Query         psy10541
Match_columns 152
No_of_seqs    126 out of 1021
Neff          6.5 
Searched_HMMs 46136
Date          Fri Aug 16 21:04:01 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10541.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10541hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1600|consensus              100.0 1.5E-56 3.3E-61  369.6   8.0  145    1-146   116-260 (321)
  2 PLN02220 delta-9 acyl-lipid de 100.0 1.9E-47 4.1E-52  317.4   2.5  139    1-148   105-243 (299)
  3 COG1398 OLE1 Fatty-acid desatu 100.0 2.5E-44 5.4E-49  292.3   4.5  141    1-148    95-236 (289)
  4 cd03505 Delta9-FADS-like The D 100.0 2.2E-35 4.7E-40  229.5  -0.0   85    1-148    52-136 (178)
  5 PF00487 FA_desaturase:  Fatty   98.1 4.6E-06   1E-10   64.5   4.8   27    2-28     53-80  (257)
  6 cd03506 Delta6-FADS-like The D  95.6  0.0029 6.3E-08   49.6  -0.3   29    2-30     47-76  (204)
  7 cd01060 Membrane-FADS-like The  94.8  0.0082 1.8E-07   42.3   0.1   25    2-26     48-73  (122)
  8 cd03513 CrtW_beta-carotene-ket  94.7   0.026 5.7E-07   45.5   2.9   22    4-25     83-104 (225)
  9 cd03512 Alkane-hydroxylase Alk  93.6   0.086 1.9E-06   44.4   3.8   28    7-34    120-148 (314)
 10 cd03510 Rhizobitoxine-FADS-lik  86.0     0.2 4.3E-06   38.6  -0.3   24    3-26     70-93  (175)
 11 cd03511 Rhizopine-oxygenase-li  85.1    0.27 5.8E-06   40.3  -0.0   24    2-25     91-115 (285)
 12 cd03514 CrtR_beta-carotene-hyd  80.2    0.44 9.6E-06   37.6  -0.5   25    2-26     71-96  (207)
 13 PLN03199 delta6-acyl-lipid des  73.9     1.1 2.5E-05   39.9   0.2   18    2-19    209-226 (485)
 14 PLN03198 delta6-acyl-lipid des  61.8     2.7 5.8E-05   38.0   0.1   20    2-21    284-303 (526)
 15 cd03507 Delta12-FADS-like The   60.3     2.5 5.5E-05   33.6  -0.3   23    3-25     81-104 (222)
 16 cd03508 Delta4-sphingolipid-FA  59.7     3.4 7.4E-05   34.5   0.4   22    5-26     96-118 (289)
 17 cd03509 DesA_FADS-like Fatty a  54.3       4 8.6E-05   34.0  -0.1   23    4-26     75-100 (288)
 18 PLN02505 omega-6 fatty acid de  51.5     4.5 9.9E-05   35.1  -0.2   22    2-23    133-155 (381)
 19 PLN02498 omega-3 fatty acid de  49.7     5.1 0.00011   35.7  -0.2   22    3-24    198-220 (450)
 20 PLN02598 omega-6 fatty acid de  46.8     6.7 0.00015   34.6   0.1   20    4-23    174-194 (421)
 21 COG3239 DesA Fatty acid desatu  44.1     8.8 0.00019   32.7   0.4   23    3-25    112-134 (343)
 22 COG3080 FrdD Fumarate reductas  44.0       5 0.00011   29.2  -0.9   14    6-19     76-89  (118)
 23 PLN02579 sphingolipid delta-4   41.1     9.6 0.00021   32.4   0.2   23    4-26    124-147 (323)
 24 PF12475 Amdo_NSP:  Amdovirus n  40.6      22 0.00049   22.0   1.7   26   16-46      1-26  (48)
 25 KOG4232|consensus               31.7      72  0.0016   28.4   4.1   25    1-25    190-215 (430)
 26 PRK05470 fumarate reductase su  28.8      11 0.00025   27.6  -1.1   13    6-18     76-88  (118)
 27 PF13045 DUF3905:  Protein of u  25.4      43 0.00092   22.9   1.3   25  116-140    29-53  (84)
 28 cd00547 QFR_TypeD_subunitD Qui  24.6      16 0.00034   26.7  -1.0   13    6-18     72-84  (115)

No 1  
>KOG1600|consensus
Probab=100.00  E-value=1.5e-56  Score=369.64  Aligned_cols=145  Identities=48%  Similarity=0.811  Sum_probs=140.1

Q ss_pred             CCcccccccccccccCCCCCCCCCcccccchhhhhhhhhccCCHHHHHhhccCCcccccCCCeEEEehhhHHHHHHHHHH
Q psy10541          1 NSLYDWVRDHRVHHKFSDTDADPHNAQRGFFFSHIGWLMQKKSKAVIEKGRQLDLSDLFEDPLVVVFQKYYIYIRFVMCF   80 (152)
Q Consensus         1 ~s~~~Wv~~HR~HH~~sDt~~DPhsp~rGf~~sH~gWll~~~~~~~~~~~~~~~~~Dl~~dp~~~~~~r~y~~~~~~~~~   80 (152)
                      |+|++||++||.||||||||+|||||+||||||||||++++++|++++++++.|++||++||++|||+|+|.++.++++|
T Consensus       116 g~~~~WvrdHR~HHk~tdTD~DPhn~~rGF~FsHvgWl~~~k~p~~k~~G~~~dvsDL~~dp~v~Fq~k~y~~l~~~~~f  195 (321)
T KOG1600|consen  116 GDIIDWVRDHRVHHKFTDTDADPHNPRRGFWFSHVGWLLDKKHPQVKECGGRLDVSDLEADPVVRFQRKTYLLLMLFFCF  195 (321)
T ss_pred             CChhHHHhhhhhhccccccCCCCCCcccchhhhhhhhHhccCChHHHhhcCcCChhHhhhCceeeehhhhHHHHHHHHHH
Confidence            78999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhhhhchheecchhhHHHHHHHHHHHHHhhhcceeeccceeeccCCCCCCCCCCcCCceeeeecc
Q psy10541         81 FLPAYINTVWLGEDWWISFITMDFIRYVANLNFTFLVNSAAHMYGYKPYDTCRGRRPRRVWSDSRS  146 (152)
Q Consensus        81 ~lp~~i~~~~wg~~~~~~~~~~~~~R~~l~~h~t~~VNSl~H~~G~r~y~~~d~s~nn~~~~~~~~  146 (152)
                      ++|+++|+++||++...+++.+ ++|.++++|+||||||+||+||.|||+++++|+||++++++|-
T Consensus       196 ~lp~~~p~~~~~~~~~~~~~~~-~~r~~~~lh~TwlVNSaaH~~G~rp~d~~~~s~nn~~~s~~t~  260 (321)
T KOG1600|consen  196 LLPTLGPMYFWGEGMGLAFYVG-LFRYCIVLHATWLVNSAAHIWGSRPYDTNDTSRNNWWVSILTF  260 (321)
T ss_pred             HHHHhCcceeeeecchhhhhHH-HHHHHHHHhhHHhhhhHHHHeecccCCCCCCcccceEEEEEEe
Confidence            9999999999999876677767 9999999999999999999999999999999999999999974


No 2  
>PLN02220 delta-9 acyl-lipid desaturase
Probab=100.00  E-value=1.9e-47  Score=317.36  Aligned_cols=139  Identities=25%  Similarity=0.369  Sum_probs=120.7

Q ss_pred             CCcccccccccccccCCCCCCCCCcccccchhhhhhhhhccCCHHHHHhhccCCcccccCCCeEEEehhhHHHHHHHHHH
Q psy10541          1 NSLYDWVRDHRVHHKFSDTDADPHNAQRGFFFSHIGWLMQKKSKAVIEKGRQLDLSDLFEDPLVVVFQKYYIYIRFVMCF   80 (152)
Q Consensus         1 ~s~~~Wv~~HR~HH~~sDt~~DPhsp~rGf~~sH~gWll~~~~~~~~~~~~~~~~~Dl~~dp~~~~~~r~y~~~~~~~~~   80 (152)
                      |||++||++||+||+|||||+|||||+||||||||||++.++.. .+++.++.+++||++||+++||+|+|...++++++
T Consensus       105 gs~~~Wv~~HR~HH~~sDt~~DPHsp~~Gfw~sH~gWl~~~~~~-~~~~~~~~~~~Dl~~d~~~~~~~~~~~~~~l~~~~  183 (299)
T PLN02220        105 GDPIDWVSTHRFHHQFTDSDRDPHSPIEGFWFSHVLWIFDTSYI-REKCGGRDNVMDLKQQWFYRFLRKTIGLHILMFWT  183 (299)
T ss_pred             CCHHHHHHHHHHHHHhcCCCCCccccccCcHHHHhHhhcCcchh-hhhcccccchHHHHhCcchHHHHHHHHHHHHHHHH
Confidence            68999999999999999999999999999999999999987543 33445677899999999999999988766544444


Q ss_pred             HhhhhhchheecchhhHHHHHHHHHHHHHhhhcceeeccceeeccCCCCCCCCCCcCCceeeeecccc
Q psy10541         81 FLPAYINTVWLGEDWWISFITMDFIRYVANLNFTFLVNSAAHMYGYKPYDTCRGRRPRRVWSDSRSSQ  148 (152)
Q Consensus        81 ~lp~~i~~~~wg~~~~~~~~~~~~~R~~l~~h~t~~VNSl~H~~G~r~y~~~d~s~nn~~~~~~~~~~  148 (152)
                      ++      +++|+  ..+++|++++|+++++|+||+|||+||+||+|||+++|+||||++++++|-.+
T Consensus       184 ~~------~~~gg--~~~~~wg~~~r~~~~~h~tw~VNS~~H~~G~rpy~~~d~srN~~~lallt~GE  243 (299)
T PLN02220        184 LL------YLWGG--LPYLTWGVGVGGAIGYHVTWLINSACHIWGSRTWKTKDTSRNVWWLSLFTMGE  243 (299)
T ss_pred             HH------HHHhH--HHHHHHHHHHHHHHHHhhhhccchhhhcccCCCCCCCCCcchhHHHHHHhccc
Confidence            33      35665  36788999999999999999999999999999999999999999999998644


No 3  
>COG1398 OLE1 Fatty-acid desaturase [Lipid metabolism]
Probab=100.00  E-value=2.5e-44  Score=292.25  Aligned_cols=141  Identities=29%  Similarity=0.447  Sum_probs=125.0

Q ss_pred             CCcccccccccccccCCCCCCCCCc-ccccchhhhhhhhhccCCHHHHHhhccCCcccccCCCeEEEehhhHHHHHHHHH
Q psy10541          1 NSLYDWVRDHRVHHKFSDTDADPHN-AQRGFFFSHIGWLMQKKSKAVIEKGRQLDLSDLFEDPLVVVFQKYYIYIRFVMC   79 (152)
Q Consensus         1 ~s~~~Wv~~HR~HH~~sDt~~DPhs-p~rGf~~sH~gWll~~~~~~~~~~~~~~~~~Dl~~dp~~~~~~r~y~~~~~~~~   79 (152)
                      |++++|+++||+||+||||++|||+ .+||||||||||++..+. +   +....+..|+.+|..++||+|++...++++.
T Consensus        95 G~~~~W~~~HR~HHr~tDTd~DPh~~~~kGfw~shigWm~~~~~-~---~~~r~~~~~~~kd~~~~~~~r~~~~~~~l~~  170 (289)
T COG1398          95 GPAIEWVGIHRKHHRKTDTDQDPHYDSFKGFWWSHIGWMLLYSA-E---AKDRETIQKLGKDIPLDWQHRNLYLIALLMQ  170 (289)
T ss_pred             CCceeHHHHHHHhhcccCCCCCCCccccccchhhhcceeeecch-h---hcChhHHHHhCCCchhhHHHHHHHHHHHHHH
Confidence            6899999999999999999999954 569999999999998764 2   2223467799999999999999999999999


Q ss_pred             HHhhhhhchheecchhhHHHHHHHHHHHHHhhhcceeeccceeeccCCCCCCCCCCcCCceeeeecccc
Q psy10541         80 FFLPAYINTVWLGEDWWISFITMDFIRYVANLNFTFLVNSAAHMYGYKPYDTCRGRRPRRVWSDSRSSQ  148 (152)
Q Consensus        80 ~~lp~~i~~~~wg~~~~~~~~~~~~~R~~l~~h~t~~VNSl~H~~G~r~y~~~d~s~nn~~~~~~~~~~  148 (152)
                      +++|.++++ ++|+.  .+++|++++|+++++|+||||||+||.+||||||.+|+|||+++|+|+|--+
T Consensus       171 i~~~l~~~~-~~gg~--~gl~~~gv~r~~~~~hat~~VNsl~H~~Gyr~fd~~d~arN~ww~al~t~GE  236 (289)
T COG1398         171 IVLPLFIGY-ALGGW--LGLIWGGVQRLVLVQHATWCVNSLGHYIGYRPFDCRDTARNCWWVALVTFGE  236 (289)
T ss_pred             HHHHHHHHH-Hhcch--hHHHHHHHHHHHHHHHHHHHHhhhhhhhcccccCCCCCccceeEEEEeeccc
Confidence            999966665 77762  5699999999999999999999999999999999999999999999998654


No 4  
>cd03505 Delta9-FADS-like The Delta9 Fatty Acid Desaturase (Delta9-FADS)-like CD includes the delta-9 and delta-11 acyl CoA desaturases found in various eukaryotes including vertebrates, insects, higher plants, and fungi. The delta-9 acyl-lipid desaturases are found in a wide range of bacteria. These enzymes play essential roles in fatty acid metabolism and the regulation of cell membrane fluidity. Acyl-CoA desaturases are the enzymes involved in the CoA-bound desaturation of fatty acids. Mammalian stearoyl-CoA delta-9 desaturase is a key enzyme in the biosynthesis of monounsaturated fatty acids, and in yeast, the delta-9 acyl-CoA desaturase (OLE1) reaction accounts for all de nova unsaturated fatty acid production in Saccharomyces cerevisiae. These non-heme, iron-containing, ER membrane-bound enzymes are part of a three-component enzyme system involving cytochrome b5, cytochrome b5 reductase, and the delta-9 fatty acid desaturase. This complex catalyzes the NADH- and oxygen-dependent i
Probab=100.00  E-value=2.2e-35  Score=229.47  Aligned_cols=85  Identities=49%  Similarity=0.864  Sum_probs=81.6

Q ss_pred             CCcccccccccccccCCCCCCