Diaphorina citri psyllid: psy10532

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340------
MRIVQIPIAAVKELVDRKSGSAGMPRSEERFSRNAETDIVCRLLLEKKKKSRAERRARGWAVVETTVRSKPLGRGTYPSTKITKSPYTLTPYSCNMGRNIFTTLLTILVDEWGYNLADKKQYVGTYILLEWLLEVYDDHTGKLYIRLLEVYDDHTGKLYKVSSDPATRLEVIKLNEQLDTRLQQRQARETGICPVRRELFTQCFDELIRQAAINCGERGLLLLRVRDEFRQTIAGYQSLYESSIAFGMRKALQVCSGHVGVQGVSSFNKKSLNMKSKEGQDIAEQGKFDMEEEIERLRGAYACQVYLIPKEHTHYQVDLTLQDHTHYQVDLTGMVEKVRLSGLRDT
ccEEEcHHHHHHHHHccccccccccccHHHcccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccEECccccccccccccccccccccHHHHHHHccccccccccccccccccHHHHHHHHHHcccccccccHHHccccccEEEEEccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
*RIVQIPIAAVKEL***********************DIVCRLLLE**************AVVETTVRSKPLGRGTYPSTKITKSPYTLTPYSCNMGRNIFTTLLTILVDEWGYNLADKKQYVGTYILLEWLLEVYDDHTGKLYIRLLEVYDDHTGKLYKVSSDPATRLEVIKLNEQLDTRLQQRQARETGICPVRRELFTQCFDELIRQAAINCGERGLLLLRVRDEFRQTIAGYQSLYESSIAFGMRKALQVCSGHVGVQGVSSFNKKSLNMKSKEGQDIAE*********IERLRGAYACQVYLIPKEHTHYQVDLTLQDHTHYQVDLTGMVEKV********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRIVQIPIAAVKELVDRKSGSAGMPRSEERFSRNAETDIVCRLLLEKKKKSRAERRARGWAVVETTVRSKPLGRGTYPSTKITKSPYTLTPYSCNMGRNIFTTLLTILVDEWGYNLADKKQYVGTYILLEWLLEVYDDHTGKLYIRLLEVYDDHTGKLYKVSSDPATRLEVIKLNEQLDTRLQQRQARETGICPVRRELFTQCFDELIRQAAINCGERGLLLLRVRDEFRQTIAGYQSLYESSIAFGMRKALQVCSGHVGVQGVSSFNKKSLNMKSKEGQDIAEQGKFDMEEEIERLRGAYACQVYLIPKEHTHYQVDLTLQDHTHYQVDLTGMVEKVRLSGLRDT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Axonemal dynein light intermediate polypeptide 1 May play a dynamic role in flagellar motility.confidentQ4FZV3
Axonemal dynein light intermediate polypeptide 1 May play a dynamic role in flagellar motility.confidentO14645
Putative inner dynein arm light chain, axonemal May play a dynamic role in flagellar motility.confidentQ9VGG6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted