Query         psy10521
Match_columns 66
No_of_seqs    96 out of 98
Neff          5.1 
Searched_HMMs 46136
Date          Fri Aug 16 20:20:48 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10521.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10521hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd05845 Ig2_L1-CAM_like Second  98.7 2.6E-08 5.6E-13   61.9   4.4   45    5-49     46-90  (95)
  2 cd05726 Ig4_Robo Fhird immunog  98.5 3.9E-07 8.5E-12   53.7   5.8   50    7-61     37-86  (90)
  3 cd05852 Ig5_Contactin-1 Fifth   98.5   1E-07 2.3E-12   55.3   3.1   34    7-41     29-62  (73)
  4 cd05853 Ig6_Contactin-4 Sixth   98.4 3.6E-07 7.7E-12   55.4   4.5   48    7-59     33-84  (85)
  5 cd05727 Ig2_Contactin-2-like S  98.4 3.8E-07 8.2E-12   56.8   3.8   40    9-49     52-91  (96)
  6 cd05738 Ig2_RPTP_IIa_LAR_like   98.4 8.3E-07 1.8E-11   50.9   4.4   46    7-56     28-73  (74)
  7 cd05734 Ig7_DSCAM Seventh immu  98.3 7.5E-07 1.6E-11   51.3   3.9   36    7-43     34-69  (79)
  8 cd05723 Ig4_Neogenin Fourth im  98.3   2E-06 4.3E-11   48.9   5.3   33    8-41     28-60  (71)
  9 cd04969 Ig5_Contactin_like Fif  98.3 8.9E-07 1.9E-11   50.3   3.0   35    7-42     29-63  (73)
 10 cd04970 Ig6_Contactin_like Six  98.3 1.5E-06 3.3E-11   50.6   4.0   41   14-59     44-84  (85)
 11 cd05854 Ig6_Contactin-2 Sixth   98.2 4.1E-06   9E-11   49.6   5.1   39   16-59     46-84  (85)
 12 cd05746 Ig4_Peroxidasin Fourth  98.2 1.8E-06 3.8E-11   48.8   3.1   35    7-42     26-60  (69)
 13 cd05745 Ig3_Peroxidasin Third   98.2 1.9E-06 4.1E-11   49.1   3.2   35    7-42     30-64  (74)
 14 cd05725 Ig3_Robo Third immunog  98.1 3.7E-06 8.1E-11   47.1   3.2   34    8-42     26-59  (69)
 15 cd05724 Ig2_Robo Second immuno  98.1 7.3E-06 1.6E-10   47.0   4.5   34    8-42     42-75  (86)
 16 cd05892 Ig_Myotilin_C C-termin  98.1 9.3E-06   2E-10   47.5   4.7   36    8-45     28-67  (75)
 17 cd05741 Ig_CEACAM_D1_like Firs  98.0 1.1E-05 2.4E-10   46.9   4.3   33    8-41     48-80  (92)
 18 cd05866 Ig1_NCAM-2 First immun  98.0 9.1E-06   2E-10   49.3   4.1   39    7-47     43-84  (92)
 19 cd05774 Ig_CEACAM_D1 First imm  98.0 8.8E-06 1.9E-10   50.9   4.0   34    7-41     60-93  (105)
 20 KOG3513|consensus               98.0 1.2E-05 2.5E-10   66.7   5.2   49    6-59    468-516 (1051)
 21 cd05735 Ig8_DSCAM Eight immuno  98.0 2.4E-05 5.1E-10   46.5   5.0   46    9-59     32-84  (88)
 22 cd05765 Ig_3 Subgroup of the i  97.9 1.9E-05   4E-10   44.8   4.3   36    9-46     39-74  (81)
 23 cd05865 Ig1_NCAM-1 First immun  97.9 3.7E-05   8E-10   46.8   5.3   41    8-49     47-91  (96)
 24 cd05763 Ig_1 Subgroup of the i  97.9 4.6E-05 9.9E-10   43.2   5.3   44    8-56     30-74  (75)
 25 cd05760 Ig2_PTK7 Second immuno  97.9 6.1E-05 1.3E-09   43.4   5.8   45    9-56     29-74  (77)
 26 cd05757 Ig2_IL1R_like Second i  97.9 5.6E-05 1.2E-09   45.8   5.7   34   14-48     49-82  (92)
 27 cd05744 Ig_Myotilin_C_like Imm  97.9 4.6E-05 9.9E-10   43.9   4.8   33    8-41     28-64  (75)
 28 cd05893 Ig_Palladin_C C-termin  97.8 3.3E-05 7.2E-10   45.0   4.2   36    8-45     28-67  (75)
 29 cd05736 Ig2_Follistatin_like S  97.8 6.7E-05 1.5E-09   42.5   5.0   45    9-58     30-75  (76)
 30 cd05871 Ig_Semaphorin_classIII  97.8 5.8E-05 1.3E-09   45.4   4.9   46    8-58     45-90  (91)
 31 cd05764 Ig_2 Subgroup of the i  97.8 3.2E-05   7E-10   43.5   3.6   34    7-41     30-63  (74)
 32 cd07702 Ig2_VEGFR-1 Second imm  97.8 2.6E-05 5.7E-10   45.7   3.2   38    9-48     29-66  (72)
 33 cd05870 Ig5_NCAM-2 Fifth immun  97.7 5.8E-05 1.3E-09   45.1   3.8   35    8-43     52-89  (98)
 34 cd05730 Ig3_NCAM-1_like Third   97.7 0.00014 2.9E-09   42.8   5.2   33    9-42     49-82  (95)
 35 cd04977 Ig1_NCAM-1_like First   97.7 9.8E-05 2.1E-09   44.0   4.6   35    9-44     45-83  (92)
 36 cd05740 Ig_CEACAM_D4 Fourth im  97.7 9.1E-05   2E-09   44.4   4.4   44    9-56     46-90  (91)
 37 cd04983 IgV_TCR_alpha_like Imm  97.6 0.00012 2.7E-09   43.7   4.5   49    7-57     55-109 (109)
 38 cd05742 Ig1_VEGFR_like First i  97.6 7.1E-05 1.5E-09   43.4   3.2   27   16-43     48-74  (84)
 39 cd05867 Ig4_L1-CAM_like Fourth  97.6 7.7E-05 1.7E-09   42.6   3.2   34   10-46     35-68  (76)
 40 cd05732 Ig5_NCAM-1_like Fifth   97.6 0.00013 2.8E-09   42.7   4.2   36    8-44     50-88  (96)
 41 PHA02785 IL-beta-binding prote  97.6 0.00014   3E-09   52.4   5.1   37    8-45    168-204 (326)
 42 cd04976 Ig2_VEGFR Second immun  97.6 7.9E-05 1.7E-09   42.5   3.1   32   13-45     31-62  (71)
 43 cd04979 Ig_Semaphorin_C Immuno  97.6 0.00016 3.4E-09   42.3   4.5   37    9-47     44-80  (89)
 44 cd05743 Ig_Perlecan_D2_like Im  97.6 7.9E-05 1.7E-09   42.8   3.0   34    8-42     30-66  (78)
 45 cd04968 Ig3_Contactin_like Thi  97.6 7.1E-05 1.5E-09   43.6   2.6   38   14-56     50-87  (88)
 46 cd04984 IgV_L_lambda Immunoglo  97.5 0.00016 3.6E-09   43.0   4.2   45    8-56     51-98  (98)
 47 cd05722 Ig1_Neogenin First imm  97.5 0.00028   6E-09   41.7   5.1   45    9-56     46-95  (95)
 48 cd05751 Ig1_LILRB1_like First   97.5   7E-05 1.5E-09   44.6   2.3   40   16-57     52-91  (91)
 49 cd05758 Ig5_KIRREL3-like Fifth  97.5 0.00013 2.9E-09   43.5   3.6   35    8-42     48-89  (98)
 50 cd05895 Ig_Pro_neuregulin-1 Im  97.5  0.0001 2.2E-09   41.9   2.9   28   16-45     43-70  (76)
 51 cd05775 Ig_SLAM-CD84_like_N N-  97.5 0.00021 4.6E-09   43.1   4.4   36    9-46     52-88  (97)
 52 cd05869 Ig5_NCAM-1 Fifth immun  97.5 0.00013 2.9E-09   43.4   3.5   35    8-43     51-88  (97)
 53 cd05876 Ig3_L1-CAM Third immun  97.5 0.00011 2.5E-09   41.6   3.0   29   13-42     32-60  (71)
 54 cd05747 Ig5_Titin_like M5, fif  97.5 0.00021 4.5E-09   42.1   3.9   33    8-41     47-82  (92)
 55 smart00408 IGc2 Immunoglobulin  97.5 0.00023 4.9E-09   36.8   3.6   28   13-41     35-62  (63)
 56 cd05862 Ig1_VEGFR First immuno  97.5 0.00025 5.5E-09   42.0   4.2   38   16-58     49-86  (86)
 57 cd04978 Ig4_L1-NrCAM_like Four  97.4 0.00032 6.9E-09   39.3   4.3   33   11-45     35-67  (76)
 58 cd00099 IgV Immunoglobulin var  97.4 0.00019   4E-09   42.3   3.4   47    8-56     53-105 (105)
 59 PF07686 V-set:  Immunoglobulin  97.4  0.0002 4.4E-09   41.7   3.5   46    7-56     64-114 (114)
 60 cd04975 Ig4_SCFR_like Fourth i  97.4 0.00048   1E-08   42.4   5.2   25   17-42     65-89  (101)
 61 cd05728 Ig4_Contactin-2-like F  97.4 0.00021 4.7E-09   41.7   3.4   33    8-42     43-75  (85)
 62 cd04971 Ig_TrKABC_d5 Fifth dom  97.4 0.00011 2.4E-09   43.4   2.2   26   16-42     45-70  (81)
 63 cd04974 Ig3_FGFR Third immunog  97.4 0.00016 3.4E-09   42.8   2.7   25   17-42     55-79  (90)
 64 cd05861 Ig1_PDGFR-alphabeta Fr  97.4 0.00037   8E-09   40.9   4.1   38   16-56     45-82  (84)
 65 cd05868 Ig4_NrCAM Fourth immun  97.3  0.0006 1.3E-08   39.2   4.7   30   15-46     39-68  (76)
 66 cd05873 Ig_Sema4D_like Immunog  97.3 0.00025 5.4E-09   43.1   3.1   30    9-40     41-70  (87)
 67 cd04973 Ig1_FGFR First immunog  97.3 0.00033 7.2E-09   40.5   3.5   32    8-41     37-68  (79)
 68 cd05882 Ig1_Necl-1 First (N-te  97.3 0.00038 8.2E-09   42.4   3.9   32    8-40     49-84  (95)
 69 cd04967 Ig1_Contactin First Ig  97.3 0.00036 7.7E-09   41.0   3.6   29   13-42     54-83  (91)
 70 cd05737 Ig_Myomesin_like_C C-t  97.3 0.00032   7E-09   41.4   3.4   34    8-42     45-82  (92)
 71 cd05851 Ig3_Contactin-1 Third   97.3 0.00061 1.3E-08   40.2   4.6   37   15-56     51-87  (88)
 72 cd05849 Ig1_Contactin-1 First   97.3 0.00041   9E-09   41.7   3.9   33    8-42     49-82  (93)
 73 cd05850 Ig1_Contactin-2 First   97.3 0.00045 9.8E-09   41.2   3.9   31   10-42     52-83  (94)
 74 cd05748 Ig_Titin_like Immunogl  97.3 0.00058 1.3E-08   38.4   4.2   35    7-42     27-64  (74)
 75 cd05894 Ig_C5_MyBP-C C5 immuno  97.3 0.00041 8.9E-09   41.0   3.6   35    8-43     40-77  (86)
 76 cd05864 Ig2_VEGFR-2 Second imm  97.3 0.00023   5E-09   41.1   2.4   29   15-44     32-60  (70)
 77 KOG4221|consensus               97.3 0.00048   1E-08   58.4   5.1   49    5-57    181-229 (1381)
 78 cd05848 Ig1_Contactin-5 First   97.2  0.0004 8.7E-09   41.6   3.3   27   14-41     55-82  (94)
 79 cd05717 Ig1_Necl-1-3_like Firs  97.2 0.00064 1.4E-08   40.1   4.1   33    8-41     49-85  (95)
 80 cd05731 Ig3_L1-CAM_like Third   97.2 0.00027 5.9E-09   39.0   2.3   27   15-42     34-60  (71)
 81 cd07701 Ig1_Necl-3 First (N-te  97.2 0.00055 1.2E-08   41.3   3.7   32    7-39     48-83  (95)
 82 cd05863 Ig2_VEGFR-3 Second imm  97.2 0.00029 6.2E-09   40.7   2.3   28   16-44     30-57  (67)
 83 cd04980 IgV_L_kappa Immunoglob  97.2  0.0005 1.1E-08   41.4   3.4   44    9-56     60-106 (106)
 84 cd05888 Ig1_Nectin-4_like Frst  97.2 0.00076 1.7E-08   40.8   4.1   29   16-45     63-91  (100)
 85 cd05718 Ig1_PVR_like First imm  97.2  0.0014 3.1E-08   38.3   5.1   36    8-44     49-88  (98)
 86 cd05875 Ig6_hNeurofascin_like   97.2 0.00087 1.9E-08   38.8   4.1   36    7-42     28-67  (77)
 87 cd05762 Ig8_MLCK Eighth immuno  97.1 0.00058 1.2E-08   41.3   3.2   47    8-59     44-93  (98)
 88 PF07679 I-set:  Immunoglobulin  97.1 0.00042   9E-09   39.6   2.4   38    8-47     44-84  (90)
 89 cd05733 Ig6_L1-CAM_like Sixth   97.1  0.0012 2.6E-08   37.9   4.3   34    8-42     29-67  (77)
 90 cd05750 Ig_Pro_neuregulin Immu  97.1 0.00043 9.2E-09   38.6   2.3   26   16-42     42-67  (75)
 91 cd05886 Ig1_Nectin-1_like Firs  97.1  0.0011 2.3E-08   40.9   4.2   36    8-44     50-89  (99)
 92 cd05858 Ig3_FGFR-2 Third immun  97.1 0.00024 5.2E-09   41.8   1.1   25   17-42     55-79  (90)
 93 cd07693 Ig1_Robo First immunog  97.1  0.0012 2.6E-08   37.9   4.1   45    8-56     50-99  (100)
 94 cd05713 Ig_MOG_like Immunoglob  97.1 0.00064 1.4E-08   40.3   2.9   31    9-40     51-87  (100)
 95 cd05887 Ig1_Nectin-3_like Firs  97.1  0.0012 2.6E-08   40.8   4.2   33   16-49     59-91  (96)
 96 cd05899 IgV_TCR_beta Immunoglo  97.0  0.0011 2.5E-08   40.1   4.0   47    8-56     59-110 (110)
 97 cd05712 Ig_Siglec_N Immunoglob  97.0   0.002 4.3E-08   39.9   5.0   32    8-40     66-102 (119)
 98 cd05752 Ig1_FcgammaR_like Frst  97.0  0.0012 2.5E-08   38.8   3.5   31    8-40     38-68  (78)
 99 cd05897 Ig2_IL1R2_like Second   97.0  0.0026 5.7E-08   39.2   5.1   29   16-45     54-82  (95)
100 cd05855 Ig_TrkB_d5 Fifth domai  97.0 0.00063 1.4E-08   40.6   2.2   26   16-42     43-68  (79)
101 cd05878 Ig_Aggrecan_like Immun  96.9  0.0015 3.2E-08   40.4   3.7   33    8-41     57-95  (110)
102 cd05756 Ig1_IL1R_like First im  96.9  0.0022 4.9E-08   38.7   4.4   30   15-46     58-87  (94)
103 cd05877 Ig_LP_like Immunoglobu  96.9  0.0015 3.2E-08   39.1   3.3   32    8-40     55-90  (106)
104 cd05714 Ig_CSPGs_LP Immunoglob  96.9  0.0012 2.5E-08   39.7   2.9   24   16-40     67-90  (106)
105 cd05856 Ig2_FGFRL1-like Second  96.8 0.00067 1.5E-08   38.0   1.7   25   16-41     47-71  (82)
106 cd04981 IgV_H Immunoglobulin (  96.8  0.0019 4.1E-08   40.2   3.8   48    8-57     62-117 (117)
107 cd05872 Ig_Sema4B_like Immunog  96.8  0.0013 2.9E-08   39.9   2.9   32    6-39     37-68  (85)
108 cd05874 Ig6_NrCAM Sixth immuno  96.8   0.003 6.5E-08   36.5   4.2   34    8-41     29-66  (77)
109 cd05880 Ig_EVA1 Immunoglobulin  96.8   0.001 2.2E-08   41.4   2.3   26   16-42     78-103 (115)
110 cd05754 Ig3_Perlecan_like Thir  96.8 0.00075 1.6E-08   39.0   1.5   26   15-41     50-75  (85)
111 cd05879 Ig_P0 Immunoglobulin (  96.8  0.0011 2.3E-08   42.0   2.2   27   16-43     79-105 (116)
112 cd05881 Ig1_Necl-2 First (N-te  96.8  0.0034 7.3E-08   38.7   4.4   32    7-39     48-83  (95)
113 cd05857 Ig2_FGFR Second immuno  96.8  0.0012 2.7E-08   37.7   2.3   25   16-41     50-74  (85)
114 smart00410 IG_like Immunoglobu  96.7   0.005 1.1E-07   33.0   4.6   35    8-43     39-76  (86)
115 smart00409 IG Immunoglobulin.   96.7   0.005 1.1E-07   33.0   4.6   35    8-43     39-76  (86)
116 cd05773 Ig8_hNephrin_like Eigh  96.7  0.0024 5.3E-08   39.2   3.7   38   17-59     69-107 (109)
117 PF00047 ig:  Immunoglobulin do  96.7  0.0016 3.4E-08   35.3   2.4   18   19-37     47-64  (64)
118 cd04972 Ig_TrkABC_d4 Fourth do  96.7  0.0013 2.9E-08   38.5   2.2   27   15-42     54-80  (90)
119 cd05859 Ig4_PDGFR-alpha Fourth  96.7  0.0026 5.7E-08   38.9   3.5   26   17-44     65-90  (101)
120 cd05771 IgC_Tapasin_R Tapasin-  96.7  0.0017 3.7E-08   40.8   2.7   22   18-40      2-23  (139)
121 cd05900 Ig_Aggrecan Immunoglob  96.7  0.0034 7.4E-08   39.5   4.0   35    9-44     60-100 (112)
122 KOG3513|consensus               96.6  0.0038 8.3E-08   52.3   5.3   53    3-57    177-231 (1051)
123 smart00406 IGv Immunoglobulin   96.6  0.0013 2.8E-08   36.4   1.5   30    7-37     47-81  (81)
124 cd05898 Ig5_KIRREL3 Fifth immu  96.6   0.004 8.6E-08   38.6   3.8   36    8-43     48-90  (98)
125 cd05753 Ig2_FcgammaR_like Seco  96.5  0.0015 3.2E-08   38.4   1.7   25   16-41     47-71  (83)
126 cd04982 IgV_TCR_gamma Immunogl  96.5  0.0054 1.2E-07   37.2   4.2   47    8-56     63-116 (116)
127 PHA02826 IL-1 receptor-like pr  96.5  0.0056 1.2E-07   42.6   4.8   38    8-46    178-216 (227)
128 cd05715 Ig_P0-like Immunoglobu  96.4  0.0028 6.2E-08   38.9   2.4   23   17-40     80-102 (116)
129 cd07706 IgV_TCR_delta Immunogl  96.4  0.0072 1.6E-07   36.8   4.2   48    8-57     58-115 (116)
130 cd05891 Ig_M-protein_C C-termi  96.4  0.0077 1.7E-07   35.7   4.1   36    8-44     45-84  (92)
131 PHA02826 IL-1 receptor-like pr  96.4  0.0043 9.3E-08   43.2   3.4   26   15-41     96-121 (227)
132 cd05846 Ig1_MRC-OX-2_like Firs  96.3  0.0054 1.2E-07   36.5   3.3   28   16-44     60-87  (97)
133 cd07690 Ig1_CD4 First immunogl  96.3  0.0019   4E-08   39.6   1.2   21   19-40     67-87  (94)
134 cd05889 Ig1_DNAM-1_like First   96.2   0.007 1.5E-07   37.3   3.3   32   16-48     59-90  (96)
135 PF13927 Ig_3:  Immunoglobulin   96.1  0.0059 1.3E-07   32.8   2.4   28   11-39     48-75  (75)
136 cd05729 Ig2_FGFR_like Second i  96.1  0.0066 1.4E-07   33.9   2.6   24   17-41     51-74  (85)
137 KOG4222|consensus               96.1    0.01 2.2E-07   50.5   4.6   48    9-60    179-226 (1281)
138 cd07700 IgV_CD8_beta Immunoglo  96.0   0.011 2.5E-07   35.8   3.5   45    8-56     58-107 (107)
139 cd05902 Ig_Neurocan Immunoglob  95.9    0.01 2.3E-07   37.2   3.1   33    8-41     57-95  (110)
140 cd05716 Ig_pIgR Immunoglobulin  95.8   0.011 2.5E-07   34.8   3.0   34    7-41     49-87  (98)
141 PHA02785 IL-beta-binding prote  95.7   0.012 2.5E-07   42.5   3.1   25   16-41    291-315 (326)
142 cd05901 Ig_Versican Immunoglob  95.7   0.013 2.9E-07   37.6   3.0   36    8-44     64-105 (117)
143 PF13895 Ig_2:  Immunoglobulin   95.5   0.028   6E-07   30.7   3.7   24   18-42     46-69  (80)
144 PHA03376 BARF1; Provisional     95.3   0.057 1.2E-06   38.5   5.4   50    8-58     75-131 (221)
145 KOG4221|consensus               95.0   0.055 1.2E-06   46.5   5.3   48    9-61    283-330 (1381)
146 cd05739 Ig3_RPTP_IIa_LAR_like   94.9   0.038 8.2E-07   31.3   3.0   23   16-41     37-59  (69)
147 KOG4194|consensus               94.9   0.056 1.2E-06   44.3   4.9   52    8-64    659-712 (873)
148 cd05720 Ig_CD8_alpha Immunoglo  94.8   0.026 5.7E-07   34.2   2.4   31    8-39     57-90  (104)
149 PHA02633 hypothetical protein;  94.7   0.036 7.9E-07   32.7   2.6   25   15-40     16-40  (63)
150 cd00096 Ig Immunoglobulin doma  94.5   0.038 8.2E-07   27.5   2.1   28   13-41     39-66  (74)
151 PF07354 Sp38:  Zona-pellucida-  94.0    0.08 1.7E-06   38.8   3.8   32    9-41     29-60  (271)
152 cd05711 Ig_FcalphaRI Immunoglo  93.6   0.091   2E-06   31.4   2.9   24   16-40     54-77  (94)
153 cd05896 Ig1_IL1RAPL-1_like Fir  93.5     0.1 2.2E-06   33.2   3.1   27   14-41     67-93  (104)
154 cd00098 IgC Immunoglobulin Con  92.3    0.15 3.3E-06   29.3   2.5   34    7-43     54-87  (95)
155 cd05759 Ig2_KIRREL3-like Secon  91.9    0.17 3.6E-06   28.8   2.3   26   18-44     47-72  (82)
156 cd05885 Ig2_Necl-4 Second immu  91.2    0.24 5.2E-06   29.7   2.6   29   15-44     41-69  (80)
157 cd05749 Ig2_Tyro3_like Second   89.9    0.32 6.9E-06   28.6   2.3   24   16-42     48-71  (81)
158 KOG4222|consensus               86.2    0.52 1.1E-05   40.6   2.2   35    5-40    364-398 (1281)
159 PHA02987 Ig domain OX-2-like p  86.0     1.4   3E-05   30.8   3.9   34    9-43     73-110 (189)
160 PF07654 C1-set:  Immunoglobuli  85.8     1.6 3.6E-05   24.9   3.6   32    6-43     48-79  (83)
161 cd05761 Ig2_Necl-1-4_like Seco  85.5     1.2 2.7E-05   25.6   3.0   24   19-43     47-70  (82)
162 KOG4194|consensus               84.9    0.75 1.6E-05   38.0   2.4   40   15-58    572-611 (873)
163 smart00407 IGc1 Immunoglobulin  82.4     2.8   6E-05   23.7   3.5   22   19-41     50-71  (75)
164 cd05860 Ig4_SCFR Fourth immuno  80.5     1.7 3.7E-05   27.3   2.3   26   17-43     65-90  (101)
165 cd07705 Ig2_Necl-1 Second immu  78.1     5.5 0.00012   23.1   3.9   21   24-44     52-72  (83)
166 cd05883 Ig2_Necl-2 Second immu  77.2     2.5 5.3E-05   25.4   2.3   24   18-42     45-68  (82)
167 cd05884 Ig2_Necl-3 Second immu  74.9     6.5 0.00014   23.0   3.6   25   19-44     48-72  (83)
168 cd05771 IgC_Tapasin_R Tapasin-  74.8     5.4 0.00012   24.8   3.5   22   19-41    110-131 (139)
169 cd04986 IgC_CH2 CH2 domain (se  73.1     3.6 7.9E-05   25.5   2.3   34    5-41     56-89  (99)
170 cd07696 IgC_CH3 CH3 domain (th  71.9     4.4 9.6E-05   24.5   2.5   10   31-40     76-85  (96)
171 cd05847 IgC_CH2_IgE CH2 domain  71.5     4.7  0.0001   24.3   2.5   12   30-41     75-86  (94)
172 cd07699 IgC_L Immunoglobulin C  68.9     5.2 0.00011   24.1   2.3   31    8-41     59-89  (100)
173 cd07698 IgC_MHC_I_alpha3 Class  64.8     7.5 0.00016   22.7   2.4   19   22-41     65-83  (93)
174 cd05770 IgC_beta2m Class I maj  64.2      17 0.00037   21.9   4.0   16   24-40     67-82  (93)
175 PF08205 C2-set_2:  CD80-like C  62.2     9.8 0.00021   21.5   2.5   23   22-44     65-87  (89)
176 PHA03282 envelope glycoprotein  58.2      31 0.00068   27.7   5.3   41    3-45    111-151 (540)
177 cd05721 IgV_CTLA-4 Immunoglobu  57.3     6.3 0.00014   25.4   1.2   20   17-37     74-93  (115)
178 cd05766 IgC_MHC_II_beta Class   55.4      23  0.0005   21.0   3.4   17   24-41     67-83  (94)
179 cd05769 IgC_TCR_beta T cell re  54.9      14  0.0003   23.3   2.5   34    9-44     62-95  (115)
180 PF05083 LST1:  LST-1 protein;   51.0      16 0.00036   22.1   2.2   17   26-42     58-74  (74)
181 cd04985 IgC_CH1 CH1 domain (fi  50.7      20 0.00042   21.6   2.6   31    8-41     57-87  (95)
182 TIGR02171 Fb_sc_TIGR02171 Fibr  50.0      54  0.0012   28.0   5.7   55    1-56    353-415 (912)
183 cd05767 IgC_MHC_II_alpha Class  46.1      45 0.00097   20.0   3.7   11   30-40     73-83  (94)
184 KOG2278|consensus               45.8      20 0.00043   25.4   2.3   21    6-26     63-84  (207)
185 cd01255 PH_TIAM TIAM Pleckstri  45.4      38 0.00082   23.3   3.5   33   10-42     90-123 (160)
186 PF07202 Tcp10_C:  T-complex pr  43.9      85  0.0019   21.5   5.2   53    8-63    119-174 (179)
187 cd07703 Ig2_Nectin-2_like Seco  42.1      17 0.00037   22.1   1.4   19   23-41     64-82  (95)
188 cd05755 Ig2_ICAM-1_like Second  41.8      18 0.00039   22.4   1.5   19   24-42     68-86  (100)
189 cd07697 IgC_TCR_gamma T cell r  40.6      24 0.00052   21.4   1.9   18   23-40     67-84  (96)
190 cd05768 IgC_CH4 CH4 domain (fo  39.9      30 0.00065   20.9   2.2   11   30-40     80-90  (102)
191 PF04296 DUF448:  Protein of un  39.7      32  0.0007   20.1   2.3   29   10-38     18-46  (78)
192 cd05719 Ig2_PVR_like Second im  39.6      30 0.00064   20.8   2.2   22   23-44     64-85  (95)
193 PF01436 NHL:  NHL repeat;  Int  38.0      25 0.00055   16.6   1.4   11   13-23      9-19  (28)
194 PRK12700 flgH flagellar basal   37.5      21 0.00046   25.4   1.5   12   12-23    152-163 (230)
195 PRK12407 flgH flagellar basal   37.4      21 0.00047   25.2   1.4   12   12-23    142-153 (221)
196 cd05772 IgC_SIRP Signal-regula  36.7      29 0.00063   21.5   1.8   18   24-41     75-92  (111)
197 KOG3515|consensus               36.5      27 0.00059   29.0   2.1   34    7-41    447-481 (741)
198 PRK12701 flgH flagellar basal   35.8      24 0.00051   25.1   1.5   12   12-23    151-162 (230)
199 TIGR02227 sigpep_I_bact signal  35.8 1.2E+02  0.0027   19.6   6.6   55    1-58     30-93  (163)
200 PF08662 eIF2A:  Eukaryotic tra  34.6 1.2E+02  0.0025   20.1   4.6   41    5-49    108-153 (194)
201 KOG3260|consensus               33.8      25 0.00055   25.1   1.3   23   16-42    108-130 (224)
202 COG2063 FlgH Flagellar basal b  33.5      27 0.00058   25.1   1.4   12   12-23    155-166 (230)
203 PF11465 Receptor_2B4:  Natural  33.4      55  0.0012   21.1   2.7   36    9-46     62-98  (108)
204 PF09466 Yqai:  Hypothetical pr  33.2      43 0.00093   20.1   2.1   19    5-23     34-52  (71)
205 PRK12697 flgH flagellar basal   33.1      28 0.00061   24.8   1.5   12   12-23    148-159 (226)
206 cd00279 YlxR Ylxr homologs; gr  32.6      63  0.0014   19.2   2.8   29   10-38     19-47  (79)
207 KOG4597|consensus               32.5      30 0.00064   27.9   1.6   31    9-40    249-279 (560)
208 PRK12788 flgH flagellar basal   32.4      29 0.00063   24.8   1.5   12   12-23    156-167 (234)
209 cd07689 Ig2_VCAM-1 Second immu  32.3      54  0.0012   20.6   2.5   23   20-42     65-87  (99)
210 PHA02914 Immunoglobulin-like d  31.9      36 0.00078   27.0   2.0   18   20-38     84-101 (500)
211 PRK00249 flgH flagellar basal   31.8      30 0.00065   24.4   1.4   12   12-23    144-155 (222)
212 PF02107 FlgH:  Flagellar L-rin  31.2      31 0.00067   23.3   1.4   12   12-23    102-113 (179)
213 PRK12698 flgH flagellar basal   31.0      32 0.00069   24.3   1.5   12   12-23    145-156 (224)
214 PRK12699 flgH flagellar basal   30.9      32 0.00069   24.8   1.5   12   12-23    169-180 (246)
215 PF03498 CDtoxinA:  Cytolethal   30.7      96  0.0021   20.6   3.7   29    9-43     85-115 (150)
216 PRK12696 flgH flagellar basal   30.6      32  0.0007   24.5   1.4   12   12-23    158-169 (236)
217 COG1471 RPS4A Ribosomal protei  29.6   2E+02  0.0043   21.0   5.3   51    8-59     95-151 (241)
218 PF04571 Lipin_N:  lipin, N-ter  29.0      70  0.0015   20.6   2.7   31   16-48     25-55  (110)
219 KOG1417|consensus               28.5      50  0.0011   25.5   2.2   18    6-23    152-170 (446)
220 PRK10626 hypothetical protein;  28.5      42  0.0009   24.2   1.7   16    8-23     45-60  (239)
221 PF03460 NIR_SIR_ferr:  Nitrite  28.4      42  0.0009   18.4   1.4   20    9-28     39-58  (69)
222 PF03287 Pox_C7_F8A:  Poxvirus   27.4   2E+02  0.0043   19.5   4.7   49   10-63      6-55  (149)
223 cd07691 Ig_CD3_gamma_delta Imm  27.2      37 0.00081   20.2   1.1   18   22-39     37-54  (69)
224 COG5475 Uncharacterized small   27.1      72  0.0016   18.6   2.2   34    8-44      7-42  (60)
225 PF11101 DUF2884:  Protein of u  24.7      62  0.0013   22.6   2.0   15    9-23     24-38  (229)
226 KOG1832|consensus               24.3      76  0.0016   28.1   2.7   30    7-36   1111-1142(1516)
227 PF11901 DUF3421:  Protein of u  24.2      81  0.0018   19.8   2.3   14   27-40      6-19  (119)
228 cd00244 AlgLyase Alginate Lyas  24.0      19 0.00042   27.3  -0.7   34   13-48      8-42  (339)
229 PF00900 Ribosomal_S4e:  Riboso  22.6 1.5E+02  0.0032   17.5   3.1   34    8-42      3-38  (77)
230 PHA03269 envelope glycoprotein  22.3 1.7E+02  0.0037   23.8   4.2   40    8-48    275-319 (566)
231 PHA02854 putative host range p  21.3 2.5E+02  0.0054   19.6   4.4   48   10-62      6-54  (178)
232 cd06896 PX_PI3K_C2_gamma The p  20.8      77  0.0017   20.2   1.7   26   16-41     11-36  (101)
233 KOG1460|consensus               20.4      60  0.0013   25.1   1.3   30   16-46    136-165 (407)
234 TIGR02754 sod_Ni_protease nick  20.2 1.5E+02  0.0032   16.9   2.8   15    1-15      8-22  (90)

No 1  
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig2_L1-CAM_like: domain similar to the second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=98.70  E-value=2.6e-08  Score=61.92  Aligned_cols=45  Identities=16%  Similarity=0.121  Sum_probs=39.6

Q ss_pred             CccCCeEEEeecccEEEeecCCCCCCcceeEEeeccccCcEEecc
Q psy10521          5 DFVGGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKITGESQASV   49 (66)
Q Consensus         5 ~~~~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~   49 (66)
                      +..++|+.+.++|+|+|.||+.+|....|.|.+.|+.+++.++++
T Consensus        46 i~~~~Ri~~~~~GnL~fs~v~~~D~g~~Y~C~a~~~~~~~~~~~~   90 (95)
T cd05845          46 ITQDERVSMGQNGNLYFANVEEQDSHPDYICHAHFPGLRTIVQKE   90 (95)
T ss_pred             ccccccEEECCCceEEEEEEehhhCCCCeEEEEEcccccceEecC
Confidence            345789999999999999999999743899999999999988776


No 2  
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig4_Robo: domain similar to the fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=98.52  E-value=3.9e-07  Score=53.74  Aligned_cols=50  Identities=28%  Similarity=0.431  Sum_probs=40.3

Q ss_pred             cCCeEEEeecccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEEecccc
Q psy10521          7 VGGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSITGFRA   61 (66)
Q Consensus         7 ~~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v~ep~~   61 (66)
                      ..+||.+.++|.|.|.||+.+|. +.|.|.+.|.. |....   .+.|.|.+...
T Consensus        37 ~~~r~~v~~~~~L~I~~v~~~D~-G~Y~C~a~N~~-G~~~~---~~~l~V~~~~~   86 (90)
T cd05726          37 SSSRFSVSQTGDLTITNVQRSDV-GYYICQTLNVA-GSILT---KAYLEVTDVIA   86 (90)
T ss_pred             CCCeEEECCCCeEEEeeCChhhC-EEEEEEEEcCC-CceEE---EEEEEEeeccc
Confidence            46799999999999999999996 99999999976 44332   45888887543


