RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy10521
         (66 letters)



>gnl|CDD|204131 pfam09092, Lyase_N, Lyase, N terminal.  Members of this family are
           predominantly found in chondroitin ABC lyase I, and
           adopt a jelly-roll fold topology consisting of a
           two-layered bent beta-sheet sandwich with one short
           alpha-helix. The convex beta sheet is composed of five
           antiparallel strands, whilst the concave beta-sheet
           contains five antiparallel beta-strands with a loop
           between two consecutive strands folding back onto the
           concave surface. This domain is required for binding of
           the protein to long glycosaminoglycan chains.
          Length = 178

 Score = 28.3 bits (63), Expect = 0.17
 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 14  LSSGDLYVFNATPNDGYKSYRCRTVNKITGESQASVFQTRLSITGFRAVY 63
            S+  L+++N  P D Y ++   +    +GE  A  F+  ++ TG+RAV+
Sbjct: 72  RSAISLWIYNEKPVDDYITFEFGSKLGPSGEPDAG-FKVGINFTGWRAVW 120


>gnl|CDD|173895 cd00517, ATPS, ATP-sulfurylase.  ATP-sulfurylase (ATPS), also known
           as sulfate adenylate transferase, catalyzes the transfer
           of an adenylyl group from ATP to sulfate, forming
           adenosine 5'-phosphosulfate (APS).  This reaction is
           generally accompanied by a further reaction, catalyzed
           by APS kinase, in which APS is phosphorylated to yield
           3'-phospho-APS (PAPS).  In some organisms the APS kinase
           is a separate protein, while in others it is
           incorporated with ATP sulfurylase in a bifunctional
           enzyme that catalyzes both reactions.  In bifunctional
           proteins, the domain that performs the kinase activity
           can be attached at the N-terminal end of the sulfurylase
           unit or at the C-terminal end, depending on the
           organism. While the reaction is ubiquitous among
           organisms, the physiological role of the reaction
           varies.  In some organisms it is used to generate APS
           from sulfate and ATP, while in others it proceeds in the
           opposite direction to generate ATP from APS and
           pyrophosphate.  ATP sulfurylase can be a monomer, a
           homodimer, or a homo-oligomer, depending on the
           organism.  ATPS belongs to a large superfamily of
           nucleotidyltransferases that includes pantothenate
           synthetase (PanC), phosphopantetheine
           adenylyltransferase (PPAT), and the amino-acyl tRNA
           synthetases. The enzymes of this family are structurally
           similar and share a dinucleotide-binding domain.
          Length = 353

 Score = 26.4 bits (59), Expect = 0.95
 Identities = 16/63 (25%), Positives = 22/63 (34%), Gaps = 11/63 (17%)

Query: 2   TSDDFVGGKYVVLSS------GDLYVFNATPNDGYKSYR-----CRTVNKITGESQASVF 50
           T+D    G   V+        G + V    P   +  YR      R + K  G  +   F
Sbjct: 103 TTDPHHPGVKKVMEQGDWLVGGPIEVLELPPFPDFDQYRLTPAELRALFKERGWRRVVAF 162

Query: 51  QTR 53
           QTR
Sbjct: 163 QTR 165


>gnl|CDD|215067 PLN00129, PLN00129, succinate dehydrogenase [ubiquinone]
           iron-sulfur subunit.
          Length = 276

 Score = 25.9 bits (57), Expect = 1.3
 Identities = 6/12 (50%), Positives = 9/12 (75%)

Query: 27  NDGYKSYRCRTV 38
           +D +K YRC T+
Sbjct: 238 DDEFKLYRCHTI 249


>gnl|CDD|241300 cd01270, PTB_CAPON-like, Carboxyl-terminal PDZ ligand of neuronal
           nitric oxide synthase protein (CAPON)
           Phosphotyrosine-binding (PTB) domain.  CAPON (also known
           as Nitric oxide synthase 1 adaptor protein, NOS1AP,
           encodes a cytosolic protein that binds to the signaling
           molecule, neuronal NOS (nNOS).  It contains a N-terminal
           PTB domain that binds to the small monomeric G protein,
           Dexras1 and a C-terminal PDZ-binding domain that
           mediates interactions with nNOS.  Included in this cd
           are C. elegan proteins dystrobrevin, DYB-1, which
           controls neurotransmitter release and muscle Ca(2+)
           transients by localizing BK channels and DYstrophin-like
           phenotype and CAPON related,DYC-1, which is functionally
           related to dystrophin homolog, DYS-1. Mutations in the
           dystrophin gene causes Duchenne muscular dystrophy.
           DYS-1 shares sequence similarity, including key motifs,
           with their mammalian counterparts. These CAPON-like
           proteins all have a single PTB domain. PTB domains have
           a common PH-like fold and are found in various
           eukaryotic signaling molecules. This domain was
           initially shown to binds peptides with a NPXY motif with
           differing requirements for phosphorylation of the
           tyrosine, although more recent studies have found that
           some types of PTB domains can bind to peptides lack
           tyrosine residues altogether. In contrast to SH2
           domains, which recognize phosphotyrosine and adjacent
           carboxy-terminal residues, PTB-domain binding
           specificity is conferred by residues amino-terminal to
           the phosphotyrosine.  PTB domains are classified into
           three groups: phosphotyrosine-dependent Shc-like,
           phosphotyrosine-dependent IRS-like, and
           phosphotyrosine-independent Dab-like PTB domains. This
           cd is part of the Dab-like subgroup.
          Length = 179

 Score = 25.7 bits (57), Expect = 1.7
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 2/38 (5%)

Query: 11  YVVLSSGDLYVFNATPNDGYKS-YRCRTVNKITGESQA 47
           YV   S DL +F+    DG  + ++C  V K   +SQA
Sbjct: 112 YVSHDSQDLKIFSYIARDGSSNVFKC-NVFKSKKKSQA 148


>gnl|CDD|215246 PLN02447, PLN02447, 1,4-alpha-glucan-branching enzyme.
          Length = 758

 Score = 25.4 bits (56), Expect = 2.2
 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 1/28 (3%)

Query: 8   GGKYVVLSSGDL-YVFNATPNDGYKSYR 34
           G K +V   GDL +VFN  P + Y  YR
Sbjct: 643 GDKVIVFERGDLVFVFNFHPTNSYSDYR 670


>gnl|CDD|143178 cd04977, Ig1_NCAM-1_like, First immunoglobulin (Ig)-like domain
          of neural cell adhesion molecule NCAM-1 and similar
          proteins.  Ig1_NCAM-1 like: first immunoglobulin
          (Ig)-like domain of neural cell adhesion molecule
          NCAM-1. NCAM-1 plays important roles in the development
          and regeneration of the central nervous system, in
          synaptogenesis and neural migration. NCAM mediates
          cell-cell and cell-substratum recognition and adhesion
          via homophilic (NCAM-NCAM), and heterophilic
          (NCAM-nonNCAM), interactions. NCAM is expressed as
          three major isoforms having different intracellular
          extensions. The extracellular portion of NCAM has five
          N-terminal Ig-like domains and two fibronectin type III
          domains. The double zipper adhesion complex model for
          NCAM homophilic binding involves the Ig1, Ig2, and Ig3
          domains. By this model, Ig1 and Ig2 mediate
          dimerization of NCAM molecules situated on the same
          cell surface (cis interactions), and Ig3 domains
          mediate interactions between NCAM molecules expressed
          on the surface of opposing cells (trans interactions),
          through binding to the Ig1 and Ig2 domains. The
          adhesive ability of NCAM is modulated by the addition
          of polysialic acid chains to the fifth Ig-like domain.
          Also included in this group is NCAM-2 (also known as
          OCAM/mamFas II and RNCAM).  NCAM-2 is differentially
          expressed in the developing and mature olfactory
          epithelium (OE).
          Length = 92

 Score = 24.4 bits (53), Expect = 3.7
 Identities = 12/45 (26%), Positives = 21/45 (46%), Gaps = 5/45 (11%)

Query: 9  GKYVVLSSGD----LYVFNATPNDGYKSYRCRTVNKITGESQASV 49
           +  V+ + D    L ++NA   D    Y+C   +    ES+A+V
Sbjct: 45 QQISVVQNDDVRSTLTIYNANIEDA-GIYKCVATDAKGTESEATV 88


>gnl|CDD|213240 cd03273, ABC_SMC2_euk, ATP-binding cassette domain of eukaryotic
          SMC2 proteins.  The structural maintenance of
          chromosomes (SMC) proteins are large (approximately 110
          to 170 kDa), and each is arranged into five
          recognizable domains. Amino-acid sequence homology of
          SMC proteins between species is largely confined to the
          amino- and carboxy-terminal globular domains. The
          amino-terminal domain contains a 'Walker A'
          nucleotide-binding domain (GxxGxGKS/T, in the
          single-letter amino-acid code), which by mutational
          studies has been shown to be essential in several
          proteins. The carboxy-terminal domain contains a
          sequence (the DA-box) that resembles a 'Walker B'
          motif, and a motif with homology to the signature
          sequence of the ATP-binding cassette (ABC) family of
          ATPases. The sequence homology within the
          carboxy-terminal domain is relatively high within the
          SMC1-SMC4 group, whereas SMC5 and SMC6 show some
          divergence in both of these sequences. In eukaryotic
          cells, the proteins are found as heterodimers of SMC1
          paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6
          (formerly known as Rad18).
          Length = 251

 Score = 24.6 bits (54), Expect = 4.0
 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 8/24 (33%)

Query: 28 DGYKSYRCRTV--------NKITG 43
          DG+KSY  RTV        N ITG
Sbjct: 9  DGFKSYATRTVISGFDPQFNAITG 32


>gnl|CDD|198067 smart00999, Aerolysin, Aerolysin toxin.  This family represents
          the pore forming lobe of aerolysin.
          Length = 368

 Score = 23.7 bits (51), Expect = 8.8
 Identities = 13/41 (31%), Positives = 16/41 (39%)

Query: 2  TSDDFVGGKYVVLSSGDLYVFNATPNDGYKSYRCRTVNKIT 42
           +  +VG    V   GD +V     N     YRC    KIT
Sbjct: 36 NASQYVGEDMDVTRVGDGWVIQGNYNGSCSGYRCGEKTKIT 76


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.318    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0604    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,145,658
Number of extensions: 210227
Number of successful extensions: 183
Number of sequences better than 10.0: 1
Number of HSP's gapped: 183
Number of HSP's successfully gapped: 10
Length of query: 66
Length of database: 10,937,602
Length adjustment: 37
Effective length of query: 29
Effective length of database: 9,296,504
Effective search space: 269598616
Effective search space used: 269598616
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (24.5 bits)