BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy10518
         (381 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2E1T|A Chain A, Crystal Structure Of Dendranthema Morifolium Dmat
           Complexed With Malonyl-coa
 pdb|2E1T|B Chain B, Crystal Structure Of Dendranthema Morifolium Dmat
           Complexed With Malonyl-coa
 pdb|2E1U|A Chain A, Crystal Structure Of Dendranthema Morifolium Dmat
 pdb|2E1U|B Chain B, Crystal Structure Of Dendranthema Morifolium Dmat
          Length = 454

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 231 PIHSWVLPWVPLLGHHFSTAIYPTIRHKLSAALVNWHPSDYSARLLILP 279
           PI++     +P+    F+  + P I+H LS  L +++P  +  +L++ P
Sbjct: 41  PINNLFFYELPITRSQFTETVVPNIKHSLSITLKHFYP--FVGKLVVYP 87


>pdb|2E1V|A Chain A, Crystal Structure Of Dendranthema Morifolium Dmat, Seleno-
           Methionine Derivative
 pdb|2E1V|B Chain B, Crystal Structure Of Dendranthema Morifolium Dmat, Seleno-
           Methionine Derivative
          Length = 454

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 231 PIHSWVLPWVPLLGHHFSTAIYPTIRHKLSAALVNWHPSDYSARLLILP 279
           PI++     +P+    F+  + P I+H LS  L +++P  +  +L++ P
Sbjct: 41  PINNLFFYELPITRSQFTETVVPNIKHSLSITLKHFYP--FVGKLVVYP 87


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.134    0.446 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,536,792
Number of Sequences: 62578
Number of extensions: 436367
Number of successful extensions: 930
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 929
Number of HSP's gapped (non-prelim): 7
length of query: 381
length of database: 14,973,337
effective HSP length: 101
effective length of query: 280
effective length of database: 8,652,959
effective search space: 2422828520
effective search space used: 2422828520
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (24.6 bits)