No 3  
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig5_Contactin-1: fifth Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=98.51  E-value=1e-07  Score=55.30  Aligned_cols=34  Identities=26%  Similarity=0.395  Sum_probs=31.2

Q ss_pred             cCCeEEEeecccEEEeecCCCCCCcceeEEeeccc
Q psy10521          7 VGGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus         7 ~~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      .++||.++++|.|.|.||+.+|. +.|.|.+.|.+
T Consensus        29 ~~~r~~~~~~g~L~I~~v~~~D~-G~Y~C~A~N~~   62 (73)
T cd05852          29 NNSRISIWDDGSLEILNITKLDE-GSYTCFAENNR   62 (73)
T ss_pred             cCCCEEEcCCCEEEECcCChhHC-EEEEEEEECCC
Confidence            35799999999999999999996 99999999987


No 4  
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig6_Contactin-4: sixth Ig domain of the neural cell adhesion molecule contactin-4. Contactins are neural cell adhesion molecules, and are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. Highest expresson of contactin-4 is in testes, thyroid, small intestine, uterus and brain. Contactin-4 plays a role in the response of neuroblastoma cells to differentiating agents, such as retinoids. The contactin 4 gene is associated with cerebellar degeneration in spinocerebellar ataxia type 16.
Probab=98.45  E-value=3.6e-07  Score=55.36  Aligned_cols=48  Identities=21%  Similarity=0.297  Sum_probs=38.6

Q ss_pred             cCCeEEE----eecccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEEecc
Q psy10521          7 VGGKYVV----LSSGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSITGF   59 (66)
Q Consensus         7 ~~~ry~i----lpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v~ep   59 (66)
                      .+++|.+    ..+|.|.|+||+.+|. |.|.|.+.|.+-..   +. .+.|+|..|
T Consensus        33 ~~~~~~~~~~~~~~~~L~I~nv~~~ds-G~YtC~a~n~~~~~---~a-~a~L~V~~p   84 (85)
T cd05853          33 DGDHFERVGGQDSAGDLMIRSIQLKHA-GKYVCMVQTSVDKL---SA-AADLIVRGP   84 (85)
T ss_pred             CCccEEEeccCCCCCcEEEecCCHHHC-EEEEEEEEcccCce---EE-EEEEEEecC
Confidence            3558877    3679999999999996 99999999998543   33 568988876


No 5  
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig2_Contactin-2-like: second Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=98.40  E-value=3.8e-07  Score=56.76  Aligned_cols=40  Identities=23%  Similarity=0.424  Sum_probs=34.4

Q ss_pred             CeEEEeecccEEEeecCCCCCCcceeEEeeccccCcEEecc
Q psy10521          9 GKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKITGESQASV   49 (66)
Q Consensus         9 ~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~   49 (66)
                      .+++..++|+|+|.+|+.+|. +.|.|.+.|..+++.+.++
T Consensus        52 r~~~~~~~G~L~fs~v~~~D~-g~Y~C~A~n~~~~~~~~~~   91 (96)
T cd05727          52 RRFVSQTNGNLYIAKVEASDR-GNYSCFVSSPSSTKSVFSK   91 (96)
T ss_pred             CeEEeCCCCcEEEeecCHhhC-ceeEEEEEecccCCcccCC
Confidence            355555699999999999997 9999999999999977766


No 6  
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of  the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig2_RPTP_IIa_LAR_like: domain similar to the second immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple Ig-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains.
Probab=98.37  E-value=8.3e-07  Score=50.87  Aligned_cols=46  Identities=26%  Similarity=0.383  Sum_probs=36.9

Q ss_pred             cCCeEEEeecccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEE
Q psy10521          7 VGGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSI   56 (66)
Q Consensus         7 ~~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v   56 (66)
                      .+++|.+.++|.|.|.+++.+|. +.|.|.+.|.+-.....   .+.|.|
T Consensus        28 ~~~~~~~~~~g~L~i~~~~~~D~-G~Y~C~a~N~~G~~~s~---~a~l~v   73 (74)
T cd05738          28 SNGRIKQLRSGALQIENSEESDQ-GKYECVATNSAGTRYSA---PANLYV   73 (74)
T ss_pred             CCCCEEEcCCcEEEECCCChhhC-EEEEEEEECCCCceEcc---cEEEEE
Confidence            45789999999999999999995 99999999997554322   446665


No 7  
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig7_DSCAM: the seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=98.34  E-value=7.5e-07  Score=51.28  Aligned_cols=36  Identities=25%  Similarity=0.531  Sum_probs=31.9

Q ss_pred             cCCeEEEeecccEEEeecCCCCCCcceeEEeeccccC
Q psy10521          7 VGGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKITG   43 (66)
Q Consensus         7 ~~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lTg   43 (66)
                      ..+|+.+.++|.|.|.+++.+|. +.|.|.+.|.+-.
T Consensus        34 ~~~r~~~~~~~~L~I~~v~~~D~-G~Y~C~a~N~~G~   69 (79)
T cd05734          34 LAGRIQLLSNGSLLIKHVLEEDS-GYYLCKVSNDVGA   69 (79)
T ss_pred             cCCCEEEecCCeEEECcCCcccC-EEEEEEEEeCCCC
Confidence            56789888999999999999995 9999999998643


No 8  
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig4_Neogenin: fourth immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=98.32  E-value=2e-06  Score=48.90  Aligned_cols=33  Identities=18%  Similarity=0.400  Sum_probs=29.8

Q ss_pred             CCeEEEeecccEEEeecCCCCCCcceeEEeeccc
Q psy10521          8 GGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus         8 ~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      +.++.+...|.|.|.+++.+|. |.|.|.+.|.+
T Consensus        28 ~~~~~~~~~~~l~i~~v~~~D~-G~Y~C~A~N~~   60 (71)
T cd05723          28 SDYFKIVKEHNLQVLGLVKSDE-GFYQCIAENDV   60 (71)
T ss_pred             CCCEEEEecCCEEEEcCCcccC-EEEEEEEEcCC
Confidence            4578888999999999999996 99999999986


No 9  
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin. Ig5_Contactin_like: Fifth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=98.27  E-value=8.9e-07  Score=50.28  Aligned_cols=35  Identities=23%  Similarity=0.401  Sum_probs=31.1

Q ss_pred             cCCeEEEeecccEEEeecCCCCCCcceeEEeecccc
Q psy10521          7 VGGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus         7 ~~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      .+.|+.+.++|.|.|.+|+.+|. +.|.|.+.|++-
T Consensus        29 ~~~~~~~~~~~~L~i~~v~~~D~-G~Y~C~a~N~~G   63 (73)
T cd04969          29 NSSRICIWPDGSLEILNVTKSDE-GKYTCFAENFFG   63 (73)
T ss_pred             cCCCEEECCCCeEEEccCChhHC-EEEEEEEECCCC
Confidence            35688889999999999999996 899999999963


No 10 
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin. Ig6_Contactin_like: Sixth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=98.26  E-value=1.5e-06  Score=50.56  Aligned_cols=41  Identities=27%  Similarity=0.387  Sum_probs=33.3

Q ss_pred             eecccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEEecc
Q psy10521         14 LSSGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSITGF   59 (66)
Q Consensus        14 lpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v~ep   59 (66)
                      ..+|.|.|.+|+.+|+ |.|.|.+.|.+ |..  +. .++|.|..|
T Consensus        44 ~~~~~L~I~~v~~~D~-G~Y~C~a~n~~-g~~--~~-~~~l~V~~p   84 (85)
T cd04970          44 DSNGDLMIRNAQLKHA-GKYTCTAQTVV-DSL--SA-SADLIVRGP   84 (85)
T ss_pred             cccceEEEccCCHHhC-eeeEEEEecCC-CcE--EE-EEEEEEECC
Confidence            3578999999999996 99999999977 443  32 568998875


No 11 
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig6_Contactin-2: Sixth Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=98.21  E-value=4.1e-06  Score=49.56  Aligned_cols=39  Identities=26%  Similarity=0.470  Sum_probs=32.5

Q ss_pred             cccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEEecc
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSITGF   59 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v~ep   59 (66)
                      .|.|.|.||+.+|+ |.|.|.+.|.. |+...   .+.|.|.+|
T Consensus        46 ~~~L~I~~v~~~D~-G~YtC~A~n~~-g~~~~---~~~L~V~~~   84 (85)
T cd05854          46 IGDLVIVNAQLSHA-GTYTCTAQTVV-DSASA---SATLVVRGP   84 (85)
T ss_pred             EeEEEEccCChhhC-eEEEEEEecCC-CCEEE---EEEEEEECC
Confidence            68999999999996 99999999988 65443   458888764


No 12 
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin. Ig4_Peroxidasin: the fourth immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted, and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells, which have undergone programmed cell death, and protection of the organism against non-self.
Probab=98.19  E-value=1.8e-06  Score=48.79  Aligned_cols=35  Identities=26%  Similarity=0.412  Sum_probs=31.2

Q ss_pred             cCCeEEEeecccEEEeecCCCCCCcceeEEeecccc
Q psy10521          7 VGGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus         7 ~~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      .+++|.+.++|.|.|.+|+.+|. |.|.|.+.|.+=
T Consensus        26 ~~~~~~~~~~~~L~I~~~~~~D~-G~Y~C~a~N~~G   60 (69)
T cd05746          26 ESGKFHISPEGYLAIRDVGVADQ-GRYECVARNTIG   60 (69)
T ss_pred             CCCCEEECCCCEEEECcCChhhC-EEEEEEEECCCC
Confidence            35789898999999999999996 999999999873


No 13 
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin. Ig3_Peroxidasin: the third immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells which have undergone programmed cell death, and protection of the organism against non-self.
Probab=98.19  E-value=1.9e-06  Score=49.14  Aligned_cols=35  Identities=34%  Similarity=0.546  Sum_probs=30.6

Q ss_pred             cCCeEEEeecccEEEeecCCCCCCcceeEEeecccc
Q psy10521          7 VGGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus         7 ~~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      .+.++.+.++|.|.|.+|+.+|. +.|.|.+.|.+-
T Consensus        30 ~~~~~~~~~~~~L~I~~v~~~D~-G~Y~C~A~N~~G   64 (74)
T cd05745          30 VDRRHLVLSSGTLRISRVALHDQ-GQYECQAVNIVG   64 (74)
T ss_pred             CCCCeEEccCCeEEEeeCCHHhC-EEEEEEEEeCCC
Confidence            34578888999999999999995 999999999863


No 14 
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig3_Robo: domain similar to the third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=98.09  E-value=3.7e-06  Score=47.11  Aligned_cols=34  Identities=29%  Similarity=0.472  Sum_probs=30.3

Q ss_pred             CCeEEEeecccEEEeecCCCCCCcceeEEeecccc
Q psy10521          8 GGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus         8 ~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      .+++.+.+.+.|.|.+|+.+|. |.|.|.+.|.+-
T Consensus        26 ~~~~~~~~~~~L~I~~v~~~D~-G~Y~C~a~N~~G   59 (69)
T cd05725          26 KGRAEILDDKSLKIRNVTAGDE-GSYTCEAENMVG   59 (69)
T ss_pred             CCcEEEeeCCEEEECcCChhHC-EEEEEEEEcCCC
Confidence            4678888999999999999996 999999999864


No 15 
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig2_Robo: domain similar to the second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antago
Probab=98.09  E-value=7.3e-06  Score=46.97  Aligned_cols=34  Identities=21%  Similarity=0.505  Sum_probs=29.9

Q ss_pred             CCeEEEeecccEEEeecCCCCCCcceeEEeecccc
Q psy10521          8 GGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus         8 ~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      +.++.+...|.|.|.+++.+|. +.|.|.+.|..-
T Consensus        42 ~~~~~~~~~~~L~I~~~~~~D~-G~Y~C~a~N~~G   75 (86)
T cd05724          42 NERVRIVDDGNLLIAEARKSDE-GTYKCVATNMVG   75 (86)
T ss_pred             CCCEEEccCCEEEEeECCcccC-EEEEEEEEeccC
Confidence            4578888899999999999995 999999999763


No 16 
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin. Ig_Myotilin_C: C-terminal immunoglobulin (Ig)-like domain of myotilin. Mytolin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to the latter family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Myotilin is most abundant in skeletal and cardiac muscle, and is involved in maintaining sarcomere integrity. It binds to alpha-actinin, filamin and actin. Mutations in myotilin lead to muscle disorders.
Probab=98.08  E-value=9.3e-06  Score=47.49  Aligned_cols=36  Identities=22%  Similarity=0.369  Sum_probs=29.2

Q ss_pred             CCeEEEeec--c--cEEEeecCCCCCCcceeEEeeccccCcE
Q psy10521          8 GGKYVVLSS--G--DLYVFNATPNDGYKSYRCRTVNKITGES   45 (66)
Q Consensus         8 ~~ry~ilps--G--eL~I~nv~~~D~~~~Y~C~~~~~lTge~   45 (66)
                      ++||.+..+  |  .|.|.+++.+|+ |.|+|.+.|.. |+.
T Consensus        28 ~~r~~~~~~~~g~~~L~I~~~~~~D~-G~Y~C~A~N~~-G~~   67 (75)
T cd05892          28 TDRISLYQDNSGRVTLLIKNVNKKDA-GWYTVSAVNEA-GVA   67 (75)
T ss_pred             CCeEEEEEcCCCcEEEEECCCChhhC-EEEEEEEEcCc-CeE
Confidence            458888764  3  699999999996 99999999976 443


No 17 
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins. Ig_CEACAM_D1_like : immunoglobulin (IG)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily-like. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surf
Probab=98.02  E-value=1.1e-05  Score=46.86  Aligned_cols=33  Identities=21%  Similarity=0.427  Sum_probs=30.7

Q ss_pred             CCeEEEeecccEEEeecCCCCCCcceeEEeeccc
Q psy10521          8 GGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus         8 ~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      .+|+.+..+|.|.|.|++.+|+ |.|.|++...-
T Consensus        48 ~~R~~~~~~~sL~I~~l~~~Ds-G~Y~c~v~~~~   80 (92)
T cd05741          48 SGRETIYPNGSLLIQNLTKEDS-GTYTLQIISTN   80 (92)
T ss_pred             CCeEEEcCCceEEEccCCchhc-EEEEEEEEcCC
Confidence            5799999999999999999996 99999999876


No 18 
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2. Ig1_NCAM-2:  first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 (OCAM/mamFas II, RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=98.02  E-value=9.1e-06  Score=49.33  Aligned_cols=39  Identities=31%  Similarity=0.598  Sum_probs=33.0

Q ss_pred             cCCeEEEeecc---cEEEeecCCCCCCcceeEEeeccccCcEEe
Q psy10521          7 VGGKYVVLSSG---DLYVFNATPNDGYKSYRCRTVNKITGESQA   47 (66)
Q Consensus         7 ~~~ry~ilpsG---eL~I~nv~~~D~~~~Y~C~~~~~lTge~~~   47 (66)
                      .++|+.+..+|   .|.|.+|+.+|. |.|+|.+.|. .|+...
T Consensus        43 ~~~r~~~~~~g~~~~L~I~~v~~~D~-G~Y~C~A~N~-~G~~~~   84 (92)
T cd05866          43 SSQRVVVQKEGVRSRLTIYNANIEDA-GIYRCQATDA-KGQTQE   84 (92)
T ss_pred             CCCCEEEEeCCCeeEEEEecCChHHC-EEEEEEEEcC-CCcEEE
Confidence            45688888888   799999999996 9999999999 566553


No 19 
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). IG_CEACAM_D1: immunoglobulin (Ig)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the D
Probab=98.02  E-value=8.8e-06  Score=50.85  Aligned_cols=34  Identities=24%  Similarity=0.389  Sum_probs=31.1

Q ss_pred             cCCeEEEeecccEEEeecCCCCCCcceeEEeeccc
Q psy10521          7 VGGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus         7 ~~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      -.||..+.++|.|.|+||+.+|. |.|.|++.+.-
T Consensus        60 ~~gR~~~~~ngSL~I~~v~~~D~-G~Y~~~v~~~~   93 (105)
T cd05774          60 YSGRETIYPNGSLLIQNVTQKDT-GFYTLQTITTN   93 (105)
T ss_pred             cCCcEEEeCCCcEEEecCCcccC-EEEEEEEEeCC
Confidence            36899999999999999999996 99999998865


No 20 
>KOG3513|consensus
Probab=97.98  E-value=1.2e-05  Score=66.75  Aligned_cols=49  Identities=24%  Similarity=0.403  Sum_probs=39.6

Q ss_pred             ccCCeEEEeecccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEEecc
Q psy10521          6 FVGGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSITGF   59 (66)
Q Consensus         6 ~~~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v~ep   59 (66)
                      -.+|||.++++|.|-|.|++.+|+ |.|.|.+.|++-..   .+ -++|+|+++
T Consensus       468 ~~~~r~~i~edGtL~I~n~t~~Da-G~YtC~A~N~~G~a---~~-~~~L~Vkd~  516 (1051)
T KOG3513|consen  468 LQSGRIRILEDGTLEISNVTRSDA-GKYTCVAENKLGKA---ES-TGNLIVKDA  516 (1051)
T ss_pred             ccCceEEECCCCcEEecccCcccC-cEEEEEEEcccCcc---ce-EEEEEEecC
Confidence            457899999999999999999997 99999999987432   22 456666654


No 21 
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig8_DSCAM:  the eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=97.96  E-value=2.4e-05  Score=46.46  Aligned_cols=46  Identities=20%  Similarity=0.456  Sum_probs=35.1

Q ss_pred             CeEEEee--c-----ccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEEecc
Q psy10521          9 GKYVVLS--S-----GDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSITGF   59 (66)
Q Consensus         9 ~ry~ilp--s-----GeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v~ep   59 (66)
                      +||.+..  .     ..|.|.++..+|. |.|.|.+.|.+ |+...   .++|.|.++
T Consensus        32 ~r~~~~~~~~~~~~~s~L~I~~~~~~D~-G~YtC~A~N~~-G~~~~---~~~L~V~~~   84 (88)
T cd05735          32 SRYLVSTKEVGDEVISTLQILPTVREDS-GFFSCHAINSY-GEDRG---IIQLTVQEP   84 (88)
T ss_pred             CcEEEEEecCCCcEEEEEEECCCCcccC-EEEEEEEEcCC-CcceE---EEEEEEeCC
Confidence            5887754  2     5699999999996 99999999998 44333   357888764


No 22 
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily. Ig_3: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=97.95  E-value=1.9e-05  Score=44.79  Aligned_cols=36  Identities=36%  Similarity=0.613  Sum_probs=28.9

Q ss_pred             CeEEEeecccEEEeecCCCCCCcceeEEeeccccCcEE
Q psy10521          9 GKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKITGESQ   46 (66)
Q Consensus         9 ~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~   46 (66)
                      +++.+...+.|.|.+++.+|. +.|.|.+.|.. |+..
T Consensus        39 ~~~~~~~~~~L~I~~~~~~D~-G~Y~C~a~N~~-G~~~   74 (81)
T cd05765          39 GNVVVTNIGQLVIYNAQPQDA-GLYTCTARNSG-GLLR   74 (81)
T ss_pred             CCEEEccccEEEEccCCcccC-EEEEEEEecCC-ceEE
Confidence            345566678999999999996 99999999976 4433


No 23 
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. Ig1_NCAM-1: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans
Probab=97.90  E-value=3.7e-05  Score=46.80  Aligned_cols=41  Identities=32%  Similarity=0.535  Sum_probs=32.3

Q ss_pred             CCeEEEeec----ccEEEeecCCCCCCcceeEEeeccccCcEEecc
Q psy10521          8 GGKYVVLSS----GDLYVFNATPNDGYKSYRCRTVNKITGESQASV   49 (66)
Q Consensus         8 ~~ry~ilps----GeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~   49 (66)
                      +.|+.+..+    +.|.|.+|+.+|. |.|+|.+.|..-|+...+.
T Consensus        47 ~~r~~v~~~~~~~~~L~I~~v~~~D~-G~YtC~A~N~~~g~~~~s~   91 (96)
T cd05865          47 QQRISVVRNDDYSSTLTIYNANIDDA-GIYKCVVSNEDEGESEATV   91 (96)
T ss_pred             CCeEEEEeCCCCceEEEEeccChhhC-EEEEEEEEcCCCCcEEEEE
Confidence            346666543    6799999999996 9999999999877766543


No 24 
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily. Ig_1: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=97.90  E-value=4.6e-05  Score=43.23  Aligned_cols=44  Identities=18%  Similarity=0.407  Sum_probs=32.2

Q ss_pred             CCeEEEee-cccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEE
Q psy10521          8 GGKYVVLS-SGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSI   56 (66)
Q Consensus         8 ~~ry~ilp-sGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v   56 (66)
                      ..++.+.+ .+.|.|.+++.+|. +.|.|.+.|.. |+.  +. .++|.|
T Consensus        30 ~~~~~~~~~~~~L~I~~~~~~D~-G~Y~C~A~N~~-G~~--~~-~~~l~V   74 (75)
T cd05763          30 ERRMHVMPEDDVFFIVDVKIEDT-GVYSCTAQNTA-GSI--SA-NATLTV   74 (75)
T ss_pred             ccceEEecCCCEEEEeeCCcccC-EEEEEEEEcCC-CEE--Ee-eEEEEE
Confidence            34677765 57899999999995 99999999984 443  22 345554


No 25 
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4. Ig2_PTK7: domain similar to the second immunoglobulin (Ig)-like domain in protein tyrosine kinase (PTK) 7, also known as CCK4. PTK7 is a subfamily of the receptor protein tyrosine kinase family, and is referred to as an RPTK-like molecule. RPTKs transduce extracellular signals across the cell membrane, and play important roles in regulating cell proliferation, migration, and differentiation. PTK7 is organized as an extracellular portion having seven Ig-like domains, a single transmembrane region, and a cytoplasmic tyrosine kinase-like domain. PTK7 is considered a pseudokinase as it has several unusual residues in some of the highly conserved tyrosine kinase (TK) motifs; it is predicted to lack TK activity. PTK7 may function as a cell-adhesion molecule. PTK7 mRNA is expressed at high levels in placenta, melanocytes, liver, lung, pancreas, and kidney. PTK7 is overexpressed in s
Probab=97.89  E-value=6.1e-05  Score=43.38  Aligned_cols=45  Identities=36%  Similarity=0.471  Sum_probs=31.6

Q ss_pred             CeEEEee-cccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEE
Q psy10521          9 GKYVVLS-SGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSI   56 (66)
Q Consensus         9 ~ry~ilp-sGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v   56 (66)
                      +++.+.. .+.|.|.+++.+|. |.|.|.+.|.+ |+...+. ...|.|
T Consensus        29 ~~~~~~~~~~~L~I~~~~~~D~-G~Y~C~a~N~~-G~~~s~~-~~~l~v   74 (77)
T cd05760          29 GNYSVSSKERTLTLRSAGPDDS-GLYYCCAHNAF-GSVCSSQ-NFTLSI   74 (77)
T ss_pred             ccEEEeCCCCEEEEeeCCcccC-EEEEEEEEeCC-CeEeeCc-eEEEEE
Confidence            4555543 46899999999995 99999999976 4444333 334444


No 26 
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig2_IL1R_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R).  IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three IG-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta. This group also contains ILIR-like 1 (IL1
Probab=97.87  E-value=5.6e-05  Score=45.82  Aligned_cols=34  Identities=21%  Similarity=0.396  Sum_probs=29.0

Q ss_pred             eecccEEEeecCCCCCCcceeEEeeccccCcEEec
Q psy10521         14 LSSGDLYVFNATPNDGYKSYRCRTVNKITGESQAS   48 (66)
Q Consensus        14 lpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S   48 (66)
                      ...+.|.|.+|+.+|+ |.|.|.+.|..-+....-
T Consensus        49 ~~~~~L~I~~v~~~Ds-G~YtC~~~n~~~~~~~~~   82 (92)
T cd05757          49 VKGSKLLIQNVTEEDA-GNYTCKLTFTHNGKQYNV   82 (92)
T ss_pred             ecCCEEEEeeCChhhC-EEEEEEEEecCCCEEEEE
Confidence            3789999999999997 999999999877765543


No 27 
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin. Ig_Myotilin_like_C: immunoglobulin (Ig)-like domain in myotilin, palladin, and myopalladin.  Myotilin, palladin, and myopalladin function as scaffolds that regulate actin organization. Myotilin and myopalladin are most abundant in skeletal and cardiac muscle; palladin is ubiquitously expressed in the organs of developing vertebrates and  plays a key role in cellular morphogenesis. The three family members each interact with specific molecular partners: all three bind to alpha-actinin; in addition, palladin also binds to vasodilator-stimulated phosphoprotein (VASP) and ezrin, myotilin binds to filamin and actin, and myopalladin also binds to nebulin and cardiac ankyrin repeat protein (CARP).
Probab=97.85  E-value=4.6e-05  Score=43.92  Aligned_cols=33  Identities=21%  Similarity=0.280  Sum_probs=27.6

Q ss_pred             CCeEEEeecc----cEEEeecCCCCCCcceeEEeeccc
Q psy10521          8 GGKYVVLSSG----DLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus         8 ~~ry~ilpsG----eL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      ..||.+..++    .|.|.+++.+|. |.|.|.+.|..
T Consensus        28 ~~r~~~~~~~~~~~~L~I~~~~~~D~-G~Y~C~a~N~~   64 (75)
T cd05744          28 TDRISLYQDNCGRICLLIQNANKEDA-GWYTVSAVNEA   64 (75)
T ss_pred             CCcEEEEEcCCCeEEEEECCCCcccC-EEEEEEEEcCC
Confidence            3577776654    399999999996 99999999987


No 28 
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin. Ig_Palladin_C: C-terminal immunoglobulin (Ig)-like domain of palladin. Palladin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to this family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Palladin binds to alpha-actinin ezrin, vasodilator-stimulated phosphoprotein VASP, SPIN90 (DIP, mDia interacting protein), and Src. Palladin also binds F-actin directly, via its Ig3 domain. Palladin is expressed as several alternatively spliced isoforms, having various combinations of Ig-like domains, in a cell-type-specific manner. It has been suggested that palladin's different Ig-like domains may be specialized for distinct functions.
Probab=97.85  E-value=3.3e-05  Score=44.96  Aligned_cols=36  Identities=19%  Similarity=0.201  Sum_probs=29.3

Q ss_pred             CCeEEEeecc----cEEEeecCCCCCCcceeEEeeccccCcE
Q psy10521          8 GGKYVVLSSG----DLYVFNATPNDGYKSYRCRTVNKITGES   45 (66)
Q Consensus         8 ~~ry~ilpsG----eL~I~nv~~~D~~~~Y~C~~~~~lTge~   45 (66)
                      .+|+.+...+    .|.|.+|+.+|+ |.|.|.+.|.+ |+.
T Consensus        28 ~~~~~~~~~~~~~~~L~I~~v~~~D~-G~Y~C~A~N~~-G~~   67 (75)
T cd05893          28 TDRVSMHQDNCGYICLLIQGATKEDA-GWYTVSAKNEA-GIV   67 (75)
T ss_pred             CCeEEEEEcCCCEEEEEECCCCHHHC-EEEEEEEEcCC-CEE
Confidence            4678886654    599999999996 99999999986 543


No 29 
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins. Ig2_Follistatin_like: domain similar to the second immunoglobulin (Ig)-like domain found in a follistatin-like molecule encoded by the CNS-related Mahya gene. Mahya genes have been retained in certain Bilaterian branches during evolution.  They are conserved in Hymenoptera and Deuterostomes, but are absent from other metazoan species such as fruit fly and nematode. Mahya proteins are secretory, with a follistatin-like domain (Kazal-type serine/threonine protease inhibitor domain and EF-hand calcium-binding domain), two Ig-like domains, and a novel C-terminal domain. Mahya may be involved in learning and memory and in processing of sensory information in Hymenoptera and vertebrates. Follistatin is a secreted, multidomain protein that binds activins with high affinity and antagonizes their signaling.
Probab=97.81  E-value=6.7e-05  Score=42.51  Aligned_cols=45  Identities=18%  Similarity=0.312  Sum_probs=34.0

Q ss_pred             CeEEEeeccc-EEEeecCCCCCCcceeEEeeccccCcEEecccceeEEEec
Q psy10521          9 GKYVVLSSGD-LYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSITG   58 (66)
Q Consensus         9 ~ry~ilpsGe-L~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v~e   58 (66)
                      .++.+.++|. |.|.+++.+|. +.|.|.+.|.+-.. .  . ...|.|.+
T Consensus        30 ~~~~~~~~~~~l~I~~~~~~D~-G~Y~C~a~N~~G~~-~--~-~~~l~V~~   75 (76)
T cd05736          30 KQLTLIANGSELHISNVRYEDT-GAYTCIAKNEAGVD-E--D-ISSLFVED   75 (76)
T ss_pred             ccEEEeCCCCEEEECcCCcccC-EEEEEEEEcCCCCc-c--e-EEEEEEEc
Confidence            5777777774 99999999995 99999999986432 2  2 44777754


No 30 
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin. Ig_Semaphorin_class III; Immunoglobulin (Ig)-like domain of class III semaphorins. Semaphorins are classified into various classes on the basis of structural features additional to the Sema domain. Class III semaphorins are a vertebrate class having a Sema domain, an Ig domain, a short basic domain, and are secreted. They have been shown to be axonal guidance cues and have a part in the regulation of the cardiovascular, immune and respiratory systems. Sema3A, the prototype member of this class III subfamily, induces growth cone collapse and is an inhibitor of axonal sprouting. In perinatal rat cortex as a chemoattractant, it functions to direct, for pyramidal neurons, the orientated extension of apical dendrites. It may play a role, prior to the development of apical dendrites, in signaling the radial migration of newborn cortical neurons towards the upper layers. Sema3A selectively inhibits vascula
Probab=97.80  E-value=5.8e-05  Score=45.43  Aligned_cols=46  Identities=15%  Similarity=0.278  Sum_probs=34.6

Q ss_pred             CCeEEEeecccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEEec
Q psy10521          8 GGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSITG   58 (66)
Q Consensus         8 ~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v~e   58 (66)
                      ++++.+ ..+.|.|.+++.+|. +.|.|.+.++.-++...   ...|.|-+
T Consensus        45 ~~r~~~-~~~~L~I~~~~~~Ds-G~Y~C~a~~~~~~~~~~---~~~l~v~~   90 (91)
T cd05871          45 EERLIH-TERGLLLRSLQRSDA-GVYTCTAVEHSFSQTLA---KYTLHVIE   90 (91)
T ss_pred             cccEEE-ecCeEEEeeCChhHC-EEEEEEEEccCCeEEEE---EEEEEEec
Confidence            456765 456799999999997 99999999777676655   34666543


No 31 
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily. Ig_2: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=97.80  E-value=3.2e-05  Score=43.54  Aligned_cols=34  Identities=24%  Similarity=0.385  Sum_probs=30.1

Q ss_pred             cCCeEEEeecccEEEeecCCCCCCcceeEEeeccc
Q psy10521          7 VGGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus         7 ~~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      ...++.+.+.|.|.|.+++.+|. +.|.|.+.|.+
T Consensus        30 ~~~~~~~~~~~~L~i~~~~~~D~-G~Y~C~a~N~~   63 (74)
T cd05764          30 NSSRTLVYDNGTLDILITTVKDT-GSFTCIASNAA   63 (74)
T ss_pred             CCCeEEEecCCEEEEEECChhhC-EEEEEEEECCC
Confidence            34678888999999999999995 99999999986


No 32 
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). Ig2_VEGFR-1: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-1 binds VEGF-A strongly; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-1 may play an inhibitory rolet in the function of VEGFR-2 by binding VEGF-A and interfering with its interaction with VEGFR-2. VEGFR-1 has a signaling role in mediating monocyte chemotaxis and may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=97.79  E-value=2.6e-05  Score=45.69  Aligned_cols=38  Identities=18%  Similarity=0.091  Sum_probs=32.1

Q ss_pred             CeEEEeecccEEEeecCCCCCCcceeEEeeccccCcEEec
Q psy10521          9 GKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKITGESQAS   48 (66)
Q Consensus         9 ~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S   48 (66)
                      .+|.+ ..+.|.|.||+.+|+ |.|.|.+.|+..|+++.-
T Consensus        29 ~~~~~-~~~~L~I~~v~~~D~-G~YtC~a~~~~~~~~~~~   66 (72)
T cd07702          29 SRYHV-DGYSLVIKDVTEEDA-GIYTILLGIKQYNLFKNL   66 (72)
T ss_pred             cEEEe-CCCEEEECcCCHHHC-EEEEEEEEccccceEeeE
Confidence            56665 345899999999997 999999999999988754


No 33 
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). Ig5_NCAM-2: the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=97.71  E-value=5.8e-05  Score=45.07  Aligned_cols=35  Identities=23%  Similarity=0.470  Sum_probs=29.2

Q ss_pred             CCeEEEee---cccEEEeecCCCCCCcceeEEeeccccC
Q psy10521          8 GGKYVVLS---SGDLYVFNATPNDGYKSYRCRTVNKITG   43 (66)
Q Consensus         8 ~~ry~ilp---sGeL~I~nv~~~D~~~~Y~C~~~~~lTg   43 (66)
                      ++||.+..   .+.|.|.||+.+|. +.|.|.+.|.+-.
T Consensus        52 ~~r~~v~~~~~~~~L~I~~v~~~D~-G~Y~C~A~N~~G~   89 (98)
T cd05870          52 DGRIEVKGQHGESSLHIKDVKLSDS-GRYDCEAASRIGG   89 (98)
T ss_pred             CceEEEeecCCeeEEEEeeCCcCCC-EEEEEEEeccCCc
Confidence            46888764   35799999999996 9999999998754


No 34 
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig3_NCAM-1_like: domain similar to the third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1,and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the
Probab=97.69  E-value=0.00014  Score=42.84  Aligned_cols=33  Identities=24%  Similarity=0.438  Sum_probs=27.6

Q ss_pred             CeEEEeecc-cEEEeecCCCCCCcceeEEeecccc
Q psy10521          9 GKYVVLSSG-DLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus         9 ~ry~ilpsG-eL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      .+|.+...| .|.|.+|+.+| .+.|.|.+.|.+-
T Consensus        49 ~~~~~~~~~~~L~I~~v~~~D-~G~Y~C~a~N~~G   82 (95)
T cd05730          49 EKYSFNEDGSEMTILDVDKLD-EAEYTCIAENKAG   82 (95)
T ss_pred             CEEEEeCCCCEEEECCCChhh-CEEEEEEEEcCCC
Confidence            567666655 59999999999 5999999999984


No 35 
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins. Ig1_NCAM-1 like: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the s
Probab=97.68  E-value=9.8e-05  Score=43.99  Aligned_cols=35  Identities=23%  Similarity=0.425  Sum_probs=27.6

Q ss_pred             CeEEEeecc----cEEEeecCCCCCCcceeEEeeccccCc
Q psy10521          9 GKYVVLSSG----DLYVFNATPNDGYKSYRCRTVNKITGE   44 (66)
Q Consensus         9 ~ry~ilpsG----eL~I~nv~~~D~~~~Y~C~~~~~lTge   44 (66)
                      +++.+..++    .|.|.+|+.+|. |.|+|.+.|.+-+.
T Consensus        45 ~~~~~~~~~~~~~~L~I~~v~~~D~-G~Y~C~A~N~~g~~   83 (92)
T cd04977          45 QQISVVQNDDVRSTLTIYNANIEDA-GIYKCVATDAKGTE   83 (92)
T ss_pred             CCEEEEeCCCCEEEEEEecCCcccC-EEEEEEEEcCCCCc
Confidence            455555444    799999999996 99999999986553


No 36 
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). Ig_CEACAM_D4:  immunoglobulin (Ig)-like domain 4 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the
Probab=97.68  E-value=9.1e-05  Score=44.42  Aligned_cols=44  Identities=20%  Similarity=0.305  Sum_probs=32.4

Q ss_pred             CeEEEee-cccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEE
Q psy10521          9 GKYVVLS-SGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSI   56 (66)
Q Consensus         9 ~ry~ilp-sGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v   56 (66)
                      +++.+.. .+.|.|.+|+.+|. |.|+|.+.|.+-..  .|. +..|.|
T Consensus        46 ~~~~~~~~~~~L~I~~v~~~D~-G~Y~C~a~N~~G~~--~S~-~~~L~V   90 (91)
T cd05740          46 PRLQLSNDNRTLTFNNVTRSDT-GHYQCEASNEVSNM--TSD-PYILNV   90 (91)
T ss_pred             CCEEEeCCCCEEEECcCChhhC-EEEEEEEEcCCCCE--Eee-eEEEEe
Confidence            4555554 46899999999996 99999999998432  233 556665


No 37 
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins. IgV_TCR_alpha: immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=97.63  E-value=0.00012  Score=43.68  Aligned_cols=49  Identities=20%  Similarity=0.276  Sum_probs=35.2

Q ss_pred             cCCeEEEeec-----ccEEEeecCCCCCCcceeEEeecccc-CcEEecccceeEEEe
Q psy10521          7 VGGKYVVLSS-----GDLYVFNATPNDGYKSYRCRTVNKIT-GESQASVFQTRLSIT   57 (66)
Q Consensus         7 ~~~ry~ilps-----GeL~I~nv~~~D~~~~Y~C~~~~~lT-ge~~~S~~~~~l~v~   57 (66)
                      ..+||.+..+     -.|.|.|++.+|. +.|.|++.+.-- ......+ +.+|.|.
T Consensus        55 ~~~r~~~~~~~~~~~~~L~I~~~~~~Ds-G~Y~C~~~~~~~~~~~~~g~-gt~l~V~  109 (109)
T cd04983          55 EKGRFSATLDKSRKSSSLHISAAQLSDS-AVYFCALSESGGTGKLTFGK-GTRLTVE  109 (109)
T ss_pred             cCCcEEEEEcccCCEEEEEECCCCHHHC-EEEEEEEecCCCCcceEECC-CEEEEEC
Confidence            3578877643     3799999999996 999999987642 2333343 7788763


No 38 
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins. Ig1_VEGFR_like: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) related proteins. The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF-A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF
Probab=97.62  E-value=7.1e-05  Score=43.35  Aligned_cols=27  Identities=30%  Similarity=0.415  Sum_probs=24.1

Q ss_pred             cccEEEeecCCCCCCcceeEEeeccccC
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKITG   43 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~lTg   43 (66)
                      .+.|.|.+|+.+|. |.|.|.+.|.+..
T Consensus        48 ~s~L~I~~v~~~Ds-G~Y~C~a~n~~~~   74 (84)
T cd05742          48 SSTLTIPNATLKDS-GTYTCAASSGTMD   74 (84)
T ss_pred             EEEEEECCCChhhC-EEEEEEEccCCCc
Confidence            56899999999996 9999999999744


No 39 
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig4_L1-CAM_like:  fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=97.60  E-value=7.7e-05  Score=42.59  Aligned_cols=34  Identities=29%  Similarity=0.542  Sum_probs=27.6

Q ss_pred             eEEEeecccEEEeecCCCCCCcceeEEeeccccCcEE
Q psy10521         10 KYVVLSSGDLYVFNATPNDGYKSYRCRTVNKITGESQ   46 (66)
Q Consensus        10 ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~   46 (66)
                      ++. ..+|.|.|.+++.+|. +.|.|.+.|.. |+..
T Consensus        35 ~~~-~~~~~L~I~~~~~~D~-G~Y~C~a~N~~-G~~~   68 (76)
T cd05867          35 RRH-VSSGALILTDVQPSDT-AVYQCEARNRH-GNLL   68 (76)
T ss_pred             eEE-eeCCEEEECCCChhhC-EEEEEEEECCC-CeEE
Confidence            444 4689999999999996 99999999974 5543


No 40 
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins. Ig5_NCAM-1 like: domain similar to the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic  (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM mole
Probab=97.60  E-value=0.00013  Score=42.69  Aligned_cols=36  Identities=28%  Similarity=0.522  Sum_probs=29.3

Q ss_pred             CCeEEEee---cccEEEeecCCCCCCcceeEEeeccccCc
Q psy10521          8 GGKYVVLS---SGDLYVFNATPNDGYKSYRCRTVNKITGE   44 (66)
Q Consensus         8 ~~ry~ilp---sGeL~I~nv~~~D~~~~Y~C~~~~~lTge   44 (66)
                      .+++.+..   .+.|.|.+|+.+|. |.|.|++.|.+-..
T Consensus        50 ~~~~~~~~~~~~~~L~I~~v~~~D~-G~Y~C~a~N~~G~~   88 (96)
T cd05732          50 DGRIVVRGHARVSSLTLKDVQLTDA-GRYDCEASNRIGGD   88 (96)
T ss_pred             cceEEEeCCccEEEEEECcCCcCcC-EEeEEEEEeCCCCc
Confidence            45777754   35899999999996 99999999998653


No 41 
>PHA02785 IL-beta-binding protein; Provisional
Probab=97.60  E-value=0.00014  Score=52.43  Aligned_cols=37  Identities=14%  Similarity=0.187  Sum_probs=32.9

Q ss_pred             CCeEEEeecccEEEeecCCCCCCcceeEEeeccccCcE
Q psy10521          8 GGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKITGES   45 (66)
Q Consensus         8 ~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~   45 (66)
                      ++|+...++|.|.|.||+.+|+ |.|.|.+.|...+..
T Consensus       168 ~~r~~~~~~~~L~i~~v~~~d~-G~Y~C~~~n~~g~~~  204 (326)
T PHA02785        168 NKRLKQRTPGIITIEDVRKNDA-GYYTCVLKYIYGDKT  204 (326)
T ss_pred             CcceEecCCCeEEEeecChhhC-eEEEEEEEeccCCEE
Confidence            4688888999999999999996 999999999877754


No 42 
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). Ig2_VEGFR: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A. VEGFR-1 may play an inhibitory part in these processes by binding VEGF and interfering with its interaction with VEGFR-2. VEGFR-1 has a signa
Probab=97.59  E-value=7.9e-05  Score=42.51  Aligned_cols=32  Identities=22%  Similarity=0.172  Sum_probs=27.3

Q ss_pred             EeecccEEEeecCCCCCCcceeEEeeccccCcE
Q psy10521         13 VLSSGDLYVFNATPNDGYKSYRCRTVNKITGES   45 (66)
Q Consensus        13 ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~   45 (66)
                      ....+.|.|.|++.+|+ |.|.|.+.|++-+..
T Consensus        31 ~~~~~~L~I~~v~~~D~-G~YtC~a~N~~g~~~   62 (71)
T cd04976          31 KKSGHSLTIKDVTEEDA-GNYTVVLTNKQAKLE   62 (71)
T ss_pred             EcCCCEEEECcCCHHHC-EEEEEEEEcCCccEE
Confidence            45678999999999996 999999999886643


No 43 
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin. Ig_Semaphorin_C; Immunoglobulin (Ig)-like domain in semaphorins. Semaphorins are transmembrane protein that have important roles in a variety of tissues. Functionally, semaphorins were initially characterized for their importance in the development of the nervous system and in axonal guidance. Later they have been found to be important for the formation and functioning of the cardiovascular, endocrine, gastrointestinal, hepatic, immune, musculoskeletal, renal, reproductive, and respiratory systems. Semaphorins function through binding to their receptors and transmembrane semaphorins also serves as receptors themselves. Although molecular mechanism of semaphorins is poorly understood, the Ig-like domains may involve in ligand binding or dimerization.
Probab=97.59  E-value=0.00016  Score=42.28  Aligned_cols=37  Identities=22%  Similarity=0.417  Sum_probs=28.4

Q ss_pred             CeEEEeecccEEEeecCCCCCCcceeEEeeccccCcEEe
Q psy10521          9 GKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKITGESQA   47 (66)
Q Consensus         9 ~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~   47 (66)
                      .++.+.+ +.|.|.+++.+|. |.|+|.+.+..=+++..
T Consensus        44 ~~~~~~~-~~L~I~~~~~~D~-G~Y~C~a~~~~~~~~~~   80 (89)
T cd04979          44 ERLLVTE-DGLLIRSVSPADA-GVYTCQSVEHGFKQTLA   80 (89)
T ss_pred             ceEEEcC-CCEEEccCCHHHC-EEEEEEEecCccceeEe
Confidence            4666654 5699999999996 99999999875444443


No 44 
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Ig_Perlecan_D2_like: the immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Perlecan consists of five domains. Domain I has three putative heparan sulfate attachment sites; domain II has four LDL receptor-like repeats, and one Ig-like repeat; domain III resembles the short arm of laminin chains; domain IV has multiple Ig-like repeats (21 repeats in human perlecan); and domain V resembles the globular G domain of the laminin A chain and internal repeats of EGF. Perlecan may participate in a variety of biological functions including cell binding, LDL-metabolism, basement membrane assembly and selective permeability, calcium binding, and growth- and neurite-promoting activities.
Probab=97.58  E-value=7.9e-05  Score=42.81  Aligned_cols=34  Identities=21%  Similarity=0.436  Sum_probs=27.5

Q ss_pred             CCeEEEeec---ccEEEeecCCCCCCcceeEEeecccc
Q psy10521          8 GGKYVVLSS---GDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus         8 ~~ry~ilps---GeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      +.|+.+...   +.|.|.||+.+|. +.|.|.+.|.+-
T Consensus        30 ~~~~~~~~~~~~~~L~I~~v~~~D~-G~Y~C~a~N~~G   66 (78)
T cd05743          30 SARVSITSEGGYGTLTIRDVKESDQ-GAYTCEAINTRG   66 (78)
T ss_pred             CCCEEEEECCCEEEEEECCCChHHC-EEEEEEEEecCC
Confidence            456766543   6799999999995 999999999764


No 45 
>cd04968 Ig3_Contactin_like Third Ig domain of contactin. Ig3_Contactin_like: Third Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=97.55  E-value=7.1e-05  Score=43.60  Aligned_cols=38  Identities=24%  Similarity=0.307  Sum_probs=29.3

Q ss_pred             eecccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEE
Q psy10521         14 LSSGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSI   56 (66)
Q Consensus        14 lpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v   56 (66)
                      ...|.|.|.+|+.+|. +.|.|.+.|.+-. ...   .++|.|
T Consensus        50 ~~~~~L~i~~v~~~D~-G~Y~C~a~N~~G~-~~~---~~~l~V   87 (88)
T cd04968          50 MSGAVLKIPNIQFEDE-GTYECEAENIKGK-DTH---QGRIYV   87 (88)
T ss_pred             EeCCEEEECCCCcccC-EEEEEEEEECCCc-EEE---EEEEEE
Confidence            5789999999999995 9999999998543 222   346655


No 46 
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain. IgV_L_lambda: Immunoglobulin (Ig) light chain, lambda type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=97.55  E-value=0.00016  Score=42.99  Aligned_cols=45  Identities=20%  Similarity=0.333  Sum_probs=34.6

Q ss_pred             CCeEEEeeccc---EEEeecCCCCCCcceeEEeeccccCcEEecccceeEEE
Q psy10521          8 GGKYVVLSSGD---LYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSI   56 (66)
Q Consensus         8 ~~ry~ilpsGe---L~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v   56 (66)
                      .+||.+..++.   |.|.+++.+|. +.|.|.+.+.  .+....+ +.+|+|
T Consensus        51 ~~rf~~~~~~~~~~L~I~~~~~~Ds-g~Y~C~~~~~--~~~~fg~-gT~L~V   98 (98)
T cd04984          51 PDRFSGSKSGNTASLTISGAQTEDE-ADYYCQVWDS--NSYVFGG-GTKLTV   98 (98)
T ss_pred             CCCEEEEccCCEEEEEECCCChhhC-EEEEEEEccC--CCCEECC-CEEEeC
Confidence            45888876555   99999999996 9999999864  4555565 777765


No 47 
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig1_Neogenin: first immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=97.54  E-value=0.00028  Score=41.69  Aligned_cols=45  Identities=24%  Similarity=0.366  Sum_probs=33.0

Q ss_pred             CeEEEeecccEEEeec-----CCCCCCcceeEEeeccccCcEEecccceeEEE
Q psy10521          9 GKYVVLSSGDLYVFNA-----TPNDGYKSYRCRTVNKITGESQASVFQTRLSI   56 (66)
Q Consensus         9 ~ry~ilpsGeL~I~nv-----~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v   56 (66)
                      .++.++++|.|.|.++     +.+| .+.|+|.+.|.--|+.. |. .++|+|
T Consensus        46 ~~~~~~~~~~l~i~~v~~~~~~~~D-~G~Y~C~a~N~~~G~~~-s~-~~~l~v   95 (95)
T cd05722          46 ERRQQLPNGSLLITSVVHSKHNKPD-EGFYQCVAQNDSLGSIV-SR-TARLTV   95 (95)
T ss_pred             cceEEccCCeEEEeeeeccCCCCCc-CEEEEEEEECCccCcEE-Ee-eeEEeC
Confidence            4578889999999998     4677 49999999998345543 33 455543


No 48 
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins. Ig1_LILRB1_like: domain similar to the first immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1). This group includes, LILRA5 (LIR9), an activating natural cytotoxicity receptor NKp46, and the immune-type receptor glycoprotein VI (GPVI). LILRs are a family of immunoreceptors expressed on expressed on T and B cells, on monocytes, dendritic cells, and subgroups of natural killer (NK) cells. The human LILR family contains nine proteins (LILRA1-3,and 5, and LILRB1-5). From functional assays, and as the cytoplasmic domains of various LILRs, for example LILRB1 (LIR-1), LILRB2 (LIR-2), and LILRB3 (LIR-3) contain immunoreceptor tyrosine-based inhibitory motifs (ITIMs) it is thought that LIR proteins are inhibitory receptors. Of the eight LIR family proteins, only LIR-1(LILRB1), and LIR-2 (LILRB2),
Probab=97.52  E-value=7e-05  Score=44.56  Aligned_cols=40  Identities=18%  Similarity=0.264  Sum_probs=30.7

Q ss_pred             cccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEEe
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSIT   57 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v~   57 (66)
                      .++++|.+|+.+|+ |.|+|+..+..++-...|+ +..|.|+
T Consensus        52 ~~~f~i~~v~~~~~-G~Y~C~~~~~~~~~S~~Sd-~lel~Vt   91 (91)
T cd05751          52 KAKFFIPSMKREHA-GRYRCYYRSGVALWSEPSD-PLELVVT   91 (91)
T ss_pred             eEEEEccCCChhHC-EEEEEEEECCCCccCCCCC-cEEEEeC
Confidence            56799999999996 9999999997644333444 7777774


No 49 
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins. Ig5_KIRREL3-like: domain similar to the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=97.52  E-value=0.00013  Score=43.48  Aligned_cols=35  Identities=29%  Similarity=0.468  Sum_probs=28.9

Q ss_pred             CCeEEEeec-------ccEEEeecCCCCCCcceeEEeecccc
Q psy10521          8 GGKYVVLSS-------GDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus         8 ~~ry~ilps-------GeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      ++||.+...       +.|.|.+|+.+|..+.|.|.+.|.+-
T Consensus        48 ~~r~~i~~~~~~~~~~s~L~I~~v~~~d~~G~Y~C~A~N~~G   89 (98)
T cd05758          48 SGRYTVETDPSPGGVLSTLTISNTQESDFQTSYNCTAWNSFG   89 (98)
T ss_pred             CCCEEEEEecCCCceEEEEEECCccccccceeEEEEEEcCCC
Confidence            368888764       37999999998866999999999864


No 50 
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. Ig_Pro_neuregulin-1: immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. There are many NRG-1 isoforms which arise from the alternative splicing of mRNA. NRG-1 belongs to the neuregulin gene family, which is comprised of four genes. This group represents NRG-1. NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, and heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. The NRG-1 protein binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates process
Probab=97.51  E-value=0.0001  Score=41.88  Aligned_cols=28  Identities=29%  Similarity=0.577  Sum_probs=24.3

Q ss_pred             cccEEEeecCCCCCCcceeEEeeccccCcE
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKITGES   45 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~lTge~   45 (66)
                      .+.|.|.+++.+|. |.|.|++.|.+ |+.
T Consensus        43 ~~~L~I~~~~~~Ds-G~Y~C~a~N~~-g~~   70 (76)
T cd05895          43 SSELQISKASLADN-GEYKCMVSSKL-GND   70 (76)
T ss_pred             EEEEEECcCCcccC-EEEEEEEEeCC-Cce
Confidence            46799999999996 99999999998 443


No 51 
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. Ig_SLAM-CD84_like_N: The N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. The SLAM family is a group of immune-cell specific receptors that can regulate both adaptive and innate immune responses. Members of this group include proteins such as CD84, SLAM (CD150), Ly-9 (CD229), NTB-A (ly-108, SLAM6), 19A (CRACC), and SLAMF9. The genes coding for the SLAM family are nested on chromosome 1, in humans at 1q23, and in mice at 1H2. The SLAM family is a subset of the CD2 family, which also includes CD2 and CD58 located on chromosome 1 at 1p13 in humans. In mice, CD2 is located on chromosome 3, and there is no CD58 homolog. The SLAM family proteins are organized as an extracellular domain with either two or four Ig-like domains, a single transmembrane segment, and a cytoplasmic region 
Probab=97.51  E-value=0.00021  Score=43.09  Aligned_cols=36  Identities=22%  Similarity=0.184  Sum_probs=30.1

Q ss_pred             CeEEEee-cccEEEeecCCCCCCcceeEEeeccccCcEE
Q psy10521          9 GKYVVLS-SGDLYVFNATPNDGYKSYRCRTVNKITGESQ   46 (66)
Q Consensus         9 ~ry~ilp-sGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~   46 (66)
                      +|+.+.+ ++.|.|+|++.+|. |.|.|++.+.- |+..
T Consensus        52 ~R~~~~~~~~sL~I~~~~~~Ds-G~Y~c~v~~~~-~~~~   88 (97)
T cd05775          52 ERVNFSQNDYSLQISNLKMEDA-GSYRAEINTKN-GVTI   88 (97)
T ss_pred             eeEEecCCceeEEECCCchHHC-EEEEEEEEcCC-CCeE
Confidence            5787876 59999999999996 99999999876 4443


No 52 
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig5_NCAM-1: The fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM) and heterophilic (NCAM-non-NCAM) interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (tr
Probab=97.51  E-value=0.00013  Score=43.42  Aligned_cols=35  Identities=29%  Similarity=0.341  Sum_probs=28.0

Q ss_pred             CCeEEEee---cccEEEeecCCCCCCcceeEEeeccccC
Q psy10521          8 GGKYVVLS---SGDLYVFNATPNDGYKSYRCRTVNKITG   43 (66)
Q Consensus         8 ~~ry~ilp---sGeL~I~nv~~~D~~~~Y~C~~~~~lTg   43 (66)
                      .+++.+..   .+.|.|.+|+.+|. |.|.|.+.|.+=.
T Consensus        51 ~~~~~v~~~~~~~~L~I~~v~~~D~-G~Y~C~A~N~~G~   88 (97)
T cd05869          51 DGHIVVRSHARVSSLTLKYIQYTDA-GEYLCTASNTIGQ   88 (97)
T ss_pred             CccEEEEcCccEEEEEEecCccCcC-EEEEEEEecCCCC
Confidence            35666643   36899999999996 9999999998654


No 53 
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM:  third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=97.51  E-value=0.00011  Score=41.56  Aligned_cols=29  Identities=21%  Similarity=0.253  Sum_probs=25.7

Q ss_pred             EeecccEEEeecCCCCCCcceeEEeecccc
Q psy10521         13 VLSSGDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus        13 ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      ....|.|.|.+++.+|. |.|.|.+.|.+-
T Consensus        32 ~~~~~~L~I~~v~~~D~-G~Y~C~a~N~~G   60 (71)
T cd05876          32 LNNNKTLQLDNVLESDD-GEYVCTAENSEG   60 (71)
T ss_pred             EcCCCEEEEcccCHHhC-EEEEEEEEcCCC
Confidence            45689999999999995 999999999984


No 54 
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins. Ig5_Titin_like: domain similar to the M5, fifth immunoglobulin (Ig)-like domain from the human titin C terminus. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic; depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone, and appears to function similar to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching.
Probab=97.47  E-value=0.00021  Score=42.10  Aligned_cols=33  Identities=12%  Similarity=0.122  Sum_probs=28.1

Q ss_pred             CCeEEEeec---ccEEEeecCCCCCCcceeEEeeccc
Q psy10521          8 GGKYVVLSS---GDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus         8 ~~ry~ilps---GeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      +.||.+.+.   +.|.|.+++.+|. |.|.|.+.|.+
T Consensus        47 ~~~~~~~~~~~~~~L~i~~~~~~D~-G~Y~C~a~N~~   82 (92)
T cd05747          47 SQRHQITSTEYKSTFEISKVQMSDE-GNYTVVVENSE   82 (92)
T ss_pred             CCcEEEEEcCCeeEEEECCCCcccC-EeEEEEEEcCC
Confidence            457887664   5899999999996 99999999976


No 55 
>smart00408 IGc2 Immunoglobulin C-2 Type.
Probab=97.46  E-value=0.00023  Score=36.76  Aligned_cols=28  Identities=21%  Similarity=0.322  Sum_probs=23.9

Q ss_pred             EeecccEEEeecCCCCCCcceeEEeeccc
Q psy10521         13 VLSSGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus        13 ilpsGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      ....+.|.|.+++.+|. +.|+|++.|..
T Consensus        35 ~~~~~~L~i~~~~~~d~-G~Y~C~~~n~~   62 (63)
T smart00408       35 SASGSTLTIKSVSLEDS-GEYTCVAENSA   62 (63)
T ss_pred             ecCCcEEEEeeCCcccC-EEEEEEEecCC
Confidence            34578999999999996 99999998863


No 56 
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). IG1_VEGFR: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF_A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angioge
Probab=97.46  E-value=0.00025  Score=41.99  Aligned_cols=38  Identities=24%  Similarity=0.190  Sum_probs=29.0

Q ss_pred             cccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEEec
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSITG   58 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v~e   58 (66)
                      +..|.|.+++.+|. |.|.|.+.|.. |  ..+. .++|+|.|
T Consensus        49 ~s~L~I~~~~~~Ds-G~Y~C~a~n~~-~--~~~~-~t~~~V~~   86 (86)
T cd05862          49 SSTLTIENVTLSDL-GRYTCTASSGQ-M--IAKN-STIVIVHE   86 (86)
T ss_pred             eeEEEEecCCcccC-EEEEEEEeecc-e--Eecc-cEEEEEeC
Confidence            56899999999996 99999998842 2  2232 56888764


No 57 
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). Ig4_L1-NrCAM_like: fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). These proteins belong to the L1 subfamily of cell adhesion molecules (CAMs) and are comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. These molecules are primarily expressed in the nervous system. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=97.44  E-value=0.00032  Score=39.28  Aligned_cols=33  Identities=30%  Similarity=0.482  Sum_probs=27.0

Q ss_pred             EEEeecccEEEeecCCCCCCcceeEEeeccccCcE
Q psy10521         11 YVVLSSGDLYVFNATPNDGYKSYRCRTVNKITGES   45 (66)
Q Consensus        11 y~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~   45 (66)
                      ......+.|.|.+|+.+|. +.|.|.+.|. -|+.
T Consensus        35 ~~~~~~~~L~i~~v~~~D~-G~Y~C~A~N~-~G~~   67 (76)
T cd04978          35 RRRVDGGTLILSNVQPNDT-AVYQCNASNV-HGYL   67 (76)
T ss_pred             eEEccCCEEEECCCChhhC-EEEEEEEEcc-CCeE
Confidence            3445689999999999995 9999999998 3443


No 58 
>cd00099 IgV Immunoglobulin variable domain (IgV). IgV: Immunoglobulin variable domain (IgV). Members of the IgV family are components of immunoglobulin (Ig) and T cell receptors. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. Within the variable domain, there are regions of even more variability called the hypervariable or complementarity-determining regions (CDRs) which are responsible for antigen binding. A predominant feature of most Ig domains is the disulfide bridge connecting 2 beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=97.44  E-value=0.00019  Score=42.30  Aligned_cols=47  Identities=19%  Similarity=0.249  Sum_probs=34.1

Q ss_pred             CCeEEEeecc-----cEEEeecCCCCCCcceeEEeecccc-CcEEecccceeEEE
Q psy10521          8 GGKYVVLSSG-----DLYVFNATPNDGYKSYRCRTVNKIT-GESQASVFQTRLSI   56 (66)
Q Consensus         8 ~~ry~ilpsG-----eL~I~nv~~~D~~~~Y~C~~~~~lT-ge~~~S~~~~~l~v   56 (66)
                      .+|+.+..++     .|.|.||+.+|. |.|.|.+.+... .+...++ +.+|.|
T Consensus        53 ~~r~~~~~~~~~~~~sL~I~~v~~~D~-G~Y~C~v~~~~~~~~~~~~~-gt~l~v  105 (105)
T cd00099          53 KGRFSGTRDSSKSSFTLTISSLQPEDS-AVYYCAVSLSGGTYKLYFGQ-GTRLTV  105 (105)
T ss_pred             CCcEEEEEeccCCEEEEEECCCCHHHC-EEEEEEEecCCCceeeEECC-CEEEeC
Confidence            4677776443     799999999996 999999986653 2444454 667654


No 59 
>PF07686 V-set:  Immunoglobulin V-set domain;  InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the V-set domains, which are Ig-like domains resembling the antibody variable domain. V-set domains are found in diverse protein families, including immunoglobulin light and heavy chains; in several T-cell receptors such as CD2 (Cluster of Differentiation 2), CD4, CD80, and CD86; in myelin membrane adhesion molecules; in junction adhesion molecules (JAM); in tyrosine-protein kinase receptors; and in the programmed cell death protein 1 (PD1).; PDB: 1PY9_A 2NXY_D 1U9K_B 3RNK_A 3BP6_A 3BIK_B 3SBW_A 1NPU_A 3BP5_A 3RNQ_A ....
Probab=97.43  E-value=0.0002  Score=41.66  Aligned_cols=46  Identities=24%  Similarity=0.500  Sum_probs=33.9

Q ss_pred             cCCeEEEeeccc-----EEEeecCCCCCCcceeEEeeccccCcEEecccceeEEE
Q psy10521          7 VGGKYVVLSSGD-----LYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSI   56 (66)
Q Consensus         7 ~~~ry~ilpsGe-----L~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v   56 (66)
                      -.+|+.+..++.     |.|.|++.+|. |.|.|++...  ++..... ..+|.|
T Consensus        64 ~~~r~~~~~~~~~~~~sL~i~~l~~~Ds-G~Y~C~v~~~--~~~~~~~-~~~L~V  114 (114)
T PF07686_consen   64 YSGRFTFSGNGSQNNFSLTIKNLQPSDS-GTYFCQVSTS--NEQSFGN-GTKLTV  114 (114)
T ss_dssp             ETTTEEEEEETTTTEEEEEESSESGGGE-EEEEEEEEES--SEEEEEE-EEEEEE
T ss_pred             eeeeeeeeecccCCeEEEEECCCCcCcC-EEEEEEEEEC--CCCEECC-cEEEEC
Confidence            356778777777     99999999996 9999999988  3333333 445544


No 60 
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins. Ig4_SCFR_like; fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). In addition to SCFR this group also includes the fourth Ig domain of platelet-derived growth factor receptors (PDGFR), alpha and beta, the fourth Ig domain of macrophage colony stimulating factor (M-CSF), and the Ig domain of the receptor tyrosine kinase KIT. SCFR and the PDGFR alpha and beta have similar organization: an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR, this fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth SCFR_Ig-like domain abolishes
Probab=97.42  E-value=0.00048  Score=42.36  Aligned_cols=25  Identities=12%  Similarity=0.202  Sum_probs=23.0

Q ss_pred             ccEEEeecCCCCCCcceeEEeecccc
Q psy10521         17 GDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus        17 GeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      +.|.|.+|..+|+ |.|+|.+.|.+-
T Consensus        65 ~~L~i~~v~~~D~-G~Ytc~A~N~~G   89 (101)
T cd04975          65 SELKLVRLKESEA-GTYTFLASNSDA   89 (101)
T ss_pred             EEEEEeecCHhhC-eeEEEEEECCCc
Confidence            6799999999996 999999999974


No 61 
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig4_Contactin-2-like: fourth Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=97.41  E-value=0.00021  Score=41.68  Aligned_cols=33  Identities=27%  Similarity=0.428  Sum_probs=27.3

Q ss_pred             CCeEEEeecccEEEeecCCCCCCcceeEEeecccc
Q psy10521          8 GGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus         8 ~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      ++++.+ .+|.|.|.+++.+|. +.|+|.+.|.+-
T Consensus        43 ~~~~~~-~~~~L~i~~~~~~D~-G~Y~C~a~N~~G   75 (85)
T cd05728          43 ENRIEV-EAGDLRITKLSLSDS-GMYQCVAENKHG   75 (85)
T ss_pred             CCeEEE-eCCEEEEeeCCHHHC-EEEEEEEECCCC
Confidence            345554 689999999999994 999999999764


No 62 
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d5: the fifth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrkB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor foun
Probab=97.41  E-value=0.00011  Score=43.37  Aligned_cols=26  Identities=23%  Similarity=0.178  Sum_probs=23.4

Q ss_pred             cccEEEeecCCCCCCcceeEEeecccc
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      .|.|.|.+++.+|. |.|+|.|.|.+-
T Consensus        45 ~~~L~I~~~~~~D~-G~YtC~A~N~~G   70 (81)
T cd04971          45 HGCLQFDNPTHVNN-GNYTLVASNEYG   70 (81)
T ss_pred             EEEEEECCCCcccC-eEEEEEEEeCCC
Confidence            56799999999996 999999999873


No 63 
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig3_FGFR: third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs.
Probab=97.39  E-value=0.00016  Score=42.78  Aligned_cols=25  Identities=32%  Similarity=0.478  Sum_probs=22.6

Q ss_pred             ccEEEeecCCCCCCcceeEEeecccc
Q psy10521         17 GDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus        17 GeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      +.|.|.||+.+|+ |.|.|.+.|.+=
T Consensus        55 ~~L~I~~v~~~D~-G~Y~C~A~N~~G   79 (90)
T cd04974          55 EVLYLRNVSFDDA-GEYTCLAGNSIG   79 (90)
T ss_pred             ceEEEeccccccC-cEEEEEeecccC
Confidence            5799999999996 999999999864


No 64 
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). Ig1_PDGFR-alphabeta: The first immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFRalpha binds to all three PDGFs, whereas the PDGFRbeta binds only to PDGF-B. PDGFRs alpha and beta have similar organization: an extracellular component with five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFRalpha and PDGFRbeta are essential for normal development.
Probab=97.37  E-value=0.00037  Score=40.95  Aligned_cols=38  Identities=16%  Similarity=0.318  Sum_probs=28.8

Q ss_pred             cccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEE
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSI   56 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v   56 (66)
                      +..|.|.+++.+|. |.|.|.+.|...++....  ...|.|
T Consensus        45 ~s~L~I~~~~~~Ds-G~Y~C~a~n~~~~~~~~~--sv~i~V   82 (84)
T cd05861          45 RSTLTFPHATVEDS-GTYECAAHESTQDQKAFK--KVNITV   82 (84)
T ss_pred             EEEEEECCCCcCCC-EEEEEEEEECccCcceeE--EEEEEE
Confidence            45799999999996 999999999877654422  335544


No 65 
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). Ig4_ NrCAM: fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six IG-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=97.34  E-value=0.0006  Score=39.16  Aligned_cols=30  Identities=13%  Similarity=0.288  Sum_probs=24.8

Q ss_pred             ecccEEEeecCCCCCCcceeEEeeccccCcEE
Q psy10521         15 SSGDLYVFNATPNDGYKSYRCRTVNKITGESQ   46 (66)
Q Consensus        15 psGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~   46 (66)
                      ..+.|.|.+|+.+|+ +.|.|.+.|.+ |+..
T Consensus        39 ~~~~l~i~~v~~~D~-G~Y~C~A~N~~-G~~~   68 (76)
T cd05868          39 DGDTIIFSKVQERSS-AVYQCNASNEY-GYLL   68 (76)
T ss_pred             cCCEEEECCCCHhhC-EEEEEEEEcCC-CEEE
Confidence            345899999999996 99999999987 4443


No 66 
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D. Ig_Sema4D_like; Immunoglobulin (Ig)-like domain of Sema4D. Sema4D is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4D has extracellular Sema and Ig domains, a transmembrane domain, and a short cytoplasmic domain. Sema4D plays a part in the development of GABAergic synapses. Sema4D in addition is an immune semaphorin. It is abundant on resting T cells; its expression is weak on resting B cells and antigen presenting cells (APCs), but is upregulated by various stimuli. The receptor used by Sema4D in the immune system is CD72. Sem4D enhances the activation of B cells and DCs through binding CD72, perhaps by reducing CD72s inhibitory signals. The receptor used by Sema4D in the non-lymphatic tissues is plexin-B1. Sem4D is anchored to the cell surface but its extracellular domain can be released from the cell surface by a metalloproteas
Probab=97.33  E-value=0.00025  Score=43.08  Aligned_cols=30  Identities=37%  Similarity=0.730  Sum_probs=26.1

Q ss_pred             CeEEEeecccEEEeecCCCCCCcceeEEeecc
Q psy10521          9 GKYVVLSSGDLYVFNATPNDGYKSYRCRTVNK   40 (66)
Q Consensus         9 ~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~   40 (66)
                      +||.+ ..|.|.|.||+.+|+ |.|.|.+.+.
T Consensus        41 ~r~~~-~~~~L~I~nv~~~Ds-G~Y~C~a~e~   70 (87)
T cd05873          41 AKYLL-YRDGLLIFNASEADA-GRYQCLSVEK   70 (87)
T ss_pred             ceEEE-ECCcEEEeCCCHHHC-EEEEEEEEec
Confidence            57755 678999999999996 9999999976


No 67 
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig1_FGFR: The first immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for all FGFs.
Probab=97.33  E-value=0.00033  Score=40.45  Aligned_cols=32  Identities=19%  Similarity=0.363  Sum_probs=26.5

Q ss_pred             CCeEEEeecccEEEeecCCCCCCcceeEEeeccc
Q psy10521          8 GGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus         8 ~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      +.++.+. .+.|.|.+++.+|. |.|.|.+.|.+
T Consensus        37 ~~~~~~~-~~~L~I~~~~~~Ds-G~Y~C~a~n~~   68 (79)
T cd04973          37 NNRTRIT-GEEVQIKDAVPRDS-GLYACVTSSPS   68 (79)
T ss_pred             CceEEEe-CCEEEECCCChhhC-EEEEEEEeCCC
Confidence            4566653 56799999999996 99999999985


No 68 
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig1_Necl-1: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-1, Necl-1 (also known as celll adhesion molecule 3 (CADM3), SynCAM2, IGSF4). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the format
Probab=97.33  E-value=0.00038  Score=42.39  Aligned_cols=32  Identities=13%  Similarity=0.219  Sum_probs=26.2

Q ss_pred             CCeEEEee----cccEEEeecCCCCCCcceeEEeecc
Q psy10521          8 GGKYVVLS----SGDLYVFNATPNDGYKSYRCRTVNK   40 (66)
Q Consensus         8 ~~ry~ilp----sGeL~I~nv~~~D~~~~Y~C~~~~~   40 (66)
                      ++||.+..    .+.|.|.||+.+|+ |.|.|.+..-
T Consensus        49 ~~r~~~~~~~~~~~~L~I~nV~~~D~-G~YtC~~~t~   84 (95)
T cd05882          49 DNRIQLVKSTPTELIISISNVQLSDE-GEYTCSIFTM   84 (95)
T ss_pred             CCeEEEEeCCCceEEEEECCCCcccC-EEEEEEEEee
Confidence            46777652    46899999999996 9999999873


No 69 
>cd04967 Ig1_Contactin First Ig domain of contactin. Ig1_Contactin: First Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 weeks postnata
Probab=97.32  E-value=0.00036  Score=41.01  Aligned_cols=29  Identities=28%  Similarity=0.529  Sum_probs=24.2

Q ss_pred             EeecccEEEeecCC-CCCCcceeEEeecccc
Q psy10521         13 VLSSGDLYVFNATP-NDGYKSYRCRTVNKIT   42 (66)
Q Consensus        13 ilpsGeL~I~nv~~-~D~~~~Y~C~~~~~lT   42 (66)
                      ...+|.|.|+++.. +|. +.|+|++.|.+-
T Consensus        54 ~~~~~~L~i~~~~~~~d~-G~Y~C~a~N~~G   83 (91)
T cd04967          54 SLVGGNLVISNPSKAKDA-GRYQCLASNIVG   83 (91)
T ss_pred             EEECCEEEEecCCccCCC-EEEEEEEEcCCC
Confidence            34689999999985 785 999999999864


No 70 
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Ig_Myomesin_like_C: domain similar to the C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Myomesin and M-protein are both structural proteins localized to the M-band, a transverse structure in the center of the sarcomere, and are candidates for M-band bridges. Both proteins are modular, consisting mainly of repetitive Ig-like and fibronectin type III (FnIII) domains. Myomesin is expressed in all types of vertebrate striated muscle; M-protein has a muscle-type specific expression pattern. Myomesin is present in both slow and fast fibers; M-protein is present only in fast fibers. It has been suggested that myomesin acts as a molecular spring with alternative splicing as a means of modifying its elasticity.
Probab=97.32  E-value=0.00032  Score=41.38  Aligned_cols=34  Identities=24%  Similarity=0.304  Sum_probs=27.1

Q ss_pred             CCeEEEeec-c---cEEEeecCCCCCCcceeEEeecccc
Q psy10521          8 GGKYVVLSS-G---DLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus         8 ~~ry~ilps-G---eL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      +++|.+... |   .|.|.+++.+|. |.|.|.+.|.+-
T Consensus        45 ~~~~~~~~~~~~~~~L~I~~v~~~D~-G~Y~C~a~N~~G   82 (92)
T cd05737          45 SDHYNVKVEQGKYASLTIKGVSSEDS-GKYGIVVKNKYG   82 (92)
T ss_pred             CCCEEEEEcCCCEEEEEEccCChhhC-EEEEEEEEECCC
Confidence            456666543 3   699999999996 999999999764


No 71 
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig3_Contactin-1: Third Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=97.31  E-value=0.00061  Score=40.23  Aligned_cols=37  Identities=30%  Similarity=0.529  Sum_probs=28.3

Q ss_pred             ecccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEE
Q psy10521         15 SSGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSI   56 (66)
Q Consensus        15 psGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v   56 (66)
                      ..+.|.|.||+.+|. |.|.|.+.|.+-.. ..   .++|.|
T Consensus        51 ~~~~L~I~~v~~~D~-G~Y~C~A~N~~G~~-~~---~~~l~V   87 (88)
T cd05851          51 SGAVLKIFNIQPEDE-GTYECEAENIKGKD-KH---QARVYV   87 (88)
T ss_pred             CCCEEEECcCChhhC-EEEEEEEEcCCCce-EE---EEEEEE
Confidence            456899999999995 99999999997543 21   346655


No 72 
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1. Ig1_Contactin-1: First Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=97.31  E-value=0.00041  Score=41.68  Aligned_cols=33  Identities=24%  Similarity=0.439  Sum_probs=26.6

Q ss_pred             CCeEEEeecccEEEeecC-CCCCCcceeEEeecccc
Q psy10521          8 GGKYVVLSSGDLYVFNAT-PNDGYKSYRCRTVNKIT   42 (66)
Q Consensus         8 ~~ry~ilpsGeL~I~nv~-~~D~~~~Y~C~~~~~lT   42 (66)
                      +++| .+.+|.|.|.++. .+|. |.|.|.+.|.+-
T Consensus        49 ~~~~-~~~~g~L~I~~~~~~~D~-G~Y~C~A~N~~G   82 (93)
T cd05849          49 NDRY-SMVGGNLVINNPDKYKDA-GRYVCIVSNIYG   82 (93)
T ss_pred             CCeE-EEECCEEEECcCCcCCCC-EEEEEEEEeCcc
Confidence            3466 4578999999996 5785 999999999864


No 73 
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2. Ig1_Contactin-2: First Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=97.29  E-value=0.00045  Score=41.25  Aligned_cols=31  Identities=32%  Similarity=0.658  Sum_probs=25.1

Q ss_pred             eEEEeecccEEEeecC-CCCCCcceeEEeecccc
Q psy10521         10 KYVVLSSGDLYVFNAT-PNDGYKSYRCRTVNKIT   42 (66)
Q Consensus        10 ry~ilpsGeL~I~nv~-~~D~~~~Y~C~~~~~lT   42 (66)
                      +|. +.+|.|.|.++. .+| .|.|+|.+.|.+-
T Consensus        52 ~~~-~~~g~L~I~~~~~~~D-~G~Y~C~A~N~~G   83 (94)
T cd05850          52 RYT-LVAGNLVINNPQKARD-AGSYQCLAINRCG   83 (94)
T ss_pred             eEE-EECCeEEEccCCccCc-CEEEEEEEEcCcC
Confidence            444 468999999976 578 4999999999875


No 74 
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins. Ig_Titin_like: immunoglobulin (Ig)-like domain found in titin-like proteins. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic, depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone.  It appears to function similarly to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching. Within the sarcomere, titin is also attached to or is associated with myosin binding protein C (MyBP-C). MyBP-C appears to contribute to the generation of passive tension by titin, and similar to titin has repeated Ig-like and FN-
Probab=97.28  E-value=0.00058  Score=38.40  Aligned_cols=35  Identities=23%  Similarity=0.282  Sum_probs=28.1

Q ss_pred             cCCeEEEee---cccEEEeecCCCCCCcceeEEeecccc
Q psy10521          7 VGGKYVVLS---SGDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus         7 ~~~ry~ilp---sGeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      .++++.+..   .+.|.|.+++.+|. |.|.|.+.|.+-
T Consensus        27 ~~~~~~~~~~~~~~~L~I~~~~~~D~-G~Y~C~a~N~~G   64 (74)
T cd05748          27 LSGRVQIETTASSTSLVIKNAERSDS-GKYTLTLKNPAG   64 (74)
T ss_pred             CCCeEEEEECCCeEEEEECCCCcCcC-EEEEEEEECCCc
Confidence            345677654   45799999999996 999999999863


No 75 
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). Ig_C5_MyBP_C : the C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). MyBP_C consists of repeated domains, Ig and fibronectin type 3, and various linkers. Three isoforms of MYBP_C exist and are included in this group: cardiac(c), and fast and slow skeletal muscle (s) MyBP_C. cMYBP_C has insertions between and inside domains and an additional cardiac-specific Ig domain at the N-terminus. For cMYBP_C  an interaction has been demonstrated between this C5 domain and the Ig C8 domain.
Probab=97.28  E-value=0.00041  Score=40.99  Aligned_cols=35  Identities=20%  Similarity=0.214  Sum_probs=28.4

Q ss_pred             CCeEEEee---cccEEEeecCCCCCCcceeEEeeccccC
Q psy10521          8 GGKYVVLS---SGDLYVFNATPNDGYKSYRCRTVNKITG   43 (66)
Q Consensus         8 ~~ry~ilp---sGeL~I~nv~~~D~~~~Y~C~~~~~lTg   43 (66)
                      ++|+.+..   .+.|.|.+++.+|. |.|.|.+.|.+=.
T Consensus        40 ~~r~~~~~~~~~~~L~I~~~~~~D~-G~Y~c~a~N~~G~   77 (86)
T cd05894          40 EGRVRVESYKDLSSFVIEGAEREDE-GVYTITVTNPVGE   77 (86)
T ss_pred             CCeEEEEEcCCeEEEEECCCccCcC-EEEEEEEEeCCCc
Confidence            45777754   36799999999996 9999999998643


No 76 
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). Ig2_VEGF-2: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-2 (KDR/Flk-1) is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF-A also interacts with VEGFR-1, which it binds more strongly than VEGFR-2.  VEGFR-2 and -1 may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=97.27  E-value=0.00023  Score=41.10  Aligned_cols=29  Identities=28%  Similarity=0.379  Sum_probs=24.8

Q ss_pred             ecccEEEeecCCCCCCcceeEEeeccccCc
Q psy10521         15 SSGDLYVFNATPNDGYKSYRCRTVNKITGE   44 (66)
Q Consensus        15 psGeL~I~nv~~~D~~~~Y~C~~~~~lTge   44 (66)
                      ..+.|.|.++..+|. |.|.|.+.|.+-..
T Consensus        32 ~~~~L~I~~v~~~D~-G~YtC~a~N~~G~~   60 (70)
T cd05864          32 RGVHLTIYEVTEKDA-GNYTVVLTNPITKE   60 (70)
T ss_pred             cCCEEEECcCCHHHC-EEEEEEEEECCCce
Confidence            356899999999996 99999999998543


No 77 
>KOG4221|consensus
Probab=97.27  E-value=0.00048  Score=58.41  Aligned_cols=49  Identities=24%  Similarity=0.412  Sum_probs=38.4

Q ss_pred             CccCCeEEEeecccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEEe
Q psy10521          5 DFVGGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSIT   57 (66)
Q Consensus         5 ~~~~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v~   57 (66)
                      +.+++|+.++|+|.|.|.+++..|. +.|||.+.+.-...+  |+ -+.|.|.
T Consensus       181 l~~~~r~i~lpsG~L~I~~~qp~d~-g~yrc~vt~g~~~r~--S~-~a~ltv~  229 (1381)
T KOG4221|consen  181 LPLDSRVIVLPSGALEISGLQPSDT-GEYRCVVTGGASQRT--SN-EAELTVL  229 (1381)
T ss_pred             ccCCCcEEEcCCCcEEecccccCCC-ceEEEEEecCCcCCc--cc-eeEEEec
Confidence            3456799999999999999999996 999999987655544  44 4455554


No 78 
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5. Ig1_Contactin-5: First Ig domain of the neural cell adhesion molecule contactin-5. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains, anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. In rats, a lack of contactin-5 (NB-2) results in an impairment of the neuronal activity in the auditory system. Contactin-5 is expressed specifically in the postnatal nervous system, peaking at about 3 weeks postnatal. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala; lower levels of expression have been detected in the corpus callosum, caudate nucleus, and spinal cord.
Probab=97.24  E-value=0.0004  Score=41.56  Aligned_cols=27  Identities=33%  Similarity=0.625  Sum_probs=23.4

Q ss_pred             eecccEEEeecC-CCCCCcceeEEeeccc
Q psy10521         14 LSSGDLYVFNAT-PNDGYKSYRCRTVNKI   41 (66)
Q Consensus        14 lpsGeL~I~nv~-~~D~~~~Y~C~~~~~l   41 (66)
                      ..+|.|.|.++. .+|. |.|+|.+.|.+
T Consensus        55 ~~~g~L~i~~~~~~~D~-G~Y~C~A~N~~   82 (94)
T cd05848          55 LIDGNLIISNPSEVKDS-GRYQCLATNSI   82 (94)
T ss_pred             eeCCeEEEccCCccCcC-EEEEEEEEcCC
Confidence            468999999986 5785 99999999987


No 79 
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively). Ig1_Necl-1-3_like:  N-terminal immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), and Necl-3 (CADM2). At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1, Necl-2, and Necl-3 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the form
Probab=97.23  E-value=0.00064  Score=40.12  Aligned_cols=33  Identities=12%  Similarity=0.230  Sum_probs=26.9

Q ss_pred             CCeEEEee----cccEEEeecCCCCCCcceeEEeeccc
Q psy10521          8 GGKYVVLS----SGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus         8 ~~ry~ilp----sGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      ++||.+..    ++.|.|.||+.+|. +.|.|++....
T Consensus        49 ~~r~~~~~~~~~~~~L~I~~v~~~Ds-G~Y~C~~~~~~   85 (95)
T cd05717          49 DNRIQLVNFSANELSISISNVSLSDE-GRYTCSLYTMP   85 (95)
T ss_pred             cCcEEEEcCCCCeeEEEEccCCcccC-EEEEEEEecCC
Confidence            46888742    35699999999996 99999998654


No 80 
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM_like: domain similar to the third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM and human neurofascin.
Probab=97.22  E-value=0.00027  Score=39.00  Aligned_cols=27  Identities=26%  Similarity=0.448  Sum_probs=23.8

Q ss_pred             ecccEEEeecCCCCCCcceeEEeecccc
Q psy10521         15 SSGDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus        15 psGeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      ..+.|.|.+|+.+|. |.|.|.+.|..-
T Consensus        34 ~~~~L~i~~v~~~D~-G~Y~C~a~N~~G   60 (71)
T cd05731          34 FNKTLKIDNVSEEDD-GEYRCTASNSLG   60 (71)
T ss_pred             CCCEEEECCCCHHHC-EEEEEEEEeCCc
Confidence            467899999999995 999999999864


No 81 
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig1_Necl-3: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-3, Necl-3 (also known as cell adhesion molecule 2 (CADM2), SynCAM2, IGSF4D).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses.  Necl-3 accumulates in central and peripheral nervous system tissue, and has been shown to selectively interact with oligodendrocytes.
Probab=97.21  E-value=0.00055  Score=41.29  Aligned_cols=32  Identities=9%  Similarity=0.242  Sum_probs=26.4

Q ss_pred             cCCeEEEe----ecccEEEeecCCCCCCcceeEEeec
Q psy10521          7 VGGKYVVL----SSGDLYVFNATPNDGYKSYRCRTVN   39 (66)
Q Consensus         7 ~~~ry~il----psGeL~I~nv~~~D~~~~Y~C~~~~   39 (66)
                      .++||.+.    ..+.|.|.||+.+|+ |.|.|++..
T Consensus        48 ~~~r~~~~~~~~~~~sL~I~~v~~~Ds-G~Y~C~~~t   83 (95)
T cd07701          48 RDNRIELVRASWHELSISISDVSLSDE-GQYTCSLFT   83 (95)
T ss_pred             cCCCEEEEECCCCcEEEEECcCCcccC-EEEEEEeEe
Confidence            35788774    236799999999996 999999997


No 82 
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). Ig2_VEGFR-3: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-3 (Flt-4) binds two members of the VEGF family (VEGF-C and -D) and is involved in tumor angiogenesis and growth.
Probab=97.21  E-value=0.00029  Score=40.68  Aligned_cols=28  Identities=18%  Similarity=0.175  Sum_probs=25.0

Q ss_pred             cccEEEeecCCCCCCcceeEEeeccccCc
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKITGE   44 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~lTge   44 (66)
                      .+.|.|.+|..+|+ |.|.|.+.|.+-+.
T Consensus        30 ~~~L~i~~v~~~D~-G~YtC~a~N~~g~~   57 (67)
T cd05863          30 QHSLQIKDVTEASA-GTYTLVLWNSAAGL   57 (67)
T ss_pred             cCEEEECCCCHHHC-EEEEEEEEECCccE
Confidence            56899999999996 99999999997754


No 83 
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. IgV_L_kappa: Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=97.19  E-value=0.0005  Score=41.40  Aligned_cols=44  Identities=23%  Similarity=0.335  Sum_probs=31.9

Q ss_pred             CeEEEeecc---cEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEE
Q psy10521          9 GKYVVLSSG---DLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSI   56 (66)
Q Consensus         9 ~ry~ilpsG---eL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v   56 (66)
                      +||.+..++   .|.|.|++.+|. +.|.|++.+-  .+....+ +.+|.|
T Consensus        60 ~r~~~~~~~~~~~L~I~~~~~~Ds-g~Y~Ca~~~~--~~~~fg~-gT~L~v  106 (106)
T cd04980          60 SRFSGSGSGTDFTLTISRVEPEDA-AVYYCQQYGT--FPYTFGG-GTKLEI  106 (106)
T ss_pred             CCEEEeccCCEEEEEECCCChHHC-EEEEEEEeCC--CCCEECC-CEEEeC
Confidence            577775543   499999999996 9999999753  3455554 666654


No 84 
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins. Ig1_Nectin-4_like: domain similar to the first immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor). Nectin-4 belongs to the nectin family, which is comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example nectin-4 trans-interacts with nectin-1. Nectin-4 has also been shown to interact with the actin filament-binding protein, afadin. Unlike the other nectins, which are widely expressed in adult tissues, nectin-4 is mainly expressed during embryogenesis, and is not detected in normal adult 
Probab=97.18  E-value=0.00076  Score=40.83  Aligned_cols=29  Identities=31%  Similarity=0.541  Sum_probs=25.5

Q ss_pred             cccEEEeecCCCCCCcceeEEeeccccCcE
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKITGES   45 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~lTge~   45 (66)
                      ++.|.|+||+.+|. |.|.|.+.+.=-|..
T Consensus        63 ~~sL~I~nv~~sD~-GtY~C~v~~~p~g~~   91 (100)
T cd05888          63 DGALILRNAVQADE-GKYKCRVITFPAGNF   91 (100)
T ss_pred             ceEEEEecCccccc-eEEEEEEEeCCCCCe
Confidence            77899999999996 999999998767753


No 85 
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig1_PVR_like: domain similar to the first immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), that result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane, may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus "c
Probab=97.17  E-value=0.0014  Score=38.33  Aligned_cols=36  Identities=19%  Similarity=0.331  Sum_probs=26.9

Q ss_pred             CCeEEEee----cccEEEeecCCCCCCcceeEEeeccccCc
Q psy10521          8 GGKYVVLS----SGDLYVFNATPNDGYKSYRCRTVNKITGE   44 (66)
Q Consensus         8 ~~ry~ilp----sGeL~I~nv~~~D~~~~Y~C~~~~~lTge   44 (66)
                      .+|..+..    ++.|.|+||+.+|+ |.|.|++...-.|.
T Consensus        49 ~~R~~~~~~~~~~~sL~I~~v~~~D~-G~Y~C~v~~~~~g~   88 (98)
T cd05718          49 EGRVSFLNSSLEDATISISNLRLEDE-GNYICEFATFPQGN   88 (98)
T ss_pred             CceEEEeCCCCCceEEEEccCCcccC-EEEEEEEEeCCCCc
Confidence            45555443    57999999999997 99999987543343


No 86 
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). Ig6_hNeurofascin_like:  the sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). NF belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and a cytoplasmic domain. NF has many alternatively spliced isoforms having different temporal expression patterns during development. NF participates in axon subcellular targeting and synapse formation, however little is known of the functions of the different isoforms.
Probab=97.15  E-value=0.00087  Score=38.82  Aligned_cols=36  Identities=19%  Similarity=0.212  Sum_probs=28.0

Q ss_pred             cCCeEEE-eecccEEEeecCC---CCCCcceeEEeecccc
Q psy10521          7 VGGKYVV-LSSGDLYVFNATP---NDGYKSYRCRTVNKIT   42 (66)
Q Consensus         7 ~~~ry~i-lpsGeL~I~nv~~---~D~~~~Y~C~~~~~lT   42 (66)
                      .++++.+ ..+|.|.|.+++.   +|..+.|.|.+.|.+-
T Consensus        28 ~~~~~~~~~~~~~L~i~~~~~~~~~~d~G~Y~C~A~N~~G   67 (77)
T cd05875          28 KDPRVSMRRRSGTLVIDFSGGGRPEDYEGEYQCFARNNLG   67 (77)
T ss_pred             CCCcEEEeCCCceEEEeccCCCCCCCCCEEEEEEEEeccc
Confidence            3567777 4789999999853   4445999999999975


No 87 
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). Ig8_MLCK: the eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). MLCK is a key regulator of different forms of cell motility involving actin and myosin II.  Agonist stimulation of smooth muscle cells increases cytosolic Ca2+, which binds calmodulin.  This Ca2+-calmodulin complex in turn binds to and activates MLCK. Activated MLCK leads to the phosphorylation of the 20 kDa myosin regulatory light chain (RLC) of myosin II and the stimulation of actin-activated myosin MgATPase activity. MLCK is widely present in vertebrate tissues; it phosphorylates the 20 kDa RLC of both smooth and nonmuscle myosin II. Phosphorylation leads to the activation of the myosin motor domain and altered structural properties of myosin II. In smooth muscle MLCK it is involved in initiating contraction. In nonmuscle cells, MLCK may participate in cell division and cell motility; it has
Probab=97.12  E-value=0.00058  Score=41.32  Aligned_cols=47  Identities=17%  Similarity=0.226  Sum_probs=35.2

Q ss_pred             CCeEEEee---cccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEEecc
Q psy10521          8 GGKYVVLS---SGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSITGF   59 (66)
Q Consensus         8 ~~ry~ilp---sGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v~ep   59 (66)
                      +.++.+..   ...|.|.+++.+|. |.|.|.+.|.+=....    .+.|.|.+.
T Consensus        44 ~~~~~~~~~~~~s~L~I~~~~~~D~-G~Ytc~a~N~~G~~~~----~~~l~V~~~   93 (98)
T cd05762          44 GEGIKIENTENSSKLTITEGQQEHC-GCYTLEVENKLGSRQA----QVNLTVVDK   93 (98)
T ss_pred             CCcEEEEecCCeeEEEECCCChhhC-EEEEEEEEcCCCceeE----EEEEEEecC
Confidence            44666653   67799999999996 9999999998754322    347777663


No 88 
>PF07679 I-set:  Immunoglobulin I-set domain;  InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents I-set domains, which are found in several cell adhesion molecules, including vascular (VCAM), intercellular (ICAM), neural (NCAM) and mucosal addressin (MADCAM) cell adhesion molecules, as well as junction adhesion molecules (JAM). I-set domains are also present in several other diverse protein families, including several tyrosine-protein kinase receptors, the hemolymph protein hemolin, the muscle proteins titin, telokin, and twitchin, the neuronal adhesion molecule axonin-1 [], and the signalling molecule semaphorin 4D that is involved in axonal guidance, immune function and angiogenesis [].; PDB: 3MTR_A 2EDK_A 3DMK_B 1KOA_A 3NCM_A 2NCM_A 2V9Q_A 2CR3_A 3QQN_A 3QR2_A ....
Probab=97.11  E-value=0.00042  Score=39.64  Aligned_cols=38  Identities=32%  Similarity=0.544  Sum_probs=29.8

Q ss_pred             CCeEEEe---ecccEEEeecCCCCCCcceeEEeeccccCcEEe
Q psy10521          8 GGKYVVL---SSGDLYVFNATPNDGYKSYRCRTVNKITGESQA   47 (66)
Q Consensus         8 ~~ry~il---psGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~   47 (66)
                      +++|.+.   ....|.|.+|+.+|+ |.|+|.+.|. .|+...
T Consensus        44 ~~~~~~~~~~~~~~L~I~~v~~~D~-G~Y~C~~~n~-~g~~~~   84 (90)
T PF07679_consen   44 SQRYQIESDGGSSSLTIKNVTREDA-GTYTCVASNS-SGEATA   84 (90)
T ss_dssp             SSSEEEEEETTEEEEEESSESGGGS-EEEEEEEEET-TEEEEE
T ss_pred             eeeeeeecccceeEEccCCCChhhC-EEEEEEEEEC-CCEEEE
Confidence            4566664   367899999999996 9999999999 555443


No 89 
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig6_L1-CAM_like: domain similar to the sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM).  L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains NrCAM [Ng(neuronglia)CAM-related cell adhesion molecule], which is primarily expressed in the nervous system, and human neurofascin.
Probab=97.11  E-value=0.0012  Score=37.88  Aligned_cols=34  Identities=21%  Similarity=0.328  Sum_probs=26.6

Q ss_pred             CCeEEE-eecccEEEeecCC----CCCCcceeEEeecccc
Q psy10521          8 GGKYVV-LSSGDLYVFNATP----NDGYKSYRCRTVNKIT   42 (66)
Q Consensus         8 ~~ry~i-lpsGeL~I~nv~~----~D~~~~Y~C~~~~~lT   42 (66)
                      +.++.+ .++|.|.|.+++.    +| .+.|.|.+.|.+-
T Consensus        29 ~~~~~~~~~~g~L~i~~~~~~~~~~d-~G~Y~C~A~N~~G   67 (77)
T cd05733          29 DPRVTMKPDSGTLVIDNMNGGRAEDY-EGEYQCYASNELG   67 (77)
T ss_pred             CCCEEEeCCCCEEEEeccCCCCCcCC-CEEEEEEEEcCCC
Confidence            345655 3589999999965    56 4999999999984


No 90 
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs). Ig_Pro_neuregulin: immunoglobulin (Ig)-like domain in neuregulins (NRGs). NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. There are four members of the neuregulin gene family (NRG1, -2, -3, and -4). The NRG-1 protein, binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. The other NRGs proteins bind one or the other or both of these ErbBs. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates processes such as target cell differentiation, and Schwann cell surv
Probab=97.10  E-value=0.00043  Score=38.57  Aligned_cols=26  Identities=23%  Similarity=0.383  Sum_probs=23.4

Q ss_pred             cccEEEeecCCCCCCcceeEEeecccc
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      .+.|.|.+++.+|. +.|.|.+.|.+-
T Consensus        42 ~~~L~I~~~~~~D~-G~Y~C~a~N~~G   67 (75)
T cd05750          42 NSELQINKAKLADS-GEYTCVVENILG   67 (75)
T ss_pred             eEEEEEccCCcccC-eEEEEEEEEcCC
Confidence            57899999999996 999999999973


No 91 
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins. Ig1_Nectin-1_like: domain similar to the first immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. In addition nectins heterophilically trans-interact with other CAMs such as nectin-like molecules (Necls), nectin-1 for example, has been shown to trans-interact with Necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is 
Probab=97.09  E-value=0.0011  Score=40.91  Aligned_cols=36  Identities=17%  Similarity=0.232  Sum_probs=29.1

Q ss_pred             CCeEEEee----cccEEEeecCCCCCCcceeEEeeccccCc
Q psy10521          8 GGKYVVLS----SGDLYVFNATPNDGYKSYRCRTVNKITGE   44 (66)
Q Consensus         8 ~~ry~ilp----sGeL~I~nv~~~D~~~~Y~C~~~~~lTge   44 (66)
                      .+|-....    ++.|.|+||+.+|+ |.|+|.+.+.=.|.
T Consensus        50 ~~Rv~f~~~~~~daSi~i~nl~~~D~-G~Y~C~v~t~P~g~   89 (99)
T cd05886          50 RERVTFKNPSFEDGTISLSRLELEDE-GVYICEFATFPTGN   89 (99)
T ss_pred             cCcEEEcCCCCCcceEEEcCCccccC-EEEEEEEEeCCCCC
Confidence            35665542    48999999999996 99999999977774


No 92 
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2). Ig3_FGFR-2-like; domain similar to the third immunoglobulin (Ig)-like domain of human fibroblast growth factor receptor 2 (FGFR2). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs. FGFR2 is required for male sex determination.
Probab=97.07  E-value=0.00024  Score=41.76  Aligned_cols=25  Identities=36%  Similarity=0.474  Sum_probs=22.4

Q ss_pred             ccEEEeecCCCCCCcceeEEeecccc
Q psy10521         17 GDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus        17 GeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      +.|.|++|+.+|+ |.|.|.+.|.+=
T Consensus        55 ~~L~I~~v~~~D~-G~Y~C~A~N~~G   79 (90)
T cd05858          55 EVLYLRNVTFEDA-GEYTCLAGNSIG   79 (90)
T ss_pred             eEEEEccCCHHHC-EEEEEEEEeCCC
Confidence            4699999999996 999999999874


No 93 
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins. Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit res
Probab=97.07  E-value=0.0012  Score=37.95  Aligned_cols=45  Identities=29%  Similarity=0.517  Sum_probs=31.0

Q ss_pred             CCeEEEeecccEEEeec-----CCCCCCcceeEEeeccccCcEEecccceeEEE
Q psy10521          8 GGKYVVLSSGDLYVFNA-----TPNDGYKSYRCRTVNKITGESQASVFQTRLSI   56 (66)
Q Consensus         8 ~~ry~ilpsGeL~I~nv-----~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v   56 (66)
                      ..+..++++|.+.+..+     +.+|. +.|.|.+.|.+ |... |. .+.|.|
T Consensus        50 ~~~~~~~~~~~~~~~~i~~~~~~~~D~-G~Y~C~a~N~~-G~~~-s~-~~~l~v   99 (100)
T cd07693          50 RSHRIVLPSGSLFFLRVVHGRKGRSDE-GVYVCVAHNSL-GEAV-SR-NASLEV   99 (100)
T ss_pred             CcceEEecCCcEEEEEeeccCCCcCcC-EEEEEEEEccc-ccee-cc-eEEEEe
Confidence            34567788999877665     67785 99999999997 3322 32 445544


No 94 
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). Ig_MOG_like:  immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). MOG, a minor component of the myelin sheath, is an important CNS-specific autoantigen, linked to the pathogenesis of multiple sclerosis (MS) and experimental autoimmune encephalomyelitis (EAE). It is a transmembrane protein having an extracellular Ig domain. MOG is expressed in the CNS on the outermost lamellae of the myelin sheath, and on the surface of oligodendrocytes, and may participate in the completion, compaction, and/or maintenance of myelin. This group also includes butyrophilin (BTN). BTN is the most abundant protein in bovine milk-fat globule membrane (MFGM).
Probab=97.06  E-value=0.00064  Score=40.26  Aligned_cols=31  Identities=26%  Similarity=0.371  Sum_probs=25.1

Q ss_pred             CeEEEee------cccEEEeecCCCCCCcceeEEeecc
Q psy10521          9 GKYVVLS------SGDLYVFNATPNDGYKSYRCRTVNK   40 (66)
Q Consensus         9 ~ry~ilp------sGeL~I~nv~~~D~~~~Y~C~~~~~   40 (66)
                      +|..+..      ...|.|.||+.+|+ |.|+|++.+.
T Consensus        51 ~R~~~~~~~~~~~~~sL~I~~v~~~D~-G~Y~C~v~~~   87 (100)
T cd05713          51 GRTELLKDAIAEGSVALRIHNVRASDE-GLYTCFFQSD   87 (100)
T ss_pred             ceEEeecccccCCcEEEEEEcCChhhC-EEEEEEEecC
Confidence            6776642      24699999999996 9999999874


No 95 
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins. Ig1_Nectin-3_like: domain similar to the first immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3). Nectin-3 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example, during spermatid development, the nectin-3,-2 trans-interaction is required for the formation of Sertoli cell-spermatid junctions in testis, and during morphogenesis of the ciliary body, the nectin-3,-1 trans-interaction is important for apex-apex adhesion between the pigment and non-pigment layers of the ciliary epithelia. Nectins also
Probab=97.06  E-value=0.0012  Score=40.76  Aligned_cols=33  Identities=24%  Similarity=0.319  Sum_probs=30.1

Q ss_pred             cccEEEeecCCCCCCcceeEEeeccccCcEEecc
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKITGESQASV   49 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~   49 (66)
                      ++.|.|+||+.+|. |.|+|.+...=.|..+.+.
T Consensus        59 d~sl~i~nv~~~D~-G~Y~C~v~tfP~G~~~~~~   91 (96)
T cd05887          59 DATIMLENVGFSDI-GVYICKAVTFPLGNTQSST   91 (96)
T ss_pred             ccEEEEeCCCcccc-EEEEEEEEeCCCCCeeEEE
Confidence            78999999999996 9999999999999887764


No 96 
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=97.05  E-value=0.0011  Score=40.07  Aligned_cols=47  Identities=21%  Similarity=0.307  Sum_probs=33.0

Q ss_pred             CCeEEEee----cccEEEeecCCCCCCcceeEEeecccc-CcEEecccceeEEE
Q psy10521          8 GGKYVVLS----SGDLYVFNATPNDGYKSYRCRTVNKIT-GESQASVFQTRLSI   56 (66)
Q Consensus         8 ~~ry~ilp----sGeL~I~nv~~~D~~~~Y~C~~~~~lT-ge~~~S~~~~~l~v   56 (66)
                      .+||.+.-    +-.|.|.+++.+|. +.|.|++.+.-. .+..... +.+|.|
T Consensus        59 ~~r~~~~~~~~~~~~L~I~~~~~~Ds-g~Y~Ca~~~~~~~~~~~fg~-gT~L~V  110 (110)
T cd05899          59 KDRFSASRPSLTRSSLTIKSAEPEDS-AVYLCASSLGGGADEAYFGP-GTRLTV  110 (110)
T ss_pred             CCceEEECcCCCccEEEECCCChhhC-EEEEEEeeCCCCccceEECC-CEEEeC
Confidence            46887753    23699999999996 999999987542 2344443 666654


No 97 
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Ig_Siglec_N: immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Siglec refers to a structurally related protein family that specifically recognizes sialic acid in oligosaccharide chains of glycoproteins and glycolipids. Siglecs are type I transmembrane proteins, organized as an extracellular module composed of Ig-like domains (an N-terminal variable set of Ig-like carbohydrate recognition domains, and 1 to 16 constant Ig-like domains), followed by transmembrane and short cytoplasmic domains. Human siglecs are classified into two subgroups, one subgroup is comprised of sialoadhesin (Siglec-1), CD22 (Siglec-2), and MAG, the other subgroup is comprised of CD33-related Siglecs which include CD33 (Siglec-3) and human Siglecs 5-11.
Probab=97.03  E-value=0.002  Score=39.93  Aligned_cols=32  Identities=25%  Similarity=0.402  Sum_probs=25.3

Q ss_pred             CCeEEEe--e---cccEEEeecCCCCCCcceeEEeecc
Q psy10521          8 GGKYVVL--S---SGDLYVFNATPNDGYKSYRCRTVNK   40 (66)
Q Consensus         8 ~~ry~il--p---sGeL~I~nv~~~D~~~~Y~C~~~~~   40 (66)
                      .|||.++  +   +-.|.|.|++.+|. +.|.|++...
T Consensus        66 ~gR~~~~~~~~~~~~sL~I~~l~~~Ds-g~Y~C~~~~~  102 (119)
T cd05712          66 RGRFRLLGDLGKKNCSLLISDAQPEDS-GKYFFRVELG  102 (119)
T ss_pred             cccEEEecCCCCCEEEEEEccCChhhC-eEEEEEEEcC
Confidence            3688773  2   23599999999996 9999998764


No 98 
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig1_FcgammaR_like: domain similar to the first immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=96.99  E-value=0.0012  Score=38.76  Aligned_cols=31  Identities=29%  Similarity=0.506  Sum_probs=24.1

Q ss_pred             CCeEEEeecccEEEeecCCCCCCcceeEEeecc
Q psy10521          8 GGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNK   40 (66)
Q Consensus         8 ~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~   40 (66)
                      +|+-+-...+.|.|.++ .+|. |.|+|++.|.
T Consensus        38 ng~~l~~~~~~l~i~~~-~~ds-G~Y~C~a~~~   68 (78)
T cd05752          38 NGKLLETTTNSYRIRAA-NNDS-GEYRCQTQGS   68 (78)
T ss_pred             CCEEeeccCCeEEEeec-ccCC-EEeEEECCCC
Confidence            34433345788999999 8886 9999999875


No 99 
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). Ig2_IL1R2_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds the type II (IL1R2) represented in this group. Mature IL1R2 consists of three IG-like domains, a transmembrane domain, and a short cytoplasmic domain. It lacks the large cytoplasmic domain of Mature IL1R1, and does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=96.96  E-value=0.0026  Score=39.21  Aligned_cols=29  Identities=24%  Similarity=0.383  Sum_probs=25.2

Q ss_pred             cccEEEeecCCCCCCcceeEEeeccccCcE
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKITGES   45 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~lTge~   45 (66)
                      ++-|.|.+|+.+|+ |.|+|.+.+..-|..
T Consensus        54 ~~~L~I~~v~~~D~-G~YtC~~~~~~~g~~   82 (95)
T cd05897          54 STYLHIIDVSLNDS-GYYTCKLQFTHEGKK   82 (95)
T ss_pred             CCEEEEEEcChhhC-EEEEEEEEEeeCCEE
Confidence            46899999999996 999999999876654


No 100
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB. TrkB_d5: the fifth domain of Trk receptor TrkB, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors, which mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. The Trks are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkB shares significant sequence homology and domain organization with TrkA, and TrkC. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. In some cell systems NT-3 can activate TrkA and TrkB receptors. TrKB transcripts are found throughout multiple structures of the central and peripheral nervous systems.
Probab=96.95  E-value=0.00063  Score=40.56  Aligned_cols=26  Identities=23%  Similarity=0.146  Sum_probs=23.5

Q ss_pred             cccEEEeecCCCCCCcceeEEeecccc
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      .|.|.|.++..+|+ |.|+|.|.|.+=
T Consensus        43 ~~~L~i~~~~~~D~-G~YtC~A~N~~G   68 (79)
T cd05855          43 HGCLQLDNPTHLNN-GIYTLVAKNEYG   68 (79)
T ss_pred             EEEEEECCCCcccC-EEEEEEEEcCCc
Confidence            57899999999996 999999999864


No 101
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG). Ig_Aggrecan_like: immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG)s. Included in this group are the Ig domains of other CSPGs: versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substi
Probab=96.91  E-value=0.0015  Score=40.39  Aligned_cols=33  Identities=21%  Similarity=0.435  Sum_probs=26.5

Q ss_pred             CCeEEEee------cccEEEeecCCCCCCcceeEEeeccc
Q psy10521          8 GGKYVVLS------SGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus         8 ~~ry~ilp------sGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      .||+.+..      +..|.|+|++.+|+ +.|+|++.+..
T Consensus        57 ~gR~~~~~~~~~~~~asL~I~~l~~sD~-G~Y~C~v~~~~   95 (110)
T cd05878          57 QGRVSLPNYPENRGDASLEISRLRSSDS-GVYRCEVMHGI   95 (110)
T ss_pred             cCeEEeccCCCCCCcEEEEECCCChhhC-EEEEEEEEeCC
Confidence            46877732      35599999999996 99999999864


No 102
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig1_IL1R_like: domain similar to the first immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=96.90  E-value=0.0022  Score=38.66  Aligned_cols=30  Identities=20%  Similarity=0.232  Sum_probs=24.9

Q ss_pred             ecccEEEeecCCCCCCcceeEEeeccccCcEE
Q psy10521         15 SSGDLYVFNATPNDGYKSYRCRTVNKITGESQ   46 (66)
Q Consensus        15 psGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~   46 (66)
                      ..|.|.|.+++.+|. |.|.|.+.|.. |..+
T Consensus        58 ~~~~L~I~~~~~~Ds-G~Y~C~~~N~~-g~~~   87 (94)
T cd05756          58 QKDLLWFLPAALEDS-GLYTCVVRNST-YCMK   87 (94)
T ss_pred             cCCeEEEccCCcccC-eEEEEEEcCCC-ccEE
Confidence            368899999999997 99999999964 4433


No 103
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP). Ig_LP_like: immunoglobulin (Ig)-like domain similar to that that found in human cartilage link protein (LP). In cartilage, chondroitin-keratan sulfate proteoglycan (CSPG), aggrecan, forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=96.86  E-value=0.0015  Score=39.15  Aligned_cols=32  Identities=19%  Similarity=0.412  Sum_probs=26.1

Q ss_pred             CCeEEEee----cccEEEeecCCCCCCcceeEEeecc
Q psy10521          8 GGKYVVLS----SGDLYVFNATPNDGYKSYRCRTVNK   40 (66)
Q Consensus         8 ~~ry~ilp----sGeL~I~nv~~~D~~~~Y~C~~~~~   40 (66)
                      .+|+.+..    +..|.|.|++.+|. +.|+|.+.+.
T Consensus        55 ~~R~~~~~~~~~~~sL~I~~v~~~Ds-G~Y~C~v~~~   90 (106)
T cd05877          55 QGRVFLRRAHDLDASLVITDLRLEDY-GRYRCEVIDG   90 (106)
T ss_pred             cCcEEecCCCCCcEEEEEccCChHHC-EEEEEEEEec
Confidence            46777753    34799999999996 9999999874


No 104
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins. Ig_CSPGs_LP: immunoglobulin (Ig)-like domain similar to that found in chondroitin sulfate proteoglycans (CSPGs) and human cartilage link protein (LP).  Included in this group are the CSPGs aggrecan, versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue.
Probab=96.86  E-value=0.0012  Score=39.69  Aligned_cols=24  Identities=21%  Similarity=0.516  Sum_probs=22.0

Q ss_pred             cccEEEeecCCCCCCcceeEEeecc
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNK   40 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~   40 (66)
                      +..|.|.||+.+|. |.|+|.+.+.
T Consensus        67 ~~sL~I~~v~~sD~-G~Y~C~v~~~   90 (106)
T cd05714          67 DASLVITDLRLEDS-GRYRCEVIDG   90 (106)
T ss_pred             cceEEECCCCHHHC-EEEEEEEEcC
Confidence            67899999999996 9999999975


No 105
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). Ig2_FGFRL1-like: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). FGFRL1 is comprised of a signal peptide, three extracellular Ig-like modules, a transmembrane segment, and a short intracellular domain. FGFRL1 is expressed preferentially in skeletal tissues. Similar to FGF receptors, the expressed protein interacts specifically with heparin and with FGF2.  FGFRL1 does not have a protein tyrosine kinase domain at its C terminus; neither does its cytoplasmic domain appear to interact with a signaling partner. It has been suggested that FGFRL1 may not have any direct signaling function, but instead acts as a decoy receptor trapping FGFs and preventing them from binding other receptors.
Probab=96.84  E-value=0.00067  Score=38.02  Aligned_cols=25  Identities=28%  Similarity=0.486  Sum_probs=22.5

Q ss_pred             cccEEEeecCCCCCCcceeEEeeccc
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      .+.|.|.+++.+|. +.|.|++.|..
T Consensus        47 ~~~L~i~~v~~~D~-G~Y~C~a~N~~   71 (82)
T cd05856          47 KWTLSLKNLKPEDS-GKYTCHVSNRA   71 (82)
T ss_pred             eEEEEEccCChhhC-EEEEEEEEcCC
Confidence            46799999999995 99999999986


No 106
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain. IgV_H: Immunoglobulin (Ig) heavy chain (H), variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which can associate with any of the heavy chains. This family includes alpha, gamma, delta, epsilon, and mu heavy chains.
Probab=96.84  E-value=0.0019  Score=40.23  Aligned_cols=48  Identities=19%  Similarity=0.182  Sum_probs=36.3

Q ss_pred             CCeEEEe--ecc---cEEEeecCCCCCCcceeEEeeccc---cCcEEecccceeEEEe
Q psy10521          8 GGKYVVL--SSG---DLYVFNATPNDGYKSYRCRTVNKI---TGESQASVFQTRLSIT   57 (66)
Q Consensus         8 ~~ry~il--psG---eL~I~nv~~~D~~~~Y~C~~~~~l---Tge~~~S~~~~~l~v~   57 (66)
                      .+||.+.  ++.   .|.|.+++.+|. +.|.|.+....   +++..... +.+|.|.
T Consensus        62 ~~rf~~~~~~~~~~~~L~I~~~~~~Ds-a~YyCa~~~~~~~~~~~~~FG~-GT~L~V~  117 (117)
T cd04981          62 KGRFTITRDTSKSTVYLQLNSLTPEDT-AVYYCARGLGGYGYGYFDYWGQ-GTLVTVS  117 (117)
T ss_pred             CCcEEEEEEccCCEEEEEECCCCHHHC-EEEEEEEEcCCCCCccEeeECC-CEEEEEC
Confidence            4688885  222   599999999996 99999998643   45666666 7888874


No 107
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B. Ig_Sema4B_like; Immunoglobulin (Ig)-like domain of Sema4B_like. Sema4B is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4B has extracellular Sema and Ig domains, a transmembrane domain and a short cytoplasmic domain. Sema4B has been shown to preferentially regulate the development of the postsynaptic specialization at the glutamatergic synapses. This cytoplasmic domain includes a PDZ-binding motif upon which the synaptic localization of Sem4B is dependent. Sema4B is a ligand of CLCP1, CLCP1 was identified in an expression profiling analysis, which compared a highly metastic lung cancer subline with its low metastic parental line. Sema4B was shown to promote CLCP1 endocytosis, and their interaction is a potential target for therapeutic intervention of metastasis.
Probab=96.82  E-value=0.0013  Score=39.86  Aligned_cols=32  Identities=25%  Similarity=0.477  Sum_probs=26.8

Q ss_pred             ccCCeEEEeecccEEEeecCCCCCCcceeEEeec
Q psy10521          6 FVGGKYVVLSSGDLYVFNATPNDGYKSYRCRTVN   39 (66)
Q Consensus         6 ~~~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~   39 (66)
                      ..++|+.+...| |.|++++.+|+ |.|.|.+.-
T Consensus        37 ~~~~r~~~~~~G-LlI~~~~~~ds-G~Y~C~s~E   68 (85)
T cd05872          37 NAQFSYRVGTDG-LLILVTSPEHS-GTYRCYSEE   68 (85)
T ss_pred             CCCcceEEeCCC-CEEEECCHhhC-EEEEEEEec
Confidence            345788888888 77999999996 999999873


No 108
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). Ig6_NrCAM: sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=96.79  E-value=0.003  Score=36.52  Aligned_cols=34  Identities=18%  Similarity=0.211  Sum_probs=25.6

Q ss_pred             CCeEEEee-cccEEEeecCCCC---CCcceeEEeeccc
Q psy10521          8 GGKYVVLS-SGDLYVFNATPND---GYKSYRCRTVNKI   41 (66)
Q Consensus         8 ~~ry~ilp-sGeL~I~nv~~~D---~~~~Y~C~~~~~l   41 (66)
                      +.++.+.+ +|.|.|..++.++   ..+.|.|.|.|.+
T Consensus        29 ~~~~~~~~~~g~l~i~~~~~~~~~~d~G~Y~C~A~N~~   66 (77)
T cd05874          29 DPKVTMKPNTGTLVINIMNGEKAEAYEGVYQCTARNER   66 (77)
T ss_pred             CCCEEEeCCCceEEEeccccCCCCCCCEEEEEEEEcCC
Confidence            34566654 7999999998653   2599999999964


No 109
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA). Ig_EVA: immunoglobulin (Ig) domain of epithelial V-like antigen 1 (EVA). EVA is also known as myelin protein zero-like 2. EVA is an adhesion molecule, which may play a role in structural organization of the thymus and early lymphocyte development.
Probab=96.79  E-value=0.001  Score=41.38  Aligned_cols=26  Identities=19%  Similarity=0.560  Sum_probs=22.3

Q ss_pred             cccEEEeecCCCCCCcceeEEeecccc
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      +..|.|.+|+.+|+ +.|+|.+.|.-.
T Consensus        78 ~~sL~I~~v~~~D~-G~Y~C~v~~~~~  103 (115)
T cd05880          78 DASILIWQLQPTDN-GTYTCQVKNPPD  103 (115)
T ss_pred             ceEEEEeeCChhhC-EEEEEEEEeCCC
Confidence            45599999999996 999999997644


No 110
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins. Ig3_Perlecan_like: domain similar to the third immunoglobulin (Ig)-like domain found in Perlecan. Perlecan is a large multi-domain heparin sulfate proteoglycan, important in tissue development and organogenesis.  Perlecan can be represented as 5 major portions; its fourth major portion (domain IV) is a tandem repeat of immunoglobulin-like domains (Ig2-Ig15), which can vary in size due to alternative splicing. Perlecan binds many cellular and extracellular ligands. Its domain IV region has many binding sites.  Some of these have been mapped at the level of individual Ig-like domains, including a site restricted to the Ig5 domain for heparin/sulfatide, a site restricted to the Ig3 domain for nidogen-1 and nidogen-2, a site restricted to Ig4-5 for fibronectin, and sites restricted to Ig2 and to Ig13-15 for fibulin-2.
Probab=96.76  E-value=0.00075  Score=38.97  Aligned_cols=26  Identities=27%  Similarity=0.401  Sum_probs=23.6

Q ss_pred             ecccEEEeecCCCCCCcceeEEeeccc
Q psy10521         15 SSGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus        15 psGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      ..|.|.|.+|+.+|. +.|.|.+.|..
T Consensus        50 ~~~~L~I~~v~~~Ds-G~Y~C~a~n~~   75 (85)
T cd05754          50 FNGILTIRNVQLSDA-GTYVCTGSNML   75 (85)
T ss_pred             cCCEEEECCCCHHHC-EEEEEEEeccC
Confidence            478999999999996 99999999876


No 111
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0). Ig_P0ex: immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an Ig domain.  The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin.
Probab=96.76  E-value=0.0011  Score=41.99  Aligned_cols=27  Identities=19%  Similarity=0.351  Sum_probs=23.6

Q ss_pred             cccEEEeecCCCCCCcceeEEeeccccC
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKITG   43 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~lTg   43 (66)
                      ++.|.|+||+.+|. |.|.|.++|+-..
T Consensus        79 daSI~I~nv~~sD~-G~Y~C~v~n~p~~  105 (116)
T cd05879          79 DGSIVIHNLDYTDN-GTFTCDVKNPPDI  105 (116)
T ss_pred             eeEEEEccCCcccC-EEEEEEEEcCCCc
Confidence            45699999999996 9999999988654


No 112
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig1_Necl-2: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-2, Necl-2 (also known as cell adhesion molecule 1 (CADM1), SynCAM1, IGSF4A, Tslc1, sgIGSF, and RA175).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-2 is expressed in a wide variety of tissues, and is a 
Probab=96.76  E-value=0.0034  Score=38.67  Aligned_cols=32  Identities=16%  Similarity=0.372  Sum_probs=26.5

Q ss_pred             cCCeEEEee-ccc---EEEeecCCCCCCcceeEEeec
Q psy10521          7 VGGKYVVLS-SGD---LYVFNATPNDGYKSYRCRTVN   39 (66)
Q Consensus         7 ~~~ry~ilp-sGe---L~I~nv~~~D~~~~Y~C~~~~   39 (66)
                      .+.||.+.. +|+   |.|.+|+.+|+ |.|.|++..
T Consensus        48 ~d~Rf~~~~~~~~~~tL~I~~vq~~D~-G~Y~Cqv~t   83 (95)
T cd05881          48 KDSRFQLVNFSSNELRVSLSNVSLSDE-GRYFCQLYT   83 (95)
T ss_pred             CCcCEEEEeCCCCEEEEEECcCCcccC-EEEEEEEEc
Confidence            467888765 454   89999999996 999999975


No 113
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. Ig2_FGFR: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three IG-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin sulfate proteoglycans.
Probab=96.76  E-value=0.0012  Score=37.67  Aligned_cols=25  Identities=24%  Similarity=0.397  Sum_probs=22.7

Q ss_pred             cccEEEeecCCCCCCcceeEEeeccc
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      .+.|.|.+++.+|+ +.|.|.+.|.+
T Consensus        50 ~~~l~i~~~~~~D~-G~Y~C~a~N~~   74 (85)
T cd05857          50 HWSLIMESVVPSDK-GNYTCVVENEY   74 (85)
T ss_pred             ceEEEEccCCcccC-EEEEEEEEeCC
Confidence            56799999999996 99999999986


No 114
>smart00410 IG_like Immunoglobulin like. IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
Probab=96.74  E-value=0.005  Score=33.00  Aligned_cols=35  Identities=31%  Similarity=0.580  Sum_probs=27.7

Q ss_pred             CCeEEEeec---ccEEEeecCCCCCCcceeEEeeccccC
Q psy10521          8 GGKYVVLSS---GDLYVFNATPNDGYKSYRCRTVNKITG   43 (66)
Q Consensus         8 ~~ry~ilps---GeL~I~nv~~~D~~~~Y~C~~~~~lTg   43 (66)
                      .+++.+...   ..|.|.+++.+|+ +.|.|.+.+....
T Consensus        39 ~~~~~~~~~~~~~~l~i~~~~~~d~-G~Y~C~v~~~~~~   76 (86)
T smart00410       39 SGRFSVSRSGSNSTLTISNVTPEDS-GTYTCAATNSSGS   76 (86)
T ss_pred             CCcEEEEEcCCeeEEEEEeeccccC-eEEEEEEEcCCCe
Confidence            456666655   6899999999997 9999999965443


No 115
>smart00409 IG Immunoglobulin.
Probab=96.74  E-value=0.005  Score=33.00  Aligned_cols=35  Identities=31%  Similarity=0.580  Sum_probs=27.7

Q ss_pred             CCeEEEeec---ccEEEeecCCCCCCcceeEEeeccccC
Q psy10521          8 GGKYVVLSS---GDLYVFNATPNDGYKSYRCRTVNKITG   43 (66)
Q Consensus         8 ~~ry~ilps---GeL~I~nv~~~D~~~~Y~C~~~~~lTg   43 (66)
                      .+++.+...   ..|.|.+++.+|+ +.|.|.+.+....
T Consensus        39 ~~~~~~~~~~~~~~l~i~~~~~~d~-G~Y~C~v~~~~~~   76 (86)
T smart00409       39 SGRFSVSRSGSNSTLTISNVTPEDS-GTYTCAATNSSGS   76 (86)
T ss_pred             CCcEEEEEcCCeeEEEEEeeccccC-eEEEEEEEcCCCe
Confidence            456666655   6899999999997 9999999965443


No 116
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin. Ig8_hNephrin_like: domain similar to the eighth immunoglobulin-like domain in human nephrin. Nephrin is an integral component of the slit diaphragm, and is a central component of the glomerular ultrafilter. Nephrin plays a structural role, and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, and an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin, from neighboring foot processes of separate podocyte cells, may interact with each other, and in association with other components of the slit diaphragm, form a porous molecular sieve within the slit pore.  The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the p
Probab=96.73  E-value=0.0024  Score=39.22  Aligned_cols=38  Identities=29%  Similarity=0.478  Sum_probs=27.4

Q ss_pred             ccEEEeecC-CCCCCcceeEEeeccccCcEEecccceeEEEecc
Q psy10521         17 GDLYVFNAT-PNDGYKSYRCRTVNKITGESQASVFQTRLSITGF   59 (66)
Q Consensus        17 GeL~I~nv~-~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v~ep   59 (66)
                      +.|.|.+|. .+| .+.|.|.+.|.+ |+.  +. ...|.+.++
T Consensus        69 s~L~I~~v~~~~D-~G~Y~C~A~N~~-G~~--~~-~i~L~~~~~  107 (109)
T cd05773          69 SILTIINVSAALD-YALFTCTAHNSL-GED--SL-DIQLVSTSR  107 (109)
T ss_pred             eEEEECcCCccCC-CEEEEEEEEeCC-ccC--cE-EEEEEecCC
Confidence            579999998 477 589999999998 332  22 346666653


No 117
>PF00047 ig:  Immunoglobulin domain The Prosite family only concerns antibodies and MHCs.;  InterPro: IPR013151 Members of the immunoglobulin superfamily are found in hundreds of proteins of different functions. Examples include antibodies, the giant muscle kinase titin and receptor tyrosine kinases. Immunoglobulin-like domains may be involved in protein-protein and protein-ligand interactions. The Pfam alignments do not include the first and last strand of the immunoglobulin-like domain.; PDB: 1B6U_A 3O4O_C 3VH8_H 1BIH_A 2C9A_A 2V5Y_A 1BQH_K 2ATP_A 3B9K_A 1NEZ_H ....
Probab=96.71  E-value=0.0016  Score=35.27  Aligned_cols=18  Identities=39%  Similarity=0.739  Sum_probs=17.0

Q ss_pred             EEEeecCCCCCCcceeEEe
Q psy10521         19 LYVFNATPNDGYKSYRCRT   37 (66)
Q Consensus        19 L~I~nv~~~D~~~~Y~C~~   37 (66)
                      |.|.+|+++|+ +.|.|.+
T Consensus        47 L~i~~v~~~d~-G~Y~C~v   64 (64)
T PF00047_consen   47 LTISNVTPEDS-GTYTCVV   64 (64)
T ss_dssp             EEESSCTGGGT-EEEEEEE
T ss_pred             EEEccCCHHHC-EEEEEEC
Confidence            99999999996 9999986


No 118
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d4: the fourth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor fo
Probab=96.69  E-value=0.0013  Score=38.46  Aligned_cols=27  Identities=19%  Similarity=0.234  Sum_probs=23.8

Q ss_pred             ecccEEEeecCCCCCCcceeEEeecccc
Q psy10521         15 SSGDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus        15 psGeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      ..+.|.|.+|..+| .+.|.|.+.|.+-
T Consensus        54 ~~~~L~I~~v~~~D-~g~Y~C~A~N~~G   80 (90)
T cd04972          54 DIYNLQLSNITSET-QTTVTCTAENPVG   80 (90)
T ss_pred             CEEEEEEecCCccc-CEEEEEEEECCCC
Confidence            45789999999999 6999999999873


No 119
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. IG4_PDGFR-alpha: The fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFR alpha binds to all three PDGFs, whereas the PDGFR beta (not included in this group) binds only to PDGF-B. PDGF alpha is organized as an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFR alpha and PDGFR beta are essential for normal development.
Probab=96.68  E-value=0.0026  Score=38.89  Aligned_cols=26  Identities=19%  Similarity=0.201  Sum_probs=23.2

Q ss_pred             ccEEEeecCCCCCCcceeEEeeccccCc
Q psy10521         17 GDLYVFNATPNDGYKSYRCRTVNKITGE   44 (66)
Q Consensus        17 GeL~I~nv~~~D~~~~Y~C~~~~~lTge   44 (66)
                      ..|.|.+++.+|. |.|.|.+.|.. |+
T Consensus        65 s~L~I~~v~~~D~-G~Ytc~A~N~~-g~   90 (101)
T cd05859          65 SKLKLIRAKEEDS-GLYTALAQNED-AV   90 (101)
T ss_pred             cEEEEeeCCHHHC-EEEEEEEEcCC-ce
Confidence            5799999999996 99999999985 44


No 120
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain. IgC_Tapasin_R: Immunoglobulin-like domain on Tapasin-R. Tapasin is a V-C1 (variable-constant) immunoglobulin superfamily molecule present in the endoplasmic reticulum (ER), where it links MHC class I molecules to the transporter associated with antigen processing (TAP). Tapasin-R is a tapasin-related protein that contains similar structural motifs to Tapasin, with some marked differences, especially in the V domain, transmembrane and cytoplasmic regions. The majority of Tapasin-R is located within the ER; however, there may be some expression of Tapasin-R at the cell surface. Tapasin-R lacks an obvious ER retention signal.
Probab=96.66  E-value=0.0017  Score=40.84  Aligned_cols=22  Identities=23%  Similarity=0.329  Sum_probs=19.9

Q ss_pred             cEEEeecCCCCCCcceeEEeecc
Q psy10521         18 DLYVFNATPNDGYKSYRCRTVNK   40 (66)
Q Consensus        18 eL~I~nv~~~D~~~~Y~C~~~~~   40 (66)
                      .|.|.||+.+|+ |.|.|++.+.
T Consensus         2 sL~i~~v~~~D~-G~Y~C~~~~~   23 (139)
T cd05771           2 SLTLPGLTVHDE-GTYICSVSTP   23 (139)
T ss_pred             eEEECCCCHHHC-EEEEEEEEcc
Confidence            489999999996 9999999875


No 121
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. Ig_Aggrecan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. These aggregates contribute to the tissue's load bearing properties. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Aggrecan has a wide distribution in connective tissue and extracellular matrices. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=96.66  E-value=0.0034  Score=39.50  Aligned_cols=35  Identities=20%  Similarity=0.425  Sum_probs=28.6

Q ss_pred             CeEEEee------cccEEEeecCCCCCCcceeEEeeccccCc
Q psy10521          9 GKYVVLS------SGDLYVFNATPNDGYKSYRCRTVNKITGE   44 (66)
Q Consensus         9 ~ry~ilp------sGeL~I~nv~~~D~~~~Y~C~~~~~lTge   44 (66)
                      +|+.+..      +..|.|.|++.+|. +.|+|.+.+-+-.+
T Consensus        60 ~R~sl~~~~~~~~~asL~I~nl~~sDs-G~Y~C~V~~g~~~~  100 (112)
T cd05900          60 DRVSLPNYPAIPSDATLEITELRSNDS-GTYRCEVMHGIEDN  100 (112)
T ss_pred             CeEEecccCCCCCCcEEEEeecccccC-EEEEEEEecCCCCc
Confidence            4777742      77899999999996 99999999875544


No 122
>KOG3513|consensus
Probab=96.65  E-value=0.0038  Score=52.25  Aligned_cols=53  Identities=17%  Similarity=0.145  Sum_probs=44.3

Q ss_pred             ccCccCC--eEEEeecccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEEe
Q psy10521          3 SDDFVGG--KYVVLSSGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSIT   57 (66)
Q Consensus         3 ps~~~~~--ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v~   57 (66)
                      |.+..+.  |+.+..+|+|||.||..+|. +.|.|-+.++.|..-+... +..|++.
T Consensus       177 ~~~~~~~~~r~~~~~~G~Lyfs~V~~~D~-~~Y~C~a~~~~~~~~v~~~-~~~L~~~  231 (1051)
T KOG3513|consen  177 PHFVQIDNRRVFSQENGNLYFSNVETSDF-GNYICSATFPSTQTIVQGP-PFPLIVR  231 (1051)
T ss_pred             CcccccCcceeEecccceEEEeecchhhc-CceEEEEEchhhcccccCC-ceeEEEc
Confidence            4444444  88888999999999999997 9999999999998888877 7778773


No 123
>smart00406 IGv Immunoglobulin V-Type.
Probab=96.56  E-value=0.0013  Score=36.45  Aligned_cols=30  Identities=20%  Similarity=0.330  Sum_probs=24.0

Q ss_pred             cCCeEEEeec-----ccEEEeecCCCCCCcceeEEe
Q psy10521          7 VGGKYVVLSS-----GDLYVFNATPNDGYKSYRCRT   37 (66)
Q Consensus         7 ~~~ry~ilps-----GeL~I~nv~~~D~~~~Y~C~~   37 (66)
                      ..+|+.+...     ..|.|.|++.+|. +.|.|++
T Consensus        47 ~~~R~~~~~~~~~~~~~L~i~~~~~~D~-G~Y~C~v   81 (81)
T smart00406       47 YKGRVTISKDTSKNDVSLTISNLRVEDT-GTYYCAV   81 (81)
T ss_pred             cCCcEEEEecCcCCEEEEEEcCCCHHHC-EEEEEcC
Confidence            3578877644     4589999999996 9999974


No 124
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). Ig5_KIRREL3: the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1). These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development. Neph1 and 2 may mediate axonal guidance and synapse formation in certain areas of the CNS. In the kidney, they participate in the formation of the slit diaphragm.
Probab=96.56  E-value=0.004  Score=38.55  Aligned_cols=36  Identities=22%  Similarity=0.296  Sum_probs=29.2

Q ss_pred             CCeEEEee-------cccEEEeecCCCCCCcceeEEeeccccC
Q psy10521          8 GGKYVVLS-------SGDLYVFNATPNDGYKSYRCRTVNKITG   43 (66)
Q Consensus         8 ~~ry~ilp-------sGeL~I~nv~~~D~~~~Y~C~~~~~lTg   43 (66)
                      .+||.|..       .=+|.|.|+..+|-.+.|.|.+.|.+=.
T Consensus        48 ~~r~~I~~~~~~~g~~S~L~I~~~~~~d~~g~Y~C~a~N~~G~   90 (98)
T cd05898          48 SERYTVERTSTGSGVLSTLTINNIMEADFQTHYNCTAWNSFGS   90 (98)
T ss_pred             CCCEEEEEEccCCCcEEEEEECCCccccCCcEEEEEEEeCCcc
Confidence            57998854       3379999999888668999999998743


No 125
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig2_FcgammaR_like: domain similar to the second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=96.54  E-value=0.0015  Score=38.39  Aligned_cols=25  Identities=28%  Similarity=0.418  Sum_probs=22.7

Q ss_pred             cccEEEeecCCCCCCcceeEEeeccc
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      +++|.|.+++.+|. |.|+|++.+..
T Consensus        47 ~~~l~I~~~~~~ds-G~Y~C~~~~~~   71 (83)
T cd05753          47 NSNLSIPQATLSDS-GSYHCSGIIGS   71 (83)
T ss_pred             CceEEECccCHHHC-EEEEEEEEeCC
Confidence            57899999999996 99999999875


No 126
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain. IgV_TCR_gamma: immunoglobulin (Ig) variable (V) domain of the gamma chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=96.53  E-value=0.0054  Score=37.21  Aligned_cols=47  Identities=17%  Similarity=0.180  Sum_probs=31.7

Q ss_pred             CCeEEEeec-----ccEEEeecCCCCCCcceeEEeecccc--CcEEecccceeEEE
Q psy10521          8 GGKYVVLSS-----GDLYVFNATPNDGYKSYRCRTVNKIT--GESQASVFQTRLSI   56 (66)
Q Consensus         8 ~~ry~ilps-----GeL~I~nv~~~D~~~~Y~C~~~~~lT--ge~~~S~~~~~l~v   56 (66)
                      .+||.+..+     -.|.|.+++.+|. +.|.|++...-.  .+..... +.+|.|
T Consensus        63 ~~r~~~~~~~~~~~~~L~I~~~~~~Ds-g~Y~C~~~~~~~~~~~~~fg~-gt~l~V  116 (116)
T cd04982          63 KNKFEARKDVGKSTSTLTIQNLEKEDS-ATYYCAYWESGSSYYIKVFGS-GTKLIV  116 (116)
T ss_pred             CCCEEEEEECCCCEEEEEEEECCHHHC-EEEEEEEecCCCCccceEECC-CEEEeC
Confidence            578887633     3699999999996 999999975311  2333333 555554


No 127
>PHA02826 IL-1 receptor-like protein; Provisional
Probab=96.53  E-value=0.0056  Score=42.62  Aligned_cols=38  Identities=16%  Similarity=0.228  Sum_probs=29.0

Q ss_pred             CCeEEEeec-ccEEEeecCCCCCCcceeEEeeccccCcEE
Q psy10521          8 GGKYVVLSS-GDLYVFNATPNDGYKSYRCRTVNKITGESQ   46 (66)
Q Consensus         8 ~~ry~ilps-GeL~I~nv~~~D~~~~Y~C~~~~~lTge~~   46 (66)
                      ++++.+..+ +.|.|.||+.+|+ |.|.|.+....-|...
T Consensus       178 ~~r~~~~~~~~~L~I~~V~~~Ds-G~YtC~a~~~~~g~~y  216 (227)
T PHA02826        178 TDRIQLRNNNSTLVIKSATHDDS-GIYTCNLRFNKNSNNY  216 (227)
T ss_pred             CCCEEEeCCCCEEEECcCCHHhC-EEEEEEEEEeECCEEE
Confidence            446666554 4799999999996 9999999987655443


No 128
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins. Ig_P0ex-like: domain similar to the immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an extracellular Ig domain. The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin. This group also contains the Ig domain of Sodium channel subunit beta-2 
Probab=96.40  E-value=0.0028  Score=38.89  Aligned_cols=23  Identities=22%  Similarity=0.447  Sum_probs=20.8

Q ss_pred             ccEEEeecCCCCCCcceeEEeecc
Q psy10521         17 GDLYVFNATPNDGYKSYRCRTVNK   40 (66)
Q Consensus        17 GeL~I~nv~~~D~~~~Y~C~~~~~   40 (66)
                      ..|.|.||+.+|+ +.|.|++.|.
T Consensus        80 ~sL~I~~v~~~D~-G~Y~C~v~~~  102 (116)
T cd05715          80 ASIVIHNLQFTDN-GTYTCDVKNP  102 (116)
T ss_pred             eEEEEeeCCcccC-EEEEEEEEeC
Confidence            4599999999996 9999999976


No 129
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain. IgV_TCR_delta: immunoglobulin (Ig) variable (V) domain of the delta chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=96.39  E-value=0.0072  Score=36.83  Aligned_cols=48  Identities=19%  Similarity=0.207  Sum_probs=35.0

Q ss_pred             CCeEEEe--ec---ccEEEeecCCCCCCcceeEEeecccc-----CcEEecccceeEEEe
Q psy10521          8 GGKYVVL--SS---GDLYVFNATPNDGYKSYRCRTVNKIT-----GESQASVFQTRLSIT   57 (66)
Q Consensus         8 ~~ry~il--ps---GeL~I~nv~~~D~~~~Y~C~~~~~lT-----ge~~~S~~~~~l~v~   57 (66)
                      .+||.+.  .+   -.|.|.+++.+|. +.|.|++.....     .+..... +.+|.|.
T Consensus        58 ~~R~~~~~~~~~~~~sL~I~~~~~~Ds-g~Y~C~~~~~~~~~~~~~~~~fg~-gt~l~v~  115 (116)
T cd07706          58 KGRYSVNFQKAQKSISLTISALQLEDS-AKYFCALSTLGMGSYDTDKLIFGK-GTRVTVE  115 (116)
T ss_pred             CCeEEEEEeccCCEEEEEECCCCHHHC-EEEEEEEECCCCCcccccCCEECC-CeEEEEc
Confidence            4789885  22   2599999999996 999999996543     3344454 7788775


No 130
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). Ig_M-protein_C: the C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). M-protein is a structural protein localized to the M-band, a transverse structure in the center of the sarcomere, and is a candidate for M-band bridges. M-protein is modular consisting mainly of repetitive IG-like and fibronectin type III (FnIII) domains, and has a muscle-type specific expression pattern. M-protein is present in fast fibers.
Probab=96.36  E-value=0.0077  Score=35.72  Aligned_cols=36  Identities=31%  Similarity=0.433  Sum_probs=26.7

Q ss_pred             CCeEEEe-ecc---cEEEeecCCCCCCcceeEEeeccccCc
Q psy10521          8 GGKYVVL-SSG---DLYVFNATPNDGYKSYRCRTVNKITGE   44 (66)
Q Consensus         8 ~~ry~il-psG---eL~I~nv~~~D~~~~Y~C~~~~~lTge   44 (66)
                      +++|.+. .+|   .|.|.+++.+|. +.|.|.+.|.+-.+
T Consensus        45 ~~~~~~~~~~~~~~~L~I~~~~~~D~-G~Y~C~a~N~~G~~   84 (92)
T cd05891          45 SEHYSVKLEQGKYASLTIKGVTSEDS-GKYSINVKNKYGGE   84 (92)
T ss_pred             CCCEEEEEcCCCEEEEEECCCChhhC-EEEEEEEEeCCCce
Confidence            3455543 333   699999999996 99999999975443


No 131
>PHA02826 IL-1 receptor-like protein; Provisional
Probab=96.35  E-value=0.0043  Score=43.20  Aligned_cols=26  Identities=23%  Similarity=0.285  Sum_probs=23.3

Q ss_pred             ecccEEEeecCCCCCCcceeEEeeccc
Q psy10521         15 SSGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus        15 psGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      ..+.|.|.+|+.+|+ |.|.|++.|..
T Consensus        96 r~~~L~I~~v~~~Ds-G~Y~C~a~N~~  121 (227)
T PHA02826         96 RSENLWIGNVINIDE-GIYICTISSGN  121 (227)
T ss_pred             CCCeEEECCCChHHC-EEEEEEEEECC
Confidence            367999999999996 99999999955


No 132
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins. Ig1_ MRC-OX-2_like: domain similar to the first immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200). MRC OX-2 is a membrane glycoprotein expressed in a variety of lymphoid and non-lymphoid cells in rats. It has a similar broad distribution pattern in humans. MRC OX-2 may regulate myeloid cell activity. The protein has an extracellular portion containing two Ig-like domains, a transmembrane portion, and a cytoplasmic portion.
Probab=96.32  E-value=0.0054  Score=36.54  Aligned_cols=28  Identities=25%  Similarity=0.402  Sum_probs=23.8

Q ss_pred             cccEEEeecCCCCCCcceeEEeeccccCc
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKITGE   44 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~lTge   44 (66)
                      +..|.|+||+.+|. +.|+|.+...-.|.
T Consensus        60 ~~sL~I~nv~~~D~-G~Y~C~~~~~p~g~   87 (97)
T cd05846          60 STSITIWNVTLEDE-GCYKCIFNTFPDGS   87 (97)
T ss_pred             ccEEEEeCCceeee-EEEEEEEEeCCCCC
Confidence            55699999999996 99999998766665


No 133
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. Ig1_CD4; first immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=96.31  E-value=0.0019  Score=39.59  Aligned_cols=21  Identities=29%  Similarity=0.509  Sum_probs=19.9

Q ss_pred             EEEeecCCCCCCcceeEEeecc
Q psy10521         19 LYVFNATPNDGYKSYRCRTVNK   40 (66)
Q Consensus        19 L~I~nv~~~D~~~~Y~C~~~~~   40 (66)
                      |.|.|++.+|. ++|.|.+-|+
T Consensus        67 L~I~~l~~sDs-gtY~C~v~~~   87 (94)
T cd07690          67 LIIKNLKIEDS-DTYICEVEDK   87 (94)
T ss_pred             EEECCCCHHHC-EEEEEEECCc
Confidence            99999999996 9999999887


No 134
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins. Ig1_DNAM-1_like: domain similar to the first immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226). DNAM-1 is a transmembrane protein having two Ig-like domains. It is an adhesion molecule which plays a part in tumor-directed cytotoxicity and adhesion in natural killer (NK) cells and T lymphocytes. It has been shown to regulate the NK cell killing of several tumor types, including myeloma cells and ovarian carcinoma cells. DNAM-1 interacts specifically with poliovirus receptor (PVR; CD155) and nectin -2 (CD211), other members of the Ig superfamily. DNAM-1 is expressed in most peripheral T cells, NK cells, monocytes and a subset of B lymphocytes.
Probab=96.16  E-value=0.007  Score=37.25  Aligned_cols=32  Identities=28%  Similarity=0.236  Sum_probs=27.6

Q ss_pred             cccEEEeecCCCCCCcceeEEeeccccCcEEec
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKITGESQAS   48 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S   48 (66)
                      ++.|.|+||+.+|. |.|+|.+...=+|.....
T Consensus        59 d~sI~i~nvt~~D~-G~Y~C~~~t~P~g~~~~~   90 (96)
T cd05889          59 DMSLSFNNATEEDV-GLYCCSLVTYPQGSWEKV   90 (96)
T ss_pred             ccEEEEcCCCcccC-EEEEEEEEeCCCCCeEEE
Confidence            68999999999996 999999998878776543


No 135
>PF13927 Ig_3:  Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C ....
Probab=96.08  E-value=0.0059  Score=32.84  Aligned_cols=28  Identities=29%  Similarity=0.356  Sum_probs=23.1

Q ss_pred             EEEeecccEEEeecCCCCCCcceeEEeec
Q psy10521         11 YVVLSSGDLYVFNATPNDGYKSYRCRTVN   39 (66)
Q Consensus        11 y~ilpsGeL~I~nv~~~D~~~~Y~C~~~~   39 (66)
                      ..-..++.|.|.+|..+|. +.|.|++.|
T Consensus        48 ~~~~~~~~L~i~~v~~~~~-g~y~C~a~N   75 (75)
T PF13927_consen   48 GSSSSNSTLTISNVTRSDN-GTYTCIASN   75 (75)
T ss_dssp             EEEEEEEEEEESSCCGGGT-EEEEEEEEE
T ss_pred             eccceeeEEEEccCCHHhC-cEEEEEEEC
Confidence            3344588999999999995 889999976


No 136
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins. Ig2_FGFR_like: domain similar to the second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three Ig-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin 
Probab=96.06  E-value=0.0066  Score=33.92  Aligned_cols=24  Identities=29%  Similarity=0.444  Sum_probs=21.4

Q ss_pred             ccEEEeecCCCCCCcceeEEeeccc
Q psy10521         17 GDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus        17 GeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      ..|.|.+++.+|. +.|.|.+.|.+
T Consensus        51 ~~l~i~~~~~~d~-g~Y~C~~~n~~   74 (85)
T cd05729          51 WTLILESVVPSDS-GKYTCIVENKY   74 (85)
T ss_pred             EEEEEeECCcccC-EEEEEEEEECC
Confidence            4699999999995 99999999876


No 137
>KOG4222|consensus
Probab=96.05  E-value=0.01  Score=50.50  Aligned_cols=48  Identities=29%  Similarity=0.478  Sum_probs=38.8

Q ss_pred             CeEEEeecccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEEeccc
Q psy10521          9 GKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSITGFR   60 (66)
Q Consensus         9 ~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v~ep~   60 (66)
                      .++.+...|.|.|.||..+|+ |+|.|.+.|. -||. .|. +++|.|.|.-
T Consensus       179 ~~~~lisgG~LlIsnvrksD~-GtY~CVatNm-vG~R-eS~-~A~lsv~e~P  226 (1281)
T KOG4222|consen  179 PIIALISGGNLLISNVRKSDE-GTYACVATNM-VGER-ESI-PARLSVQEKP  226 (1281)
T ss_pred             eeEEEecCCcEEEeccccCCC-ceeeeeeccc-cccc-ccc-cceeeeccCC
Confidence            456667899999999999996 9999999885 4553 354 8899998753


No 138
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain. IgV_CD8_beta: immunoglobulin (Ig)-like domain in CD8 beta. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain.
Probab=95.97  E-value=0.011  Score=35.79  Aligned_cols=45  Identities=29%  Similarity=0.427  Sum_probs=30.8

Q ss_pred             CCeEEE--eecc---cEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEE
Q psy10521          8 GGKYVV--LSSG---DLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSI   56 (66)
Q Consensus         8 ~~ry~i--lpsG---eL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v   56 (66)
                      .+||.+  .+++   .|.|.+++.+|. +.|.|...+.  ......+ +.+|.|
T Consensus        58 ~~rf~~~~~~~~~~~~L~I~~~~~~Ds-g~YyCa~~~~--~~~~Fg~-gT~L~V  107 (107)
T cd07700          58 QEKFSIRVTSDSSRYRLHINRVKPEDS-GTYFCMTVGS--PELTFGT-GTQLSV  107 (107)
T ss_pred             cCcEEEEEECCCCEEEEEECCCCHHHC-EEEEEeEcCC--CCCEECc-CEEEeC
Confidence            357765  3333   399999999996 9999998743  3344454 666654


No 139
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. Ig_Neurocan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Unlike aggrecan which is widely distributed in connective tissue and extracellular matrices, neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many differen
Probab=95.88  E-value=0.01  Score=37.23  Aligned_cols=33  Identities=24%  Similarity=0.403  Sum_probs=26.9

Q ss_pred             CCeEEEee------cccEEEeecCCCCCCcceeEEeeccc
Q psy10521          8 GGKYVVLS------SGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus         8 ~~ry~ilp------sGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      .||..+..      +..|.|.||+.+|. +.|+|.+.+-.
T Consensus        57 ~gRvsl~~~~~~~~~asL~i~nv~~~D~-G~Y~C~v~~g~   95 (110)
T cd05902          57 QGRVSLPGYPKNRYNASLVLSRLRYSDS-GTYRCEVVLGI   95 (110)
T ss_pred             ccEEEeecCCCCCceEEEEECCCCHHHC-EEEEEEEEECC
Confidence            46777743      55899999999996 99999999843


No 140
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). Ig_pIgR: Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). pIgR delivers dimeric IgA and pentameric IgM to mucosal secretions. Polymeric immunoglobulin (pIgs) are the first defense against pathogens and toxins. IgA and IgM can form polymers via an 18-residue extension at their c-termini referred to as the tailpiece. pIgR transports pIgs across mucosal epithelia into mucosal secretions. Human pIgR is a glycosylated type I transmembrane protein, comprised of a 620 residue extracellular region, a 23 residue transmembrane region, and a 103 residue cytoplasmic tail. The extracellular region contains five domains that share sequence similarity with Ig variable (v) regions.
Probab=95.83  E-value=0.011  Score=34.77  Aligned_cols=34  Identities=12%  Similarity=0.122  Sum_probs=26.9

Q ss_pred             cCCeEEEeec-----ccEEEeecCCCCCCcceeEEeeccc
Q psy10521          7 VGGKYVVLSS-----GDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus         7 ~~~ry~ilps-----GeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      ..+|+.+..+     -.|.|.+|+.+|. +.|.|++....
T Consensus        49 ~~~r~~~~~~~~~~~~~L~I~~v~~~Ds-G~Y~C~~~~~~   87 (98)
T cd05716          49 YEGRVSLTDDPDNGVFTVTLNQLRKEDA-GWYWCGVGDDG   87 (98)
T ss_pred             cCCCEEEEecCCCCEEEEEEcCCCHHHC-EEEEEEcccCC
Confidence            3578887532     2599999999996 99999998764


No 141
>PHA02785 IL-beta-binding protein; Provisional
Probab=95.66  E-value=0.012  Score=42.48  Aligned_cols=25  Identities=12%  Similarity=0.294  Sum_probs=22.9

Q ss_pred             cccEEEeecCCCCCCcceeEEeeccc
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      +|.|.|.+|+.+|. +.|.|.|.|..
T Consensus       291 ~~~L~I~~V~~~D~-G~Y~C~A~n~~  315 (326)
T PHA02785        291 TSRLNINPVKEEDA-TTFTCMAFTIP  315 (326)
T ss_pred             eEEEEECCcchhcC-eeeEEEEEecc
Confidence            57899999999996 99999999976


No 142
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. Ig_Versican: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Like aggrecan, versican has a wide distribution in connective tissue and extracellular matrices. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA
Probab=95.65  E-value=0.013  Score=37.63  Aligned_cols=36  Identities=25%  Similarity=0.441  Sum_probs=28.2

Q ss_pred             CCeEEEee------cccEEEeecCCCCCCcceeEEeeccccCc
Q psy10521          8 GGKYVVLS------SGDLYVFNATPNDGYKSYRCRTVNKITGE   44 (66)
Q Consensus         8 ~~ry~ilp------sGeL~I~nv~~~D~~~~Y~C~~~~~lTge   44 (66)
                      .||-.+..      +..|.|.||+.+|. |.|+|.+.+....+
T Consensus        64 ~gRv~l~~~~~~~g~asL~i~~v~~sD~-G~Y~C~V~~g~~~~  105 (117)
T cd05901          64 MGRVSVPSHPEDQGDASLTIVKLRASDA-GVYRCEVMHGIEDT  105 (117)
T ss_pred             cCcEEeeccCCcCCceEEEEcccccccC-EEEEEEEEECCccc
Confidence            45666642      57899999999996 99999999876433


No 143
>PF13895 Ig_2:  Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A ....
Probab=95.52  E-value=0.028  Score=30.68  Aligned_cols=24  Identities=33%  Similarity=0.702  Sum_probs=20.3

Q ss_pred             cEEEeecCCCCCCcceeEEeecccc
Q psy10521         18 DLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus        18 eL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      .|+|.+++.+|. +.|.|++.+.-.
T Consensus        46 ~~~~~~~~~~~~-g~y~C~~~~~~~   69 (80)
T PF13895_consen   46 GLFIPNVSPEDS-GNYTCRASNGSG   69 (80)
T ss_dssp             EEEESSEEGGGT-EEEEEEEEETTE
T ss_pred             eeeeeeeccccC-EEEEEEEEeCCC
Confidence            399999999985 999999988543


No 144
>PHA03376 BARF1; Provisional
Probab=95.27  E-value=0.057  Score=38.48  Aligned_cols=50  Identities=20%  Similarity=0.174  Sum_probs=36.6

Q ss_pred             CCeEEEee---cccEEEeecCCCCCCcceeEEeeccccCcEEeccc----ceeEEEec
Q psy10521          8 GGKYVVLS---SGDLYVFNATPNDGYKSYRCRTVNKITGESQASVF----QTRLSITG   58 (66)
Q Consensus         8 ~~ry~ilp---sGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~----~~~l~v~e   58 (66)
                      .|++.|..   +=.|.|.|++.+|. |+|+|.+...-+|-.++.-.    +-.|.|..
T Consensus        75 RGrtD~~~~~gnvsLvI~~l~lSDd-GtY~C~fQkge~~~~k~ehLt~V~~~~Lsv~a  131 (221)
T PHA03376         75 RGFFDIHRSANTFFLVVTAANISHD-GNYLCRMKLGETEVTKQEHLSVVKPLTLSVHS  131 (221)
T ss_pred             ccEEEEEecCCeEEEEEEeeeecCC-ceEEEEEEcCCCceeeeeeeeeeecceEEEEe
Confidence            46677743   33589999999995 99999999988888887531    22366654


No 145
>KOG4221|consensus
Probab=94.98  E-value=0.055  Score=46.52  Aligned_cols=48  Identities=25%  Similarity=0.437  Sum_probs=37.1

Q ss_pred             CeEEEeecccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEEecccc
Q psy10521          9 GKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSITGFRA   61 (66)
Q Consensus         9 ~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v~ep~~   61 (66)
                      -|+.++-.++|+|.|++.+|. +.|.|++.|  |.+....  .+.|.|..|-+
T Consensus       283 ~rivl~g~~slliS~a~~~dS-g~YtC~Atn--~~D~ida--saev~V~a~P~  330 (1381)
T KOG4221|consen  283 YRIVLVGGSSLLISNATDDDS-GKYTCRATN--TNDSIDA--SAEVTVLAPPG  330 (1381)
T ss_pred             eEEEEecccceEEeccccccC-ceEEEEecC--CCccccc--ceEEEEEcCCC
Confidence            477777899999999999995 999999999  5554433  45666665543


No 146
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig3_RPTP_IIa_LAR_like: domain similar to the third immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple IG-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains. Included in this group is Drosophila LAR (DLAR).
Probab=94.90  E-value=0.038  Score=31.27  Aligned_cols=23  Identities=17%  Similarity=0.366  Sum_probs=19.2

Q ss_pred             cccEEEeecCCCCCCcceeEEeeccc
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      .+.|.|.|++  | .+.|.|.+.|.+
T Consensus        37 ~~~L~i~~~~--d-~G~Y~C~A~N~~   59 (69)
T cd05739          37 RNVLELTNIY--E-SANYTCVAISSL   59 (69)
T ss_pred             ccEEEEeccc--c-CeeEEEEEEeCC
Confidence            4579999986  4 379999999987


No 147
>KOG4194|consensus
Probab=94.86  E-value=0.056  Score=44.27  Aligned_cols=52  Identities=17%  Similarity=0.286  Sum_probs=40.2

Q ss_pred             CCeEEEee-cccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEEec-cccccc
Q psy10521          8 GGKYVVLS-SGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSITG-FRAVYS   64 (66)
Q Consensus         8 ~~ry~ilp-sGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v~e-p~~~~~   64 (66)
                      +.|-+++| .-..+|.||..||. |-|.|.+.|. .|+.+.+   |.|+|-| |.-+.|
T Consensus       659 eRRl~Vmpedd~f~Itnvk~eD~-GiYtC~A~n~-AG~isan---AtL~V~e~p~f~~P  712 (873)
T KOG4194|consen  659 ERRLHVMPEDDVFFITNVKIEDQ-GIYTCTAQNV-AGQISAN---ATLTVLETPSFSIP  712 (873)
T ss_pred             hheeeecCCCCEEEEeccccccc-ceeEEeeecc-ccceeec---eEEEEecCCccccc
Confidence            34777888 66789999999995 9999999986 6776655   3777776 566655


No 148
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain. Ig_CD8_alpha: immunoglobulin (Ig)-like domain in CD8 alpha. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alphaalpha or alphabeta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a v-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain. The Ig domain of CD8 alpha binds to antibodies.
Probab=94.82  E-value=0.026  Score=34.22  Aligned_cols=31  Identities=16%  Similarity=0.134  Sum_probs=24.7

Q ss_pred             CCeEEEee---cccEEEeecCCCCCCcceeEEeec
Q psy10521          8 GGKYVVLS---SGDLYVFNATPNDGYKSYRCRTVN   39 (66)
Q Consensus         8 ~~ry~ilp---sGeL~I~nv~~~D~~~~Y~C~~~~   39 (66)
                      .+||.+..   .-.|.|.+++.+|. +.|.|++..
T Consensus        57 ~~rf~~~~~~~~~~L~I~~~~~sDs-gtY~Ca~~~   90 (104)
T cd05720          57 SKRFSGSRSSNSFVLTLKNFQKENE-GYYFCSVAS   90 (104)
T ss_pred             CceEEEEecCCEEEEEECCCCHHHC-EEEEEEEcc
Confidence            46788744   33599999999996 999999863


No 149
>PHA02633 hypothetical protein; Provisional
Probab=94.68  E-value=0.036  Score=32.73  Aligned_cols=25  Identities=28%  Similarity=0.561  Sum_probs=22.7

Q ss_pred             ecccEEEeecCCCCCCcceeEEeecc
Q psy10521         15 SSGDLYVFNATPNDGYKSYRCRTVNK   40 (66)
Q Consensus        15 psGeL~I~nv~~~D~~~~Y~C~~~~~   40 (66)
                      -...|.|.++..+|. |.|.|+++|.
T Consensus        16 ~~~nLwilpa~~sDS-GiYiC~~rn~   40 (63)
T PHA02633         16 NCNNMLILNPTQSDS-GIYMCITKNE   40 (63)
T ss_pred             ccccEEEeccccccC-cEEEEEEcCC
Confidence            578899999999996 9999999975


No 150
>cd00096 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=94.47  E-value=0.038  Score=27.53  Aligned_cols=28  Identities=29%  Similarity=0.389  Sum_probs=23.8

Q ss_pred             EeecccEEEeecCCCCCCcceeEEeeccc
Q psy10521         13 VLSSGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus        13 ilpsGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      ......|.|.+++.+|. +.|.|.+.+..
T Consensus        39 ~~~~~~l~i~~~~~~d~-g~y~C~~~~~~   66 (74)
T cd00096          39 SSGSSTLTISNVTLEDS-GTYTCVASNSA   66 (74)
T ss_pred             ceeEEEEEECccCcccC-cEEEEEEecCc
Confidence            44577799999999996 99999999876


No 151
>PF07354 Sp38:  Zona-pellucida-binding protein (Sp38);  InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals. These are sperm proteins that bind to the 90 kDa family of zona pellucida glycoproteins in a calcium-dependent manner []. These represent some of the specific molecules that mediate the first steps of gamete interaction, allowing fertilisation to occur [].; GO: 0007339 binding of sperm to zona pellucida, 0005576 extracellular region
Probab=94.05  E-value=0.08  Score=38.80  Aligned_cols=32  Identities=22%  Similarity=0.235  Sum_probs=29.2

Q ss_pred             CeEEEeecccEEEeecCCCCCCcceeEEeeccc
Q psy10521          9 GKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus         9 ~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      ++.-|.++|+|.+.|.+.++. |.|.|...++.
T Consensus        29 ~~~nIT~TG~L~~~~F~esmS-G~YTCtLsYk~   60 (271)
T PF07354_consen   29 SYVNITETGKLMFKNFQESMS-GSYTCTLSYKP   60 (271)
T ss_pred             CeEEEccCceEEeeccccccC-CceEEEEEEEe
Confidence            356778999999999999996 99999999998


No 152
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI. IG_FcalphaRI : immunoglobulin (IG)-like domain of of FcalphaRI. FcalphaRI (CD89) is an IgA-specific receptor that is expressed on monocytes, eosinophils, neutrophils and macrophages. FcalphaRI mediates IgA-induced immune effector responses such as phagocytosis, antibody-dependent cell-mediated cytotoxicity and respiratory burst. Both monomeric and dimeric IgA can bind to FcalphaRI, and monomeric or dimeric IgA immune complexes can activate phagocytosis and other immune responses through the clustering of FcalphaRI. The Fc RI ectodomain is comprised of two Ig-like domains oriented at about 90 degree to each another.
Probab=93.55  E-value=0.091  Score=31.42  Aligned_cols=24  Identities=21%  Similarity=0.369  Sum_probs=20.1

Q ss_pred             cccEEEeecCCCCCCcceeEEeecc
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNK   40 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~   40 (66)
                      ..++.|.+++.+|+ |.|+|+....
T Consensus        54 ~a~f~I~~~~~~~~-G~Y~C~~~~~   77 (94)
T cd05711          54 QASFPLGPVTPAHA-GTYRCYGSYN   77 (94)
T ss_pred             EEEEEecCCCcccC-EEEEEEEECC
Confidence            33689999999997 9999998644


No 153
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1). Ig1_ IL1RAPL-1_like: domain similar to the first immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1).  IL-1 alpha and IL-1 beta are cytokines which participates in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of 
Probab=93.53  E-value=0.1  Score=33.17  Aligned_cols=27  Identities=19%  Similarity=0.267  Sum_probs=24.0

Q ss_pred             eecccEEEeecCCCCCCcceeEEeeccc
Q psy10521         14 LSSGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus        14 lpsGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      .-...|.|..+..||. |.|.|+++|.-
T Consensus        67 ~~~~~Lwf~Pa~~eDS-G~Y~C~~rN~t   93 (104)
T cd05896          67 KEEDSIWFRPAELQDS-GLYTCVLRNST   93 (104)
T ss_pred             EeCCEEEEEeCChhhC-eEEEEEECCCC
Confidence            4578899999999996 99999999873


No 154
>cd00098 IgC Immunoglobulin Constant domain. IgC: Immunoglobulin constant domain (IgC). Members of the IgC family are components of immunoglobulin, T-cell receptors, CD1 cell surface glycoproteins, secretory glycoproteins A/C, and Major Histocompatibility Complex (MHC) class I/II molecules. In immunoglobulins, each chain is composed of one variable domain (IgV) and one or more IgC domains. These names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. The IgV domain is responsible for antigen binding, and the IgC domain is involved in oligomerization and molecular interactions.
Probab=92.26  E-value=0.15  Score=29.29  Aligned_cols=34  Identities=26%  Similarity=0.340  Sum_probs=21.4

Q ss_pred             cCCeEEEeecccEEEeecCCCCCCcceeEEeeccccC
Q psy10521          7 VGGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKITG   43 (66)
Q Consensus         7 ~~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lTg   43 (66)
                      .+|.|.+  ..-|.|....++| .+.|.|++.|.--.
T Consensus        54 ~~gt~~~--~s~l~v~~~~~~~-~~~y~C~v~h~~~~   87 (95)
T cd00098          54 SDGTYSV--SSQLTVSPSDWNS-GDTYTCVVTHESLP   87 (95)
T ss_pred             CCCCEEE--EEEEEECHHHhCC-CCCEEEEEEeCCCC
Confidence            3445554  3335555555556 59999999998554


No 155
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). Ig2_KIRREL3-like: domain similar to the second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=91.90  E-value=0.17  Score=28.85  Aligned_cols=26  Identities=15%  Similarity=0.312  Sum_probs=19.1

Q ss_pred             cEEEeecCCCCCCcceeEEeeccccCc
Q psy10521         18 DLYVFNATPNDGYKSYRCRTVNKITGE   44 (66)
Q Consensus        18 eL~I~nv~~~D~~~~Y~C~~~~~lTge   44 (66)
                      .|.|....++| .+.|+|++.|+.-.+
T Consensus        47 ~L~i~~~~~~~-~~~y~C~a~n~~l~~   72 (82)
T cd05759          47 TLPITPSDHDT-GRTFTCRARNEALPT   72 (82)
T ss_pred             EEEEeCceecC-CCEEEEEEcCccCCC
Confidence            46677666666 489999999986433


No 156
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Ig2_Necl-4: second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1-Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Ig domains are likely to participate in ligand binding and recognition. Necl-4 is expressed on Schwann cells, and plays a key part in initiating peripheral nervous system (PNS) myelination.  In injured peripheral nerve cells, the mRNA signal for both Necl-4 and Necl-5 was observed to be elevated.  Necl-4 participates in cell-cell adhesion and is proposed to play a role in tumor suppression.
Probab=91.16  E-value=0.24  Score=29.67  Aligned_cols=29  Identities=10%  Similarity=0.037  Sum_probs=22.6

Q ss_pred             ecccEEEeecCCCCCCcceeEEeeccccCc
Q psy10521         15 SSGDLYVFNATPNDGYKSYRCRTVNKITGE   44 (66)
Q Consensus        15 psGeL~I~nv~~~D~~~~Y~C~~~~~lTge   44 (66)
                      -+|.|.|.=+..+| .+.|.|++.|+...+
T Consensus        41 ~~s~L~~~~~~~Dd-g~~~~C~A~n~a~~~   69 (80)
T cd05885          41 VSNTIRFPVDRKDD-GAILSCEASHPALVS   69 (80)
T ss_pred             EEEEEEEEeeeccC-CcEEEEEEEChhhCC
Confidence            37889986666555 599999999997654


No 157
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs). Ig2_Tyro3_like: the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3 and Mer are widely expressed in adult tissues, though they show higher expression in the brain, in the lymphatic and vascular systems, and in the testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and c
Probab=89.85  E-value=0.32  Score=28.56  Aligned_cols=24  Identities=17%  Similarity=0.230  Sum_probs=19.3

Q ss_pred             cccEEEeecCCCCCCcceeEEeecccc
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      .+.|.|.++.  | .+.|.|.+.|.+=
T Consensus        48 ~s~L~i~~~~--d-~g~Y~C~A~N~~G   71 (81)
T cd05749          48 PSVLNVPGLN--E-TSKFSCEAHNAKG   71 (81)
T ss_pred             CCEEEEcccc--C-CeEEEEEEEeccC
Confidence            4679999985  4 3799999999854


No 158
>KOG4222|consensus
Probab=86.22  E-value=0.52  Score=40.58  Aligned_cols=35  Identities=26%  Similarity=0.370  Sum_probs=30.4

Q ss_pred             CccCCeEEEeecccEEEeecCCCCCCcceeEEeecc
Q psy10521          5 DFVGGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNK   40 (66)
Q Consensus         5 ~~~~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~   40 (66)
                      -...+|..+-+.|.|.|.||+.+|. +-|-|++.+-
T Consensus       364 ~~~~~r~svs~~g~L~it~v~~~d~-g~Yvcq~~~~  398 (1281)
T KOG4222|consen  364 PSSNGRGSVSPTGTLTITNVRQSDE-GYYVCQTQTS  398 (1281)
T ss_pred             CCcCccceecCCCCccccccccccc-ceEeeccccc
Confidence            3457899999999999999999995 9999997643


No 159
>PHA02987 Ig domain OX-2-like protein; Provisional
Probab=86.05  E-value=1.4  Score=30.81  Aligned_cols=34  Identities=18%  Similarity=0.295  Sum_probs=27.7

Q ss_pred             CeEEEe----ecccEEEeecCCCCCCcceeEEeeccccC
Q psy10521          9 GKYVVL----SSGDLYVFNATPNDGYKSYRCRTVNKITG   43 (66)
Q Consensus         9 ~ry~il----psGeL~I~nv~~~D~~~~Y~C~~~~~lTg   43 (66)
                      +|..++    -+-.|.|.||+.+|+ |-|+|.+.-.-.|
T Consensus        73 ~Rve~mS~s~~~StItIknVt~sDe-GcY~C~F~tfp~G  110 (189)
T PHA02987         73 NKIEYLSKSFNESTILIKNVSLKDN-GCYTCIFNTLLSK  110 (189)
T ss_pred             CeEEEeccCCCcceEEEEeCChhhC-eEEEEEEEecCCC
Confidence            466642    267899999999996 9999999887777


No 160
>PF07654 C1-set:  Immunoglobulin C1-set domain;  InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents C1-set domains, which are classical Ig-like domains resembling the antibody constant domain. C1-set domains are found almost exclusively in molecules involved in the immune system, such as in immunoglobulin light and heavy chains, in the major histocompatibility complex (MHC) class I and II complex molecules [, ], and in various T-cell receptors.; PDB: 3BVN_D 3BXN_A 3PWV_E 3L9R_F 2XFX_B 1BMG_A 1K8I_A 3M1B_G 3M17_C 1EXU_A ....
Probab=85.83  E-value=1.6  Score=24.93  Aligned_cols=32  Identities=34%  Similarity=0.385  Sum_probs=21.6

Q ss_pred             ccCCeEEEeecccEEEeecCCCCCCcceeEEeeccccC
Q psy10521          6 FVGGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKITG   43 (66)
Q Consensus         6 ~~~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lTg   43 (66)
                      +.+|.|.+...  |.|.   +++ ...|.|++.|.-..
T Consensus        48 ~~dgty~~~s~--l~v~---~~~-~~~ysC~V~H~~l~   79 (83)
T PF07654_consen   48 NSDGTYSVTSS--LTVT---WNS-GDEYSCRVTHESLP   79 (83)
T ss_dssp             ETTSEEEEEEE--EEEE---TTT-TGGEEEEEEETTSS
T ss_pred             ccccceeeeEE--EEec---CCC-CCEEEEEEEECCCC
Confidence            45778887544  4444   544 36999999997543


No 161
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively). Ig2_Necl-1-4_like: domain similar to the second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), Necl-3 (CADM2) and Necl-4 (CADM4). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cel
Probab=85.51  E-value=1.2  Score=25.58  Aligned_cols=24  Identities=17%  Similarity=0.162  Sum_probs=16.5

Q ss_pred             EEEeecCCCCCCcceeEEeeccccC
Q psy10521         19 LYVFNATPNDGYKSYRCRTVNKITG   43 (66)
Q Consensus        19 L~I~nv~~~D~~~~Y~C~~~~~lTg   43 (66)
                      |.| ....+|....|+|++.|+--.
T Consensus        47 l~~-~~~~~d~g~~~~C~v~h~~l~   70 (82)
T cd05761          47 LRF-QVDREDDGAPIICRVDHPALK   70 (82)
T ss_pred             EEE-EcchhhCCCEEEEEEeChhcC
Confidence            444 445555558999999998554


No 162
>KOG4194|consensus
Probab=84.90  E-value=0.75  Score=37.99  Aligned_cols=40  Identities=23%  Similarity=0.301  Sum_probs=30.3

Q ss_pred             ecccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEEec
Q psy10521         15 SSGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSITG   58 (66)
Q Consensus        15 psGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v~e   58 (66)
                      -.+.|+..||..+|+ +.|.|.+.|++-..  -|. -+||.|..
T Consensus       572 ~~~~L~L~nVt~td~-grYQCVvtN~FGSt--ysq-k~KltV~~  611 (873)
T KOG4194|consen  572 YTAILHLDNVTFTDE-GRYQCVVTNHFGST--YSQ-KAKLTVNQ  611 (873)
T ss_pred             hhheeeeeeeecccC-ceEEEEEecccCcc--hhh-eeEEEeec
Confidence            378999999999996 99999999986432  122 45676654


No 163
>smart00407 IGc1 Immunoglobulin C-Type.
Probab=82.41  E-value=2.8  Score=23.69  Aligned_cols=22  Identities=23%  Similarity=0.288  Sum_probs=13.8

Q ss_pred             EEEeecCCCCCCcceeEEeeccc
Q psy10521         19 LYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus        19 L~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      |.|.-..+.+ ...|.|++.|.-
T Consensus        50 L~v~~~~~~~-~~~~tC~V~H~~   71 (75)
T smart00407       50 LTVSASTWES-GDTYTCQVTHEG   71 (75)
T ss_pred             EEEccccCCC-CCEEEEEEEEcC
Confidence            3333334444 489999999873


No 164
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). Ig4_SCFR: The fourth Immunoglobulin (Ig)-like domain in stem cell factor receptor (SCFR). SCFR is organized as an extracellular component having five IG-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR. This fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth domain abolishes the ligand-induced dimerization of SCFR and completely inhibits signal transduction.
Probab=80.54  E-value=1.7  Score=27.34  Aligned_cols=26  Identities=15%  Similarity=0.220  Sum_probs=22.6

Q ss_pred             ccEEEeecCCCCCCcceeEEeeccccC
Q psy10521         17 GDLYVFNATPNDGYKSYRCRTVNKITG   43 (66)
Q Consensus        17 GeL~I~nv~~~D~~~~Y~C~~~~~lTg   43 (66)
                      .+|.+..+..+|+ |.|.|++.|..-.
T Consensus        65 S~L~L~Rlk~~E~-G~YTf~a~N~~~~   90 (101)
T cd05860          65 SELHLTRLKGTEG-GTYTFLVSNSDAS   90 (101)
T ss_pred             EEEEEeecChhhC-cEEEEEEECCCCe
Confidence            5799999999996 9999999998643


No 165
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig2_Necl-1: second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue and is important to the formation of synapses, axon bundles, and myel
Probab=78.14  E-value=5.5  Score=23.13  Aligned_cols=21  Identities=14%  Similarity=0.175  Sum_probs=15.7

Q ss_pred             cCCCCCCcceeEEeeccccCc
Q psy10521         24 ATPNDGYKSYRCRTVNKITGE   44 (66)
Q Consensus        24 v~~~D~~~~Y~C~~~~~lTge   44 (66)
                      +..+|....|.|++.|+--.+
T Consensus        52 ~~~~d~g~~~tC~v~h~~l~~   72 (83)
T cd07705          52 VTREDDGAEITCSVGHESLHD   72 (83)
T ss_pred             ecchhCCCEEEEEEECcccCC
Confidence            555665699999999986444


No 166
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig2_Necl-2: second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Nectin-like molecules (Necls) have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is expressed in a wide variety of tissues, and is a putative tumour suppressor gene, which is downregulated in aggressive neuroblastoma. Ig domains are likely to participate in ligand binding and recognition.
Probab=77.20  E-value=2.5  Score=25.44  Aligned_cols=24  Identities=17%  Similarity=0.174  Sum_probs=19.4

Q ss_pred             cEEEeecCCCCCCcceeEEeecccc
Q psy10521         18 DLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus        18 eL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      .|.+ .+..||....|+|++.|+.=
T Consensus        45 ~L~~-~p~~eDdG~~~~C~a~~~~l   68 (82)
T cd05883          45 QLML-KVTKEDDGVPVICLVDHPAV   68 (82)
T ss_pred             EEEE-ECchhhCCCEEEEEEcCccc
Confidence            3444 78889888999999999864


No 167
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig2_Necl-3: second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-3 has been shown to accumulate in tissues of the central and peripheral nervous system, where it is expressed in ependymal cells and myelinated axons.  It is observed at the interface between the axon shaft and the myelin sheath. Ig domains are likely to participate in ligand binding and recognition.
Probab=74.94  E-value=6.5  Score=22.99  Aligned_cols=25  Identities=16%  Similarity=0.113  Sum_probs=16.4

Q ss_pred             EEEeecCCCCCCcceeEEeeccccCc
Q psy10521         19 LYVFNATPNDGYKSYRCRTVNKITGE   44 (66)
Q Consensus        19 L~I~nv~~~D~~~~Y~C~~~~~lTge   44 (66)
                      |.|. .+.+|....|+|++.|+--..
T Consensus        48 L~~~-~~~~d~g~~ytC~v~h~~l~~   72 (83)
T cd05884          48 LDFR-VDRSDDGVAIICRVDHESLNA   72 (83)
T ss_pred             EEEE-cccccCCCEEEEEEechhcCC
Confidence            4443 344455689999999985543


No 168
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain. IgC_Tapasin_R: Immunoglobulin-like domain on Tapasin-R. Tapasin is a V-C1 (variable-constant) immunoglobulin superfamily molecule present in the endoplasmic reticulum (ER), where it links MHC class I molecules to the transporter associated with antigen processing (TAP). Tapasin-R is a tapasin-related protein that contains similar structural motifs to Tapasin, with some marked differences, especially in the V domain, transmembrane and cytoplasmic regions. The majority of Tapasin-R is located within the ER; however, there may be some expression of Tapasin-R at the cell surface. Tapasin-R lacks an obvious ER retention signal.
Probab=74.82  E-value=5.4  Score=24.75  Aligned_cols=22  Identities=23%  Similarity=0.350  Sum_probs=14.5

Q ss_pred             EEEeecCCCCCCcceeEEeeccc
Q psy10521         19 LYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus        19 L~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      |-|. .+.+|....|.|++.|+-
T Consensus       110 L~v~-~~~~~~g~~ytC~V~H~~  131 (139)
T cd05771         110 LTLE-PGTEDAGATYTCRVSHVS  131 (139)
T ss_pred             EEec-CCccCCCCEEEEEEEcCC
Confidence            4443 344454579999999963


No 169
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH2: The second immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=73.13  E-value=3.6  Score=25.51  Aligned_cols=34  Identities=21%  Similarity=0.131  Sum_probs=21.0

Q ss_pred             CccCCeEEEeecccEEEeecCCCCCCcceeEEeeccc
Q psy10521          5 DFVGGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus         5 ~~~~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      .+.+|.|.+  +..|-|.-=+|+- ...|.|++.|+-
T Consensus        56 ~~~dgTys~--~S~L~v~~~~W~~-g~~ytC~V~H~~   89 (99)
T cd04986          56 SDQCGCYSV--SSVLPGCAEEWNK-GEPFACTVTHPE   89 (99)
T ss_pred             cCCCCCEEE--EEEEEeCHHHhcC-CCeEEEEEECCC
Confidence            345677777  3445444334443 367999999974


No 170
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH3: The third immunoglobulin constant domain (IgC) of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=71.93  E-value=4.4  Score=24.49  Aligned_cols=10  Identities=10%  Similarity=0.780  Sum_probs=9.1

Q ss_pred             cceeEEeecc
Q psy10521         31 KSYRCRTVNK   40 (66)
Q Consensus        31 ~~Y~C~~~~~   40 (66)
                      ..|.|.+.|.
T Consensus        76 ~~ysC~V~H~   85 (96)
T cd07696          76 DTFQCKVTHP   85 (96)
T ss_pred             CcEEEEEECC
Confidence            6899999997


No 171
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE). IgC_CH2_IgE: The second constant domain of the heavy chain of immunoglobulin E (IgE). The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma, and mu, all consisting of a variable domain (VH) and three (in alpha, delta, and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). The different classes of antibodies vary in their heavy chains; the IgE class has the epsilon type. This domain (Cepsilon2) of IgE is in place of the flexible hinge region found in IgG.
Probab=71.49  E-value=4.7  Score=24.27  Aligned_cols=12  Identities=25%  Similarity=0.575  Sum_probs=9.9

Q ss_pred             CcceeEEeeccc
Q psy10521         30 YKSYRCRTVNKI   41 (66)
Q Consensus        30 ~~~Y~C~~~~~l   41 (66)
                      ...|.|++.|.-
T Consensus        75 ~~~ytC~V~H~~   86 (94)
T cd05847          75 GKTYTCKVTHQG   86 (94)
T ss_pred             CCeEEEEEEECC
Confidence            379999999973


No 172
>cd07699 IgC_L Immunoglobulin Constant domain. IgC_L: Immunoglobulin (Ig) light chain constant (C) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=68.89  E-value=5.2  Score=24.09  Aligned_cols=31  Identities=23%  Similarity=0.316  Sum_probs=17.8

Q ss_pred             CCeEEEeecccEEEeecCCCCCCcceeEEeeccc
Q psy10521          8 GGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus         8 ~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      +|-|.+  ...|-|.--.|.+ ...|.|++.|+-
T Consensus        59 dgty~~--~s~L~v~~~~w~~-~~~~sC~V~H~~   89 (100)
T cd07699          59 DNTYSL--SSYLTLTKSDWNK-HKVYTCEVTHEG   89 (100)
T ss_pred             CCCEEE--EEEEEEcHHHhCC-CCeEEEEEEecC
Confidence            444544  2334343333333 479999999974


No 173
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_I_alpha3;  Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class I alpha chain. Class I MHC proteins bind antigenic peptide fragments and present them to CD8+ T lymphocytes.  Class I molecules consist of a transmembrane alpha chain and a small chain called the beta2 microglobulin. The alpha chain contains three extracellular domains, two of which fold together to form the peptide-binding cleft (alpha1 and alpha2), and one which has an Ig fold (alpha3).  Peptide binding to class I molecules occurs in the endoplasmic reticulum (ER) and involves both chaperones and dedicated factors to assist in peptide loading.  Class I MHC molecules are expressed on most nucleated cells.
Probab=64.85  E-value=7.5  Score=22.75  Aligned_cols=19  Identities=26%  Similarity=0.585  Sum_probs=13.9

Q ss_pred             eecCCCCCCcceeEEeeccc
Q psy10521         22 FNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus        22 ~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      ..|..+|+ ..|.|++.|.-
T Consensus        65 l~v~~~~~-~~ytC~V~H~~   83 (93)
T cd07698          65 LEVPPEDK-ARYSCRVEHSG   83 (93)
T ss_pred             EEECCCCC-CEEEEEEEeCC
Confidence            44555564 89999999973


No 174
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin. IgC_beta2m: Immunoglobulin-like domain in beta2-Microglobulin (beta2m). Beta2m is the non-covalently bound light chain of the human class I major histocompatibility complex (MHC-I). Beta2m is structured as a beta-sandwich domain composed of two facing beta-sheets (four stranded and three stranded), that is typical of the C-type immunoglobulin superfamily. This structure is stabilized by an intramolecular disulfide bridge connecting two Cys residues in the facing beta -sheets. In vivo, MHC-I continuously exposes beta2m on the cell surface, where it may be released to plasmatic fluids, transported to the kidneys, degraded and then excreted.
Probab=64.15  E-value=17  Score=21.92  Aligned_cols=16  Identities=31%  Similarity=0.603  Sum_probs=11.8

Q ss_pred             cCCCCCCcceeEEeecc
Q psy10521         24 ATPNDGYKSYRCRTVNK   40 (66)
Q Consensus        24 v~~~D~~~~Y~C~~~~~   40 (66)
                      +.+++ ...|.|++.|.
T Consensus        67 ~~~~~-~~~ysC~V~H~   82 (93)
T cd05770          67 FTPTK-GDEYACRVRHN   82 (93)
T ss_pred             ECCCC-CCeEEEEEEEC
Confidence            34555 37899999996


No 175
>PF08205 C2-set_2:  CD80-like C2-set immunoglobulin domain ;  InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the C2-set type domains found in the T-cell antigen CD80, as well as in related proteins. CD80 (B7-1) is a glycoprotein expressed on antigen-presenting cells []. The shared ligands on CD80 and CD86 (B7-2) deliver the co-stimulatory signal through CD28 and CTLA-4 on T-cells, where CD28 augments the T-cell response and CTLA-4 attenuates it [].; PDB: 3S58_A 3O3U_N 3CJJ_A 3S59_A 2PF6_B 2PET_A 3ALP_A 3SKU_D 3U83_A 3U82_B ....
Probab=62.24  E-value=9.8  Score=21.52  Aligned_cols=23  Identities=22%  Similarity=0.371  Sum_probs=18.1

Q ss_pred             eecCCCCCCcceeEEeeccccCc
Q psy10521         22 FNATPNDGYKSYRCRTVNKITGE   44 (66)
Q Consensus        22 ~nv~~~D~~~~Y~C~~~~~lTge   44 (66)
                      ..++++|....++|++.|+...+
T Consensus        65 ~~~~~~~~~~~~~C~~~~~~~~~   87 (89)
T PF08205_consen   65 LTPTREDHGKTLTCRASHPALSQ   87 (89)
T ss_dssp             EETTGGGTTEEEEEEEEETTCCE
T ss_pred             EEcChHHCCeEEEEEEECCccCC
Confidence            35677777899999999987654


No 176
>PHA03282 envelope glycoprotein E; Provisional
Probab=58.23  E-value=31  Score=27.67  Aligned_cols=41  Identities=15%  Similarity=0.097  Sum_probs=29.3

Q ss_pred             ccCccCCeEEEeecccEEEeecCCCCCCcceeEEeeccccCcE
Q psy10521          3 SDDFVGGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKITGES   45 (66)
Q Consensus         3 ps~~~~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~   45 (66)
                      |...+..|..+ -+|.|.|++++.+|. |.|.-.+.+.-+.+.
T Consensus       111 ~e~~~~~rvs~-~n~tl~l~~a~~~Ds-G~Y~L~~~~~~~~~~  151 (540)
T PHA03282        111 PEFAWPPRVAV-VNGTLVLREARETDS-GMYVLSVSRAPNSTA  151 (540)
T ss_pred             cccccCcceeE-ecceEEEeeccccCC-ceEEEEecCCCCchh
Confidence            44555444444 599999999999996 999988655544444


No 177
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4). IgV_CTLA-4: domain similar to the variable(v)-type immunoglobulin (Ig) domain found in cytotoxic T lymphocyte-associated antigen 4 (CTLA-4).  CTLA-4 is involved in the regulation of T cell response, acting as an inhibitor of intracellular signalling.  CTLA-4 is similar to CD28, a T cell co-receptor protein that recognizes the B7 proteins (CD80 and CD86). CD28 binding of the B7 proteins occurs after the presentation of antigen to the T cell receptor (TCR) via the peptide-MHC complex on the surface of an antigen presenting cell (APC).  CTLA-4 also binds the B7 molecules with a higher affinity than does CD28.  The B7/CTLA-4 interaction generates inhibitory signals down-regulating the response, and may prevent T cell activation by weak TCR signals. CD28 and CTLA-4 then elicit opposing signals in the regulation of T cell responsiveness and homeostasis. T cell activation leads to increased 
Probab=57.34  E-value=6.3  Score=25.41  Aligned_cols=20  Identities=20%  Similarity=0.358  Sum_probs=17.4

Q ss_pred             ccEEEeecCCCCCCcceeEEe
Q psy10521         17 GDLYVFNATPNDGYKSYRCRT   37 (66)
Q Consensus        17 GeL~I~nv~~~D~~~~Y~C~~   37 (66)
                      =.|.|.|++.||. ..|.|..
T Consensus        74 v~L~l~~L~a~DT-a~Y~Ca~   93 (115)
T cd05721          74 VNFTLQNLRANQT-DIYFCKI   93 (115)
T ss_pred             EEEEEcCCCHHHC-eEEEEEe
Confidence            4699999999996 9999964


No 178
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain. IgC_MHC_II_beta: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II beta chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosome be
Probab=55.42  E-value=23  Score=21.04  Aligned_cols=17  Identities=24%  Similarity=0.471  Sum_probs=11.8

Q ss_pred             cCCCCCCcceeEEeeccc
Q psy10521         24 ATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus        24 v~~~D~~~~Y~C~~~~~l   41 (66)
                      +..++ ...|.|++.|.-
T Consensus        67 ~~~~~-~~~ysC~V~H~~   83 (94)
T cd05766          67 TTPSR-GDTYTCVVEHSS   83 (94)
T ss_pred             EcCCC-CCEEEEEEEeCC
Confidence            33444 368999999973


No 179
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain. IgC_TCR_beta: Constant domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the beta chain. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The antigen binding site is formed by the variable domains of the alpha and beta chains, located at the N-terminus of each chain. Alpha/beta TCRs recognize antigens differently from gamma/delta TCRs.
Probab=54.92  E-value=14  Score=23.28  Aligned_cols=34  Identities=15%  Similarity=0.120  Sum_probs=19.4

Q ss_pred             CeEEEeecccEEEeecCCCCCCcceeEEeeccccCc
Q psy10521          9 GKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKITGE   44 (66)
Q Consensus         9 ~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge   44 (66)
                      |-|.+  +--|-|.-.+|.|....|.|++.|.--.+
T Consensus        62 gTYs~--~S~L~v~~~~w~~~~~~ytC~V~H~g~~~   95 (115)
T cd05769          62 STYSI--SSRLRVSATEWFNPRNTFTCIVQFYGGTD   95 (115)
T ss_pred             CeEEE--EEEEEEChHHhccCCCeEEEEEEEeCCcc
Confidence            44554  22344444344343479999999984433


No 180
>PF05083 LST1:  LST-1 protein;  InterPro: IPR007775 B144/LST1 is a gene encoded in the human major histocompatibility complex that produces multiple forms of alternatively spliced mRNA and encodes peptides fewer than 100 amino acids in length. B144/LST1 is strongly expressed in dendritic cells. Transfection of B144/LST1 into a variety of cells induces morphologic changes including the production of long, thin filopodia []. A possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation [, ]. ; GO: 0000902 cell morphogenesis, 0006955 immune response, 0016020 membrane
Probab=51.00  E-value=16  Score=22.09  Aligned_cols=17  Identities=35%  Similarity=0.475  Sum_probs=14.7

Q ss_pred             CCCCCcceeEEeecccc
Q psy10521         26 PNDGYKSYRCRTVNKIT   42 (66)
Q Consensus        26 ~~D~~~~Y~C~~~~~lT   42 (66)
                      .||-...|-|+++|+=|
T Consensus        58 kED~stDYAcIa~~kpt   74 (74)
T PF05083_consen   58 KEDPSTDYACIAKNKPT   74 (74)
T ss_pred             ccCCCcCeeeeeccCCC
Confidence            88988899999999754


No 181
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH1: The first immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fab antigen-binding fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=50.67  E-value=20  Score=21.57  Aligned_cols=31  Identities=29%  Similarity=0.437  Sum_probs=17.2

Q ss_pred             CCeEEEeecccEEEeecCCCCCCcceeEEeeccc
Q psy10521          8 GGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus         8 ~~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      +|.|.+..  -|-|.--+|. ....|.|++.|.-
T Consensus        57 dgty~~~s--~L~v~~~~w~-~~~~ytC~V~H~~   87 (95)
T cd04985          57 GGLYTASS--QLTVPASEWK-GKESFYCKVEHPS   87 (95)
T ss_pred             CCCEEEEE--EEEEeHHHcC-CCCcEEEEEEeCC
Confidence            56666532  2223332332 2368999999973


No 182
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171. This model describes a paralogous family of the rumen bacterium Fibrobacter succinogenes. Eleven members are found in Fibrobacter succinogenes S85, averaging over 900 amino acids in length. More than half are predicted lipoproteins. The function is unknown.
Probab=50.05  E-value=54  Score=27.97  Aligned_cols=55  Identities=16%  Similarity=0.109  Sum_probs=42.8

Q ss_pred             CCccCccCCeEEEe---ecc-----cEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEE
Q psy10521          1 MTSDDFVGGKYVVL---SSG-----DLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSI   56 (66)
Q Consensus         1 ~~ps~~~~~ry~il---psG-----eL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v   56 (66)
                      |-|.+..+||++..   ..|     +|||+|+..+.. +..+-.+.+.-.=.+++...+..+||
T Consensus       353 ~sP~~SPDG~~vAY~ts~e~~~g~s~vYv~~L~t~~~-~~vkl~ve~aaiprwrv~e~gdt~iv  415 (912)
T TIGR02171       353 YHPDISPDGKKVAFCTGIEGLPGKSSVYVRNLNASGS-GLVKLPVENAAIPRWRVLENGDTVIV  415 (912)
T ss_pred             ecCcCCCCCCEEEEEEeecCCCCCceEEEEehhccCC-CceEeecccccccceEecCCCCeEEE
Confidence            45888999999987   334     699999999985 88998888888878887664555544


No 183
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_II_alpha: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II alpha chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosom
Probab=46.06  E-value=45  Score=20.02  Aligned_cols=11  Identities=18%  Similarity=0.220  Sum_probs=9.4

Q ss_pred             CcceeEEeecc
Q psy10521         30 YKSYRCRTVNK   40 (66)
Q Consensus        30 ~~~Y~C~~~~~   40 (66)
                      ...|.|++.|.
T Consensus        73 ~~~ytC~V~H~   83 (94)
T cd05767          73 GDIYSCIVEHW   83 (94)
T ss_pred             CCeEEEEEEeC
Confidence            36999999997


No 184
>KOG2278|consensus
Probab=45.81  E-value=20  Score=25.41  Aligned_cols=21  Identities=10%  Similarity=0.142  Sum_probs=16.2

Q ss_pred             ccCCeEEE-eecccEEEeecCC
Q psy10521          6 FVGGKYVV-LSSGDLYVFNATP   26 (66)
Q Consensus         6 ~~~~ry~i-lpsGeL~I~nv~~   26 (66)
                      |...||.+ ++.|+|+||..|-
T Consensus        63 ndKqRF~l~d~~~el~IrAnQG   84 (207)
T KOG2278|consen   63 NDKQRFSLIDEAGELLIRANQG   84 (207)
T ss_pred             cccceEEeecCCCcEEEEecCC
Confidence            44578888 5899999997653


No 185
>cd01255 PH_TIAM TIAM Pleckstrin homology (PH) domain. TIAM Pleckstrin homology (PH) domain. TIAM (T-cell invasion and metastasis) is a guanine nucleotide exchange factor specific for RAC1. It consists of an N-terminal PH domain followed by  Raf-like ras binding domain(RDB), a PDZ domain, a RhoGEF (DH) domain and a PH domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. This subfamily contains the alignment of the PH domain that follows the DH domain.
Probab=45.39  E-value=38  Score=23.25  Aligned_cols=33  Identities=9%  Similarity=0.156  Sum_probs=28.6

Q ss_pred             eEE-EeecccEEEeecCCCCCCcceeEEeecccc
Q psy10521         10 KYV-VLSSGDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus        10 ry~-ilpsGeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      ||- |.|.-+|+||.-...|..+.|-|...|.-+
T Consensus        90 rfr~miP~~alQVR~~n~ad~e~~~vwEliH~kS  123 (160)
T cd01255          90 RFRVLIPVTALQVRASSAADMESNFLWELIHLKS  123 (160)
T ss_pred             eEEEeeceeeeeeecCCCcCcccceEEEEEeecc
Confidence            565 679999999999999999999999988643


No 186
>PF07202 Tcp10_C:  T-complex protein 10 C-terminus;  InterPro: IPR009852 Proteins in this entry include T-complex 10, involved in spermatogenesis in mice, and centromere protein J, which not only inhibits microtubule nucleation from the centrosome, but also depolymerises taxol-stabilised microtubules [, ]. These proteins share an approximately 180 residue C-terminal region which contains unsual G repreats [].
Probab=43.91  E-value=85  Score=21.48  Aligned_cols=53  Identities=13%  Similarity=0.087  Sum_probs=32.2

Q ss_pred             CCeEEEeecccEEEeecCCCCC---CcceeEEeeccccCcEEecccceeEEEecccccc
Q psy10521          8 GGKYVVLSSGDLYVFNATPNDG---YKSYRCRTVNKITGESQASVFQTRLSITGFRAVY   63 (66)
Q Consensus         8 ~~ry~ilpsGeL~I~nv~~~D~---~~~Y~C~~~~~lTge~~~S~~~~~l~v~ep~~~~   63 (66)
                      +.|.+.+|+|.-.|+-.+..-.   -++.+|.-.+ =..|++-  ..|||.+++..|.+
T Consensus       119 G~k~i~~pnGq~ei~t~~~krreyPDGTvk~vy~d-G~qet~y--~~gr~r~kd~~g~~  174 (179)
T PF07202_consen  119 GDKTITFPNGQKEIHTADFKRREYPDGTVKTVYPD-GRQETRY--ASGRVRIKDKDGNV  174 (179)
T ss_pred             CcEEEEeCCCcEEEEccccEEEEcCCCCEEEEecC-CCEEEEe--CCCcEEEecCCCCE
Confidence            5677778888877765433210   1466666665 2334443  36799998877754


No 187
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins. Ig2_Nectin-2_like: domain similar to the second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112). Nectin-2 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion.  Nectin-2 and nectin-3 localize at Sertoli-spermatid junctions where they form heterophilic trans-interactions between the cells that are essential for the formation and maintenance of the junctions and for spermatid development.
Probab=42.15  E-value=17  Score=22.08  Aligned_cols=19  Identities=21%  Similarity=0.377  Sum_probs=15.4

Q ss_pred             ecCCCCCCcceeEEeeccc
Q psy10521         23 NATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus        23 nv~~~D~~~~Y~C~~~~~l   41 (66)
                      -...+|..+.|.|++.|+-
T Consensus        64 ~P~~~d~Gk~ltC~v~h~a   82 (95)
T cd07703          64 VPTPEANGKEVTCKVEHET   82 (95)
T ss_pred             ecCHHHCCCEEEEEEeCcc
Confidence            4567777799999999984


No 188
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of  intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ ICAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. ICAM-1 may be involved in organ targeted tumor metastasis. The interaction of ICAM-1 with leukocyte function-associated antigen-1 (LFA-1) plays a part in leukocyte-endothelial cell recognition. This group also contains ICAM-2, which also interacts with LFA-1. Transmigration of immature dendritic cells across resting endothelium is dependent on the interaction of ICAM-2 with, yet unidentified, ligand(s) on the dendritic cells. ICAM-1 has five Ig-like domains and ICAM-2 has two. ICAM-1 may also act as host receptor for viruses and parasites.
Probab=41.83  E-value=18  Score=22.35  Aligned_cols=19  Identities=16%  Similarity=0.307  Sum_probs=15.7

Q ss_pred             cCCCCCCcceeEEeecccc
Q psy10521         24 ATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus        24 v~~~D~~~~Y~C~~~~~lT   42 (66)
                      +..+|....|+|++.+.+-
T Consensus        68 ~~r~D~g~~~sC~A~l~l~   86 (100)
T cd05755          68 VDREDHGANFSCETELDLR   86 (100)
T ss_pred             cchhhCCcEEEEEEEeccC
Confidence            6778878899999997753


No 189
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain. IgC_TCR_gamma;  immunoglobulin (Ig) constant (C) domain of the gamma chain of gamma-delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha-beta TCRs but a small subset contain gamma-delta TCRs. Alpha-beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma-delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma-delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds.
Probab=40.55  E-value=24  Score=21.43  Aligned_cols=18  Identities=22%  Similarity=0.331  Sum_probs=11.8

Q ss_pred             ecCCCCCCcceeEEeecc
Q psy10521         23 NATPNDGYKSYRCRTVNK   40 (66)
Q Consensus        23 nv~~~D~~~~Y~C~~~~~   40 (66)
                      .+.+++....|.|++.|.
T Consensus        67 ~vt~~~~~~~ysC~V~H~   84 (96)
T cd07697          67 TVTKDSLGKKFRCIYKHE   84 (96)
T ss_pred             EECchhCCCeEEEEEEEC
Confidence            344443335699999995


No 190
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH4: The fourth immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=39.91  E-value=30  Score=20.92  Aligned_cols=11  Identities=9%  Similarity=0.274  Sum_probs=9.4

Q ss_pred             CcceeEEeecc
Q psy10521         30 YKSYRCRTVNK   40 (66)
Q Consensus        30 ~~~Y~C~~~~~   40 (66)
                      ...|.|++.|.
T Consensus        80 ~~~ytC~V~H~   90 (102)
T cd05768          80 GDVFTCVVGHE   90 (102)
T ss_pred             CCcEEEEeEeC
Confidence            36899999997


No 191
>PF04296 DUF448:  Protein of unknown function (DUF448);  InterPro: IPR007393 This entry represents a group of uncharacterised proteins. Some member sequences retain zinc-binding residues. The structure of the hypothetical cytosolic protein SP0554 from Streptococcus pneumoniae revealed an alpha+beta fold that could have evolved from a glucocorticoid receptor-like zinc finger domain [].; PDB: 1G2R_A.
Probab=39.66  E-value=32  Score=20.13  Aligned_cols=29  Identities=17%  Similarity=0.320  Sum_probs=17.0

Q ss_pred             eEEEeecccEEEeecCCCCCCcceeEEee
Q psy10521         10 KYVVLSSGDLYVFNATPNDGYKSYRCRTV   38 (66)
Q Consensus        10 ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~   38 (66)
                      |+...++|++.+---....+.|.|-|.-.
T Consensus        18 R~v~~~~~~i~~D~~~k~~GRGaYvc~~~   46 (78)
T PF04296_consen   18 RFVRTPDGEIVPDPSGKLPGRGAYVCPDP   46 (78)
T ss_dssp             EEEE-TTS-EEEETTS---SEEEEEES-H
T ss_pred             EEEEeCCCEEEECCCCCCCCCeEEEcCCH
Confidence            67788888866665555667789999764


No 192
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig2_PVR_like: domain similar to the second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), these result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus 
Probab=39.57  E-value=30  Score=20.81  Aligned_cols=22  Identities=14%  Similarity=0.134  Sum_probs=17.3

Q ss_pred             ecCCCCCCcceeEEeeccccCc
Q psy10521         23 NATPNDGYKSYRCRTVNKITGE   44 (66)
Q Consensus        23 nv~~~D~~~~Y~C~~~~~lTge   44 (66)
                      ...++|.-..|.|++.|+-..+
T Consensus        64 ~p~~~d~G~~~tC~v~h~~l~~   85 (95)
T cd05719          64 VPSREANGKELTCVVSHPTLQE   85 (95)
T ss_pred             ecCHHHCCCEEEEEEeCcccCC
Confidence            5567777799999999986544


No 193
>PF01436 NHL:  NHL repeat;  InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins. For example, the repeat is found in a variety of enzymes of the copper type II, ascorbate-dependent monooxygenase family which catalyse the C terminus alpha-amidation of biological peptides []. In many it occurs in tandem arrays, for example in the ringfinger beta-box, coiled-coil (RBCC) eukaryotic growth regulators []. The 'Brain Tumor' protein (Brat) is one such growth regulator that contains a 6-bladed NHL-repeat beta-propeller [, ].  The NHL repeats are also found in serine/threonine protein kinase (STPK) in diverse range of pathogenic bacteria. These STPK are transmembrane receptors with a intracellular N-terminal kinase domain and extracellular C-terminal sensor domain. In the STPK, PknD, from Mycobacterium tuberculosis, the sensor domain forms a rigid, six-bladed b-propeller composed of NHL repeats with a flexible tether to the transmembrane domain.; GO: 0005515 protein binding; PDB: 3FVZ_A 3FW0_A 1RWL_A 1RWI_A 1Q7F_A.
Probab=38.00  E-value=25  Score=16.56  Aligned_cols=11  Identities=45%  Similarity=0.751  Sum_probs=8.9

Q ss_pred             EeecccEEEee
Q psy10521         13 VLSSGDLYVFN   23 (66)
Q Consensus        13 ilpsGeL~I~n   23 (66)
                      +.++|+|+|.+
T Consensus         9 v~~~g~i~VaD   19 (28)
T PF01436_consen    9 VDSDGNIYVAD   19 (28)
T ss_dssp             EETTSEEEEEE
T ss_pred             EeCCCCEEEEE
Confidence            45889999988


No 194
>PRK12700 flgH flagellar basal body L-ring protein; Reviewed
Probab=37.53  E-value=21  Score=25.35  Aligned_cols=12  Identities=33%  Similarity=0.492  Sum_probs=10.6

Q ss_pred             EEeecccEEEee
Q psy10521         12 VVLSSGDLYVFN   23 (66)
Q Consensus        12 ~ilpsGeL~I~n   23 (66)
                      .++|+|+|.|+.
T Consensus       152 ~VlpNGNLvI~G  163 (230)
T PRK12700        152 GVLPNGNLQIAG  163 (230)
T ss_pred             EECCCCCEEEEE
Confidence            478999999987


No 195
>PRK12407 flgH flagellar basal body L-ring protein; Reviewed
Probab=37.39  E-value=21  Score=25.20  Aligned_cols=12  Identities=33%  Similarity=0.393  Sum_probs=10.5

Q ss_pred             EEeecccEEEee
Q psy10521         12 VVLSSGDLYVFN   23 (66)
Q Consensus        12 ~ilpsGeL~I~n   23 (66)
                      .++|+|+|.|+.
T Consensus       142 ~VlpNGnL~I~G  153 (221)
T PRK12407        142 QVLPNGVLVIRG  153 (221)
T ss_pred             EECCCCCEEEEE
Confidence            468999999987


No 196
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain. IgC_SIRP: Immunoglobulin-like domain of signal-regulatory proteins (SIRP); the signal-regulatory proteins (SIRP) are Ig-like cell surface receptors detected in hematopoietic and non-hematopoietic cells. While their extracellular domains are similar, SIRP are classified as alpha or beta based on the length of the intracytoplasmic domain.  Those having a 110- to 113-amino acid tail are classified as SIRP-alpha, and those having a 5-amino acid tail as SIRP-beta. SIRP-alpha and SIRP-beta molecules are thought to have complementary roles in signal regulation:  SIRP-alpha inhibit signalling via their immunoreceptor tyrosine (IT)-based inhibition motifs while SIRP-beta are activating.  SIRP-beta lack the cytoplasmic domainof SIRP-alpha, and associate with at least one other transmembrane protein (DAP-12 or KARAP). The IT-based activation motifs within DAP-12's cytoplasmic domain may link SIRP-beta to the activating 
Probab=36.67  E-value=29  Score=21.48  Aligned_cols=18  Identities=17%  Similarity=0.278  Sum_probs=12.4

Q ss_pred             cCCCCCCcceeEEeeccc
Q psy10521         24 ATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus        24 v~~~D~~~~Y~C~~~~~l   41 (66)
                      .+.+|....|.|++.|.-
T Consensus        75 ~~~~d~~~~ytC~V~H~~   92 (111)
T cd05772          75 LTEDDVHSQVTCEVQHRT   92 (111)
T ss_pred             CccccccCceEEEEEeCC
Confidence            344444467999999973


No 197
>KOG3515|consensus
Probab=36.46  E-value=27  Score=28.97  Aligned_cols=34  Identities=29%  Similarity=0.278  Sum_probs=29.4

Q ss_pred             cCCeEEEeecccEE-EeecCCCCCCcceeEEeeccc
Q psy10521          7 VGGKYVVLSSGDLY-VFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus         7 ~~~ry~ilpsGeL~-I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      .++.+.+.++|-|. +.||+..|. +.|.|.+.|--
T Consensus       447 ~g~~~~v~~~~~~~s~~~v~~~d~-g~y~~tatns~  481 (741)
T KOG3515|consen  447 DGGVVRVGAGAGLGSGVNVSRSDG-GSYGLTATNSP  481 (741)
T ss_pred             cCceEEeeccccccccceeeeccC-CcceeeeccCC
Confidence            46788999999998 999999996 99999998653


No 198
>PRK12701 flgH flagellar basal body L-ring protein; Reviewed
Probab=35.85  E-value=24  Score=25.14  Aligned_cols=12  Identities=33%  Similarity=0.540  Sum_probs=10.6

Q ss_pred             EEeecccEEEee
Q psy10521         12 VVLSSGDLYVFN   23 (66)
Q Consensus        12 ~ilpsGeL~I~n   23 (66)
                      .+||+|+|+|+.
T Consensus       151 ~VlpNGnL~I~G  162 (230)
T PRK12701        151 KVLANGNMVVQG  162 (230)
T ss_pred             EECCCCCEEEEE
Confidence            478999999987


No 199
>TIGR02227 sigpep_I_bact signal peptidase I, bacterial type. A related model finds a simlar protein in many archaea and a few bacteria, as well as a microsomal (endoplasmic reticulum) protein in eukaryotes.
Probab=35.77  E-value=1.2e+02  Score=19.58  Aligned_cols=55  Identities=24%  Similarity=0.360  Sum_probs=33.8

Q ss_pred             CCccCccCCeEEEee---------cccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEEec
Q psy10521          1 MTSDDFVGGKYVVLS---------SGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSITG   58 (66)
Q Consensus         1 ~~ps~~~~~ry~ilp---------sGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v~e   58 (66)
                      |.|++..++..++..         .|++.+.....+.  +.+.|.-.-.+-|++..-. .++|.|+.
T Consensus        30 M~Ptl~~Gd~vlv~k~~~~~~~~~rGDiVvf~~~~~~--~~~~iKRVig~pGd~v~i~-~~~l~vNg   93 (163)
T TIGR02227        30 MEPTLKEGDRILVNKFAYGTSDPKRGDIVVFKDPDDN--KNIYVKRVIGLPGDKVEFR-DGKLYING   93 (163)
T ss_pred             cccchhCCCEEEEEEeEcCCCCCCCCcEEEEecCCCC--CceeEEEEEecCCCEEEEE-CCEEEECC
Confidence            778888777666643         4888888764332  3344444445567776654 55666653


No 200
>PF08662 eIF2A:  Eukaryotic translation initiation factor eIF2A;  InterPro: IPR013979  This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins. 
Probab=34.62  E-value=1.2e+02  Score=20.11  Aligned_cols=41  Identities=17%  Similarity=0.193  Sum_probs=25.4

Q ss_pred             CccCCeEEEee-----cccEEEeecCCCCCCcceeEEeeccccCcEEecc
Q psy10521          5 DFVGGKYVVLS-----SGDLYVFNATPNDGYKSYRCRTVNKITGESQASV   49 (66)
Q Consensus         5 ~~~~~ry~ilp-----sGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~   49 (66)
                      +.+.|+|+++.     +|+|.|-|++...    -.+...|..+....-|+
T Consensus       108 wsP~G~~l~~~g~~n~~G~l~~wd~~~~~----~i~~~~~~~~t~~~WsP  153 (194)
T PF08662_consen  108 WSPDGRFLVLAGFGNLNGDLEFWDVRKKK----KISTFEHSDATDVEWSP  153 (194)
T ss_pred             ECCCCCEEEEEEccCCCcEEEEEECCCCE----EeeccccCcEEEEEEcC
Confidence            35689999975     5789999988422    23333444444444465


No 201
>KOG3260|consensus
Probab=33.76  E-value=25  Score=25.10  Aligned_cols=23  Identities=35%  Similarity=0.332  Sum_probs=18.4

Q ss_pred             cccEEEeecCCCCCCcceeEEeecccc
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      |=+|+|+|++-    .+|+|++-|-+-
T Consensus       108 Sldl~v~dlqG----K~y~~~vnnLlk  130 (224)
T KOG3260|consen  108 SLDLKVHDLQG----KNYRMIVNNLLK  130 (224)
T ss_pred             ceeeeeeecCC----cceeeehhhhcc
Confidence            67899999987    679999876443


No 202
>COG2063 FlgH Flagellar basal body L-ring protein [Cell motility and secretion]
Probab=33.51  E-value=27  Score=25.14  Aligned_cols=12  Identities=33%  Similarity=0.515  Sum_probs=10.7

Q ss_pred             EEeecccEEEee
Q psy10521         12 VVLSSGDLYVFN   23 (66)
Q Consensus        12 ~ilpsGeL~I~n   23 (66)
                      .|||+|+|+|+.
T Consensus       155 ~VLpNGNL~I~G  166 (230)
T COG2063         155 QVLPNGNLVIEG  166 (230)
T ss_pred             EEcCCCCEEEEE
Confidence            478999999997


No 203
>PF11465 Receptor_2B4:  Natural killer cell receptor 2B4;  InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells. It plays a role in activating NK-mediated cytotoxicity through its interaction with CD48 on target cells in a subset of CD8 T cells []. The structure of 2B4 consists of an immunoglobulin variable domain fold and contains two beta-sheets. One of the beta-sheets, the six-stranded sheet, contains structural features that may have a role in ligand recognition and receptor function []. This entry represents the 2B4 immunoglobulin domain.; GO: 0005488 binding; PDB: 2PTU_D 2PTT_B 1Z2K_A.
Probab=33.39  E-value=55  Score=21.07  Aligned_cols=36  Identities=22%  Similarity=0.287  Sum_probs=26.3

Q ss_pred             CeEEEee-cccEEEeecCCCCCCcceeEEeeccccCcEE
Q psy10521          9 GKYVVLS-SGDLYVFNATPNDGYKSYRCRTVNKITGESQ   46 (66)
Q Consensus         9 ~ry~ilp-sGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~   46 (66)
                      .||...+ +..|.|..++.+|. |.|.-.+.+ -+|.+.
T Consensus        62 ~r~~F~~enlaLlIkaAq~qDS-G~Y~LEvT~-~sG~V~   98 (108)
T PF11465_consen   62 NRFNFTSENLALLIKAAQPQDS-GLYCLEVTN-ESGKVC   98 (108)
T ss_dssp             HHEEEETTTTEEEESS-SGGG--EEEEEEEEE-TTSCEE
T ss_pred             ceEeeeccCceEEEeecCcccC-ceEEEEEEc-CCCcEE
Confidence            4666654 89999999999996 888777766 566654


No 204
>PF09466 Yqai:  Hypothetical protein Yqai;  InterPro: IPR018474 The hypothetical protein YqaI is expressed in bacteria, particularly Bacillus subtilis. It forms a homo-dimer, with each monomer containing an alpha helix and four beta strands.; PDB: 2DSM_B.
Probab=33.15  E-value=43  Score=20.11  Aligned_cols=19  Identities=21%  Similarity=0.496  Sum_probs=13.7

Q ss_pred             CccCCeEEEeecccEEEee
Q psy10521          5 DFVGGKYVVLSSGDLYVFN   23 (66)
Q Consensus         5 ~~~~~ry~ilpsGeL~I~n   23 (66)
                      +.++..|++.|+|+...++
T Consensus        34 I~~~D~y~i~~~geIvL~e   52 (71)
T PF09466_consen   34 IFPGDDYFISPDGEIVLEE   52 (71)
T ss_dssp             B-TTS-EEE-ETTEEEECC
T ss_pred             cccCCeEEEeCCCcEEehh
Confidence            4568899999999998876


No 205
>PRK12697 flgH flagellar basal body L-ring protein; Reviewed
Probab=33.05  E-value=28  Score=24.80  Aligned_cols=12  Identities=42%  Similarity=0.534  Sum_probs=10.6

Q ss_pred             EEeecccEEEee
Q psy10521         12 VVLSSGDLYVFN   23 (66)
Q Consensus        12 ~ilpsGeL~I~n   23 (66)
                      .++|+|+|.|+.
T Consensus       148 ~VlpNGnL~I~G  159 (226)
T PRK12697        148 NVLPNGNLVVSG  159 (226)
T ss_pred             EECCCCCEEEEE
Confidence            468999999987


No 206
>cd00279 YlxR Ylxr homologs; group of conserved hypothetical bacterial proteins of unknown function; structure revealed putative RNA binding cleft; proteins are encoded by an operon that includes other proteins involved in transcription and/or translation
Probab=32.56  E-value=63  Score=19.18  Aligned_cols=29  Identities=17%  Similarity=0.289  Sum_probs=19.9

Q ss_pred             eEEEeecccEEEeecCCCCCCcceeEEee
Q psy10521         10 KYVVLSSGDLYVFNATPNDGYKSYRCRTV   38 (66)
Q Consensus        10 ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~   38 (66)
                      |+...|.|++.+---....+.|.|-|...
T Consensus        19 R~v~~~~g~i~~D~~~k~~GRGaYvc~~~   47 (79)
T cd00279          19 RFVAGPEGEVVPDPTGKLPGRGAYVCADR   47 (79)
T ss_pred             EEEEcCCCeEEECCCCCCCCCeEEEcCCH
Confidence            56677778766544444567889999764


No 207
>KOG4597|consensus
Probab=32.54  E-value=30  Score=27.89  Aligned_cols=31  Identities=26%  Similarity=0.275  Sum_probs=27.2

Q ss_pred             CeEEEeecccEEEeecCCCCCCcceeEEeecc
Q psy10521          9 GKYVVLSSGDLYVFNATPNDGYKSYRCRTVNK   40 (66)
Q Consensus         9 ~ry~ilpsGeL~I~nv~~~D~~~~Y~C~~~~~   40 (66)
                      +|-.+...+.|.|.|...+|+ +-|.|.+++-
T Consensus       249 e~p~vtstcql~ic~ewq~~a-~w~tCs~rcg  279 (560)
T KOG4597|consen  249 ENPVVTSTCQLVICNEWQADA-GWYTCSARCG  279 (560)
T ss_pred             CCcceeeeeeEEEcchhhcCC-Cceeeccccc
Confidence            566778899999999999996 8999999974


No 208
>PRK12788 flgH flagellar basal body L-ring protein; Reviewed
Probab=32.42  E-value=29  Score=24.84  Aligned_cols=12  Identities=33%  Similarity=0.537  Sum_probs=10.6

Q ss_pred             EEeecccEEEee
Q psy10521         12 VVLSSGDLYVFN   23 (66)
Q Consensus        12 ~ilpsGeL~I~n   23 (66)
                      .++|+|+|.|..
T Consensus       156 ~VLPNGNLvI~G  167 (234)
T PRK12788        156 DVLPNGNLLISG  167 (234)
T ss_pred             EEcCCCCEEEEE
Confidence            468999999987


No 209
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ VCAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. The interaction of VCAM-1 binding to the beta1 integrin very late antigen (VLA-4) expressed by lymphocytes and monocytes mediates the adhesion of leucocytes to blood vessel walls, and regulates migration across the endothelium. During metastasis, some circulating cancer cells extravasate to a secondary site by a similar process.  VCAM-1 may be involved in organ targeted tumor metastasis and may also act as host receptors for viruses and parasites.  VCAM-1 contains seven Ig domains.
Probab=32.35  E-value=54  Score=20.61  Aligned_cols=23  Identities=30%  Similarity=0.300  Sum_probs=16.6

Q ss_pred             EEeecCCCCCCcceeEEeecccc
Q psy10521         20 YVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus        20 ~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      .-..+..||..+.|.|+|.=.+-
T Consensus        65 vtftptreD~g~~fsC~A~L~l~   87 (99)
T cd07689          65 VTFTPTIEDIGKVLVCRAKLHID   87 (99)
T ss_pred             EEEecchhhCCcEEEEEEEEeec
Confidence            33445688988899999975443


No 210
>PHA02914 Immunoglobulin-like domain protein; Provisional
Probab=31.94  E-value=36  Score=27.01  Aligned_cols=18  Identities=11%  Similarity=0.169  Sum_probs=14.7

Q ss_pred             EEeecCCCCCCcceeEEee
Q psy10521         20 YVFNATPNDGYKSYRCRTV   38 (66)
Q Consensus        20 ~I~nv~~~D~~~~Y~C~~~   38 (66)
                      -+.|++..| .|.|||.+.
T Consensus        84 ~~~Nvs~sd-EGrYrCIFY  101 (500)
T PHA02914         84 IEENIGEHE-DGDFKCIFY  101 (500)
T ss_pred             EecCccccc-CCcEEEEEE
Confidence            456788888 599999997


No 211
>PRK00249 flgH flagellar basal body L-ring protein; Reviewed
Probab=31.83  E-value=30  Score=24.35  Aligned_cols=12  Identities=33%  Similarity=0.534  Sum_probs=10.4

Q ss_pred             EEeecccEEEee
Q psy10521         12 VVLSSGDLYVFN   23 (66)
Q Consensus        12 ~ilpsGeL~I~n   23 (66)
                      .++|+|+|.|+.
T Consensus       144 ~VlpNGnLvI~G  155 (222)
T PRK00249        144 QVLPNGNLVIRG  155 (222)
T ss_pred             EECCCCcEEEEE
Confidence            468999999987


No 212
>PF02107 FlgH:  Flagellar L-ring protein;  InterPro: IPR000527 The flgH, flgI and fliF genes of Salmonella typhimurium encode the major proteins for the L, P and M rings of the flagellar basal body []. In fact, the basal body consists of four rings (L,P,S and M) surrounding the flagellar rod, which is believed to transmit motor rotation to the filament []. The M ring is integral to the inner membrane of the cell, and may be connected to the rod via the S (supramembrane) ring, which lies just distal to it. The L and P rings reside in the outer membrane and periplasmic space, respectively. FlgH and FlgI, which are exported across the cell membrane to their destinations in the outer membrane and periplasmic space, have typical N-terminal cleaved signal-peptide sequences. FlgH is predicted to have an extensive beta-sheet structure, in keeping with other outer membrane proteins [].; GO: 0003774 motor activity, 0001539 ciliary or flagellar motility, 0009427 bacterial-type flagellum basal body, distal rod, L ring
Probab=31.21  E-value=31  Score=23.27  Aligned_cols=12  Identities=33%  Similarity=0.504  Sum_probs=10.2

Q ss_pred             EEeecccEEEee
Q psy10521         12 VVLSSGDLYVFN   23 (66)
Q Consensus        12 ~ilpsGeL~I~n   23 (66)
                      .++|+|.|.|..
T Consensus       102 ~VlpNGnL~I~G  113 (179)
T PF02107_consen  102 EVLPNGNLVIEG  113 (179)
T ss_pred             EECCCCcEEEEE
Confidence            368999999986


No 213
>PRK12698 flgH flagellar basal body L-ring protein; Reviewed
Probab=31.03  E-value=32  Score=24.33  Aligned_cols=12  Identities=33%  Similarity=0.534  Sum_probs=10.5

Q ss_pred             EEeecccEEEee
Q psy10521         12 VVLSSGDLYVFN   23 (66)
Q Consensus        12 ~ilpsGeL~I~n   23 (66)
                      .++|+|+|.|+.
T Consensus       145 ~VlpNGnL~I~G  156 (224)
T PRK12698        145 QVLPNGNLVIRG  156 (224)
T ss_pred             EECCCCCEEEEE
Confidence            468999999987


No 214
>PRK12699 flgH flagellar basal body L-ring protein; Reviewed
Probab=30.89  E-value=32  Score=24.82  Aligned_cols=12  Identities=33%  Similarity=0.537  Sum_probs=10.6

Q ss_pred             EEeecccEEEee
Q psy10521         12 VVLSSGDLYVFN   23 (66)
Q Consensus        12 ~ilpsGeL~I~n   23 (66)
                      .++|+|+|.|+.
T Consensus       169 ~VLPNGNLvI~G  180 (246)
T PRK12699        169 DILPNGNLLVSG  180 (246)
T ss_pred             EECCCCCEEEEE
Confidence            578999999987


No 215
>PF03498 CDtoxinA:  Cytolethal distending toxin A/C family;  InterPro: IPR003558 Escherichia coli, Haemophilus spp and Campylobacter spp. all produce a toxin that is seen to cause distension in certain cell lines [, ], which eventually disintegrate and die. This novel toxin, termed cytolethal distending toxin (cdt), has three subunits: A, B and C. Their sizes are approx. 27.7, 29.5 and 19.9kDa respectively [], and they appear to be entirely novel [].  Further research on the complete toxin has revealed that it blocks the cell cycle at stage G2, through inactivation of the cyclin-dependent kinase Cdk1, and without induction of DNA breaks. This leads to multipolar abortive mitosis and micronucleation, associated with centrosomal amplification []. The roles of each subunit are unclear, but it is believed that they have separate roles in pathogenicity. This entry represents the A and C subunits.; GO: 0009405 pathogenesis; PDB: 2F2F_A 1SR4_C.
Probab=30.67  E-value=96  Score=20.62  Aligned_cols=29  Identities=7%  Similarity=0.257  Sum_probs=18.2

Q ss_pred             CeEEEee--cccEEEeecCCCCCCcceeEEeeccccC
Q psy10521          9 GKYVVLS--SGDLYVFNATPNDGYKSYRCRTVNKITG   43 (66)
Q Consensus         9 ~ry~ilp--sGeL~I~nv~~~D~~~~Y~C~~~~~lTg   43 (66)
                      ..|.++|  +|..+|+++...      +|...+...+
T Consensus        85 q~F~iiPtttgAVQIks~~~~------~Cl~~~~~~~  115 (150)
T PF03498_consen   85 QVFSIIPTTTGAVQIKSLSTG------ECLQTFNNSR  115 (150)
T ss_dssp             H-EEEEEBTTS-EEEEETTT--------EEEE-STTS
T ss_pred             ceEEEEEcCCCcEEEEecCCC------ceEEecCCCc
Confidence            4567766  999999996653      7888766554


No 216
>PRK12696 flgH flagellar basal body L-ring protein; Reviewed
Probab=30.65  E-value=32  Score=24.52  Aligned_cols=12  Identities=33%  Similarity=0.274  Sum_probs=10.6

Q ss_pred             EEeecccEEEee
Q psy10521         12 VVLSSGDLYVFN   23 (66)
Q Consensus        12 ~ilpsGeL~I~n   23 (66)
                      .++|+|+|.|..
T Consensus       158 ~VLPNGNLvI~G  169 (236)
T PRK12696        158 RVLPGGLMQVEG  169 (236)
T ss_pred             EECCCCCEEEEE
Confidence            478999999987


No 217
>COG1471 RPS4A Ribosomal protein S4E [Translation, ribosomal structure and biogenesis]
Probab=29.60  E-value=2e+02  Score=21.02  Aligned_cols=51  Identities=25%  Similarity=0.427  Sum_probs=36.1

Q ss_pred             CCeEEEee--cccEEEeecCCCCCCcceeEEeecccc---CcEEeccccee-EEEecc
Q psy10521          8 GGKYVVLS--SGDLYVFNATPNDGYKSYRCRTVNKIT---GESQASVFQTR-LSITGF   59 (66)
Q Consensus         8 ~~ry~ilp--sGeL~I~nv~~~D~~~~Y~C~~~~~lT---ge~~~S~~~~~-l~v~ep   59 (66)
                      +..|=++|  .|-|..+-++.|.+ +.=-|++.|+.+   |..+...+.|+ +.+.++
T Consensus        95 gE~yRvl~d~~grl~l~~is~EeA-~~Kl~kV~nKt~vkgG~~QLn~hDGrni~~~d~  151 (241)
T COG1471          95 GEHYRVLPDEKGRLVLHPISAEEA-SYKLCKVKNKTTVKGGRIQLNLHDGRNIRLEDD  151 (241)
T ss_pred             CceEEEEecCCccEEEEecChhhc-cceEEEEEeEEEecCCEEEEEecCCceeeccCC
Confidence            55677776  79999999998775 334599999988   55665555555 666553


No 218
>PF04571 Lipin_N:  lipin, N-terminal conserved region;  InterPro: IPR007651 Mutations in the lipin gene lead to fatty liver dystrophy in mice. The protein has been shown to be phosphorylated by the TOR Ser/Thr protein kinases in response to insulin stimulation. This entry represents a conserved domain found at the N terminus of the member proteins [, ].
Probab=28.96  E-value=70  Score=20.62  Aligned_cols=31  Identities=19%  Similarity=0.172  Sum_probs=25.8

Q ss_pred             cccEEEeecCCCCCCcceeEEeeccccCcEEec
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKITGESQAS   48 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S   48 (66)
                      +|..=|.=|+..|  ++|+|...|--=|.++.-
T Consensus        25 SGAiDVIVV~q~D--Gs~~sSPFhVRFGk~~vl   55 (110)
T PF04571_consen   25 SGAIDVIVVEQPD--GSLKSSPFHVRFGKLGVL   55 (110)
T ss_pred             cCceeEEEEecCC--CCEecCccEEEEcceeee
Confidence            8888899999999  599999998777776653


No 219
>KOG1417|consensus
Probab=28.49  E-value=50  Score=25.50  Aligned_cols=18  Identities=17%  Similarity=0.580  Sum_probs=15.6

Q ss_pred             ccCCeEEEee-cccEEEee
Q psy10521          6 FVGGKYVVLS-SGDLYVFN   23 (66)
Q Consensus         6 ~~~~ry~ilp-sGeL~I~n   23 (66)
                      +++|.|+|.| .|.|.|.-
T Consensus       152 NsDGDFLiVPQ~G~L~I~T  170 (446)
T KOG1417|consen  152 NSDGDFLIVPQQGRLWITT  170 (446)
T ss_pred             cCCCCEEEecccCcEEEEe
Confidence            6799999998 89999864


No 220
>PRK10626 hypothetical protein; Provisional
Probab=28.45  E-value=42  Score=24.24  Aligned_cols=16  Identities=19%  Similarity=0.393  Sum_probs=14.0

Q ss_pred             CCeEEEeecccEEEee
Q psy10521          8 GGKYVVLSSGDLYVFN   23 (66)
Q Consensus         8 ~~ry~ilpsGeL~I~n   23 (66)
                      .|+|.|.|+|+|+|.+
T Consensus        45 sg~l~I~~dg~L~inG   60 (239)
T PRK10626         45 SGNLVISPDGNVMRNG   60 (239)
T ss_pred             CCceEEcCCCCEEECC
Confidence            5689999999999976


No 221
>PF03460 NIR_SIR_ferr:  Nitrite/Sulfite reductase ferredoxin-like half domain;  InterPro: IPR005117 Sulphite reductases (SiRs) and related nitrite reductases (NiRs) catalyse the six-electron reduction reactions of sulphite to sulphide, and nitrite to ammonia, respectively. The Escherichia coli SiR enzyme is a complex composed of two proteins, a flavoprotein alpha-component (SiR-FP) and a hemoprotein beta-component (SiR-HP), and has an alpha(8)beta(4) quaternary structure []. SiR-FP contains both FAD and FMN, while SiR-HP contains a Fe(4)S(4) cluster coupled to a sirohaem through a cysteine bridge. Electrons are transferred from NADPH to FAD, and on to FMN in SiR-FP, from which they are transferred to the metal centre of SiR-HP, where they reduce the siroheme-bound sulphite. SiR-HP has a two-fold symmetry, which generates a distinctive three-domain alpha/beta fold that controls assembly and reactivity []. This entry describes the ferrodoxin-like (alpha/beta sandwich) domain, which consists of a duplication containing two subdomains of this fold.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3B0H_A 4GEP_A 2GEP_A 2AOP_A 5AOP_A 6GEP_A 4AOP_A 1AOP_A 3AOP_A 8GEP_A ....
Probab=28.38  E-value=42  Score=18.42  Aligned_cols=20  Identities=10%  Similarity=0.205  Sum_probs=16.9

Q ss_pred             CeEEEeecccEEEeecCCCC
Q psy10521          9 GKYVVLSSGDLYVFNATPND   28 (66)
Q Consensus         9 ~ry~ilpsGeL~I~nv~~~D   28 (66)
                      +...+.+..+|+|++|..++
T Consensus        39 ~~irlT~~Q~l~l~~v~~~~   58 (69)
T PF03460_consen   39 GEIRLTTRQNLQLRGVPEEN   58 (69)
T ss_dssp             SEEEEETTSCEEEEEEEGGG
T ss_pred             CeEEECCCCeEEEeCCCHHH
Confidence            67777889999999998876


No 222
>PF03287 Pox_C7_F8A:  Poxvirus C7/F8A protein;  InterPro: IPR004967 This family includes Poxvirus C7 and F8A proteins.; GO: 0016032 viral reproduction
Probab=27.40  E-value=2e+02  Score=19.53  Aligned_cols=49  Identities=14%  Similarity=0.131  Sum_probs=37.1

Q ss_pred             eEEE-eecccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEEecccccc
Q psy10521         10 KYVV-LSSGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSITGFRAVY   63 (66)
Q Consensus        10 ry~i-lpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v~ep~~~~   63 (66)
                      ++.+ +-+.+|=|+||+--.+ -+|=|...=+.++.-+..    -+.|.+|.|+.
T Consensus         6 e~dIfiVde~ialkn~~L~kG-dsYGC~I~lk~~~~K~i~----f~~Il~pdwse   55 (149)
T PF03287_consen    6 ELDIFIVDENIALKNVELHKG-DSYGCTIKLKSKETKKIN----FIFILRPDWSE   55 (149)
T ss_pred             EEEEEEEeCceeeceeecccC-cccCEEEEEEeCCccEEE----EEEEEccChhh
Confidence            4556 5699999999998875 799999988877766554    46666677753


No 223
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. Ig_CD3_gamma_delta; immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=27.19  E-value=37  Score=20.18  Aligned_cols=18  Identities=22%  Similarity=0.516  Sum_probs=13.5

Q ss_pred             eecCCCCCCcceeEEeec
Q psy10521         22 FNATPNDGYKSYRCRTVN   39 (66)
Q Consensus        22 ~nv~~~D~~~~Y~C~~~~   39 (66)
                      ..-...|-.|.|.|+..+
T Consensus        37 LGs~~~DPRG~Y~C~~s~   54 (69)
T cd07691          37 LGSRINDPRGTYSCKESE   54 (69)
T ss_pred             ccCcccCCCcceEecCcc
Confidence            334456888999998876


No 224
>COG5475 Uncharacterized small protein [Function unknown]
Probab=27.07  E-value=72  Score=18.59  Aligned_cols=34  Identities=29%  Similarity=0.422  Sum_probs=21.3

Q ss_pred             CCeEEEeecc--cEEEeecCCCCCCcceeEEeeccccCc
Q psy10521          8 GGKYVVLSSG--DLYVFNATPNDGYKSYRCRTVNKITGE   44 (66)
Q Consensus         8 ~~ry~ilpsG--eL~I~nv~~~D~~~~Y~C~~~~~lTge   44 (66)
                      .|.-+.+-+|  ...|.+++. |  ++|.|+-.+...-+
T Consensus         7 tgdvV~lKsGGP~Mtvs~~ss-~--Gmy~C~Wf~g~g~~   42 (60)
T COG5475           7 TGDVVTLKSGGPRMTVSGYSS-D--GMYECRWFDGYGVK   42 (60)
T ss_pred             cCcEEEeecCCceEEEecccc-C--CeEEEEEecCCCcc
Confidence            3444444444  245566655 3  79999999987644


No 225
>PF11101 DUF2884:  Protein of unknown function (DUF2884);  InterPro: IPR021307  Some members in this bacterial family of proteins are annotated as YggN which currently has no known function. 
Probab=24.74  E-value=62  Score=22.57  Aligned_cols=15  Identities=20%  Similarity=0.417  Sum_probs=13.1

Q ss_pred             CeEEEeecccEEEee
Q psy10521          9 GKYVVLSSGDLYVFN   23 (66)
Q Consensus         9 ~ry~ilpsGeL~I~n   23 (66)
                      .++.|.++|+|+|.+
T Consensus        24 ~~~~I~~~g~L~i~G   38 (229)
T PF11101_consen   24 EKLRIDPDGNLFING   38 (229)
T ss_pred             ceEEEcCCCcEEECC
Confidence            389999999999975


No 226
>KOG1832|consensus
Probab=24.26  E-value=76  Score=28.05  Aligned_cols=30  Identities=20%  Similarity=0.460  Sum_probs=25.4

Q ss_pred             cCCeEEEee--cccEEEeecCCCCCCcceeEE
Q psy10521          7 VGGKYVVLS--SGDLYVFNATPNDGYKSYRCR   36 (66)
Q Consensus         7 ~~~ry~ilp--sGeL~I~nv~~~D~~~~Y~C~   36 (66)
                      .+.+++++-  +||+.|.||...-..++|.|-
T Consensus      1111 ~~~~hL~vG~~~Geik~~nv~sG~~e~s~ncH 1142 (1516)
T KOG1832|consen 1111 GGTNHLAVGSHAGEIKIFNVSSGSMEESVNCH 1142 (1516)
T ss_pred             cCCceEEeeeccceEEEEEccCcccccccccc
Confidence            356788864  999999999998878999994


No 227
>PF11901 DUF3421:  Protein of unknown function (DUF3421);  InterPro: IPR024518 This domain of unknown function is found in the fish toxin Natterin [] and in uncharacterised proteins.
Probab=24.20  E-value=81  Score=19.77  Aligned_cols=14  Identities=29%  Similarity=0.404  Sum_probs=9.8

Q ss_pred             CCCCcceeEEeecc
Q psy10521         27 NDGYKSYRCRTVNK   40 (66)
Q Consensus        27 ~D~~~~Y~C~~~~~   40 (66)
                      +|....|-||++|.
T Consensus         6 ~~g~~iYV~Ra~~~   19 (119)
T PF11901_consen    6 SDGEPIYVGRAKHE   19 (119)
T ss_pred             CCCCEEEEEEEEEC
Confidence            34567888888765


No 228
>cd00244 AlgLyase Alginate Lyase A1-III; enzymatically depolymerizes alginate, a complex copolymer of beta-D-mannuronate and alpha-L-guluronate, by cleaving the beta-(1,4) glycosidic bond.
Probab=23.95  E-value=19  Score=27.26  Aligned_cols=34  Identities=32%  Similarity=0.337  Sum_probs=24.4

Q ss_pred             EeecccEEEeecCCCCCCcceeEEee-ccccCcEEec
Q psy10521         13 VLSSGDLYVFNATPNDGYKSYRCRTV-NKITGESQAS   48 (66)
Q Consensus        13 ilpsGeL~I~nv~~~D~~~~Y~C~~~-~~lTge~~~S   48 (66)
                      +.|.|-+.=..-...+  +.|.|.+. .++||+++.-
T Consensus         8 ~~p~gy~~~~~~~~~~--~~~~C~~~p~py~g~l~~~   42 (339)
T cd00244           8 VPPSGYYADVLKRKGP--KAYDCTAVPNPYTGELVFR   42 (339)
T ss_pred             cCCccccccHHHhccC--CCCCCCCCCCCccCcccCc
Confidence            3466655544444444  78999998 9999999873


No 229
>PF00900 Ribosomal_S4e:  Ribosomal family S4e;  InterPro: IPR013845 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families includes yeast S7 (YS6); archaeal S4e; and mammalian and plant cytoplasmic S4 []. Two highly similar isoforms of mammalian S4 exist, one coded by a gene on chromosome Y, and the other on chromosome X. These proteins have 233 to 264 amino acids. This entry represents the central region of these proteins.; PDB: 2XZM_W 2XZN_W 3IZ6_D 3KBG_A 3U5G_E 3U5C_E 3IZB_D.
Probab=22.58  E-value=1.5e+02  Score=17.52  Aligned_cols=34  Identities=29%  Similarity=0.473  Sum_probs=24.2

Q ss_pred             CCeEEEee--cccEEEeecCCCCCCcceeEEeecccc
Q psy10521          8 GGKYVVLS--SGDLYVFNATPNDGYKSYRCRTVNKIT   42 (66)
Q Consensus         8 ~~ry~ilp--sGeL~I~nv~~~D~~~~Y~C~~~~~lT   42 (66)
                      +..|-+++  .|-|.++.+++|++ +.=-|++.++.+
T Consensus         3 ~e~yRvl~d~kgr~~l~~I~~eea-~~KLckV~~k~~   38 (77)
T PF00900_consen    3 GEHYRVLYDTKGRFVLHPISEEEA-KYKLCKVRNKTT   38 (77)
T ss_dssp             TEEEEEEE-TTS-EEEEEE-TTGG-GEEEEEEEEEEE
T ss_pred             CcEEEEEECCCCcEEEEECCHHHc-cCeEEEEeEEEE
Confidence            44566765  79999999999985 333599998877


No 230
>PHA03269 envelope glycoprotein C; Provisional
Probab=22.30  E-value=1.7e+02  Score=23.79  Aligned_cols=40  Identities=13%  Similarity=0.273  Sum_probs=28.7

Q ss_pred             CCeEEEe-e--cc--cEEEeecCCCCCCcceeEEeeccccCcEEec
Q psy10521          8 GGKYVVL-S--SG--DLYVFNATPNDGYKSYRCRTVNKITGESQAS   48 (66)
Q Consensus         8 ~~ry~il-p--sG--eL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S   48 (66)
                      ++||++- +  .|  -|.|++|++.++ |.|..+..+.-.+-...+
T Consensus       275 ~~~yi~p~~a~p~~~pL~I~sltaATe-GvY~Wrv~~~~n~t~~~~  319 (566)
T PHA03269        275 KEKYIIPDRKTTSDFSLHILSLDASTE-GTYIWRVIHTANKNVINE  319 (566)
T ss_pred             CceEEeccCCCCCccceEEeecccccC-ceEEEEEecCCCCceeee
Confidence            5788773 2  11  299999999996 999999887665444444


No 231
>PHA02854 putative host range protein; Provisional
Probab=21.25  E-value=2.5e+02  Score=19.63  Aligned_cols=48  Identities=19%  Similarity=0.187  Sum_probs=36.3

Q ss_pred             eEEE-eecccEEEeecCCCCCCcceeEEeeccccCcEEecccceeEEEeccccc
Q psy10521         10 KYVV-LSSGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSITGFRAV   62 (66)
Q Consensus        10 ry~i-lpsGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~~S~~~~~l~v~ep~~~   62 (66)
                      ++.+ +.+++|=|.||+--.+ .+|=|...=+.+.+-+..    -+.|.+|.++
T Consensus         6 eldIflvdEnialKnv~L~kG-dSYGC~I~Lk~~~~K~~~----~i~Il~pdws   54 (178)
T PHA02854          6 ELDIFVTNEDLALKNVELFKG-NSYGCFINLKVKEEKKFN----IIFVLKPDWS   54 (178)
T ss_pred             EEEEEEecCceeccccccccC-CccCEEEEEEeCCccEEE----EEEEEecChh
Confidence            3444 4599999999999875 799999988877765543    5667777664


No 232
>cd06896 PX_PI3K_C2_gamma The phosphoinositide binding Phox Homology Domain of the Gamma Isoform of Class II Phosphoinositide 3-Kinases. The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. The Phosphoinositide 3-Kinase (PI3K) family of enzymes catalyzes the phosphorylation of the 3-hydroxyl group of the inositol ring of phosphatidylinositol. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. PI3Ks are divided into three main classes (I, II, and III) based on their substrate specificity, regulation, and domain structure. Class II PI3Ks preferentially use PI as a substrate to produce PI3P, but can also phosphorylate PI4P to produce PI(3,4)P2. They function as monomers and do not associate with any regulatory subunits. Class II enzymes contain an N-terminal Ras binding domain, a lipid binding C2 dom
Probab=20.84  E-value=77  Score=20.23  Aligned_cols=26  Identities=19%  Similarity=0.318  Sum_probs=21.9

Q ss_pred             cccEEEeecCCCCCCcceeEEeeccc
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKI   41 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~l   41 (66)
                      .+.|||.-|.|+|...++.++.....
T Consensus        11 ~s~lY~i~V~~sd~~~t~v~Rs~eeF   36 (101)
T cd06896          11 SSNLYLVQVTQSCNLVSLTEKSFEQF   36 (101)
T ss_pred             cceEEEEEEEEeCCCcceeeecHHHH
Confidence            36899999999999899999987543


No 233
>KOG1460|consensus
Probab=20.38  E-value=60  Score=25.10  Aligned_cols=30  Identities=23%  Similarity=0.403  Sum_probs=26.6

Q ss_pred             cccEEEeecCCCCCCcceeEEeeccccCcEE
Q psy10521         16 SGDLYVFNATPNDGYKSYRCRTVNKITGESQ   46 (66)
Q Consensus        16 sGeL~I~nv~~~D~~~~Y~C~~~~~lTge~~   46 (66)
                      .|-|+...|+.|++ ..|-|.+-++-|||+-
T Consensus       136 ~~tll~tkvs~e~a-snfG~lV~dP~t~evl  165 (407)
T KOG1460|consen  136 IGTLLVTKVSREQA-SNFGCLVEDPSTGEVL  165 (407)
T ss_pred             ceEEEEEEecHhHh-hccCeeeecCCcCceE
Confidence            46788999999997 8999999999999974


No 234
>TIGR02754 sod_Ni_protease nickel-type superoxide dismutase maturation protease. Members of this protein family are apparent proteases encoded adjacent to the genes for a nickel-type superoxide dismutase. This family belongs to the same larger family (see Pfam model pfam00717) as signal peptidase I, an unusual serine protease suggested to have a Ser/Lys catalytic dyad.
Probab=20.16  E-value=1.5e+02  Score=16.89  Aligned_cols=15  Identities=20%  Similarity=0.313  Sum_probs=9.6

Q ss_pred             CCccCccCCeEEEee
Q psy10521          1 MTSDDFVGGKYVVLS   15 (66)
Q Consensus         1 ~~ps~~~~~ry~ilp   15 (66)
                      |.|.+..+...++.+
T Consensus         8 M~P~l~~GD~vlv~~   22 (90)
T TIGR02754         8 MSPTLPPGDRIIVVP   22 (90)
T ss_pred             ccCccCCCCEEEEEE
Confidence            677777666655553


Done!