Diaphorina citri psyllid: psy10539

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MKGKRRILPSENVWVSIVSLGEGWHNYHHVFPWDYRAAEMGSYSLNLTTFWLDQFAKIGWAYDLKKPSDKMIRSHAEKYAGHDHPVEVTEEDASTMDLEEINDNIEICG
cccccccccccHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHccHcccccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHcc
MKGKRRILPSENVWVSIVSLGEGWHNYHHVFPWDYRAAEMGSYSLNLTTFWLDQFAKIGWAYDLKKPSDKMI**************EVTEEDASTMDLEEINDNIEICG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGKRRILPSENVWVSIVSLGEGWHNYHHVFPWDYRAAEMGSYSLNLTTFWLDQFAKIGWAYDLKKPSDKMIRSHAEKYAGHDHPVEVTEEDASTMDLEEINDNIEICG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Acyl-CoA desaturase (Fragment) Terminal component of the liver microsomal stearyl-CoA desaturase system, that utilizes O(2) and electrons from reduced cytochrome b5 to catalyze the insertion of a double bond into a spectrum of fatty acyl-CoA substrates including palmitoyl-CoA and stearoyl-CoA.confidentO02858

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016215 [MF]acyl-CoA desaturase activityprobableGO:0003824, GO:0016717, GO:0016705, GO:0003674, GO:0016491
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0006631 [BP]fatty acid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0006082, GO:0009987, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0044281
GO:0048047 [BP]mating behavior, sex discriminationprobableGO:0044703, GO:0000003, GO:0007618, GO:0019098, GO:0007617, GO:0050896, GO:0007610, GO:0022414, GO:0008150, GO:0051705, GO:0051704
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0031410 [CC]cytoplasmic vesicleprobableGO:0005737, GO:0031982, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043226
GO:0042811 [BP]pheromone biosynthetic processprobableGO:0042445, GO:0042446, GO:0044711, GO:0044550, GO:0019748, GO:0044710, GO:0044237, GO:0010817, GO:0044249, GO:0009058, GO:0042810, GO:0008150, GO:0008152, GO:0065007, GO:0009987, GO:0065008

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted