BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy10518
(381 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2E1T|A Chain A, Crystal Structure Of Dendranthema Morifolium Dmat
Complexed With Malonyl-coa
pdb|2E1T|B Chain B, Crystal Structure Of Dendranthema Morifolium Dmat
Complexed With Malonyl-coa
pdb|2E1U|A Chain A, Crystal Structure Of Dendranthema Morifolium Dmat
pdb|2E1U|B Chain B, Crystal Structure Of Dendranthema Morifolium Dmat
Length = 454
Score = 30.8 bits (68), Expect = 1.4, Method: Compositional matrix adjust.
Identities = 13/49 (26%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
Query: 231 PIHSWVLPWVPLLGHHFSTAIYPTIRHKLSAALVNWHPSDYSARLLILP 279
PI++ +P+ F+ + P I+H LS L +++P + +L++ P
Sbjct: 41 PINNLFFYELPITRSQFTETVVPNIKHSLSITLKHFYP--FVGKLVVYP 87
>pdb|2E1V|A Chain A, Crystal Structure Of Dendranthema Morifolium Dmat, Seleno-
Methionine Derivative
pdb|2E1V|B Chain B, Crystal Structure Of Dendranthema Morifolium Dmat, Seleno-
Methionine Derivative
Length = 454
Score = 30.4 bits (67), Expect = 1.6, Method: Compositional matrix adjust.
Identities = 13/49 (26%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
Query: 231 PIHSWVLPWVPLLGHHFSTAIYPTIRHKLSAALVNWHPSDYSARLLILP 279
PI++ +P+ F+ + P I+H LS L +++P + +L++ P
Sbjct: 41 PINNLFFYELPITRSQFTETVVPNIKHSLSITLKHFYP--FVGKLVVYP 87
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.134 0.446
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,536,792
Number of Sequences: 62578
Number of extensions: 436367
Number of successful extensions: 930
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 929
Number of HSP's gapped (non-prelim): 7
length of query: 381
length of database: 14,973,337
effective HSP length: 101
effective length of query: 280
effective length of database: 8,652,959
effective search space: 2422828520
effective search space used: 2422828520
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (24.6 bits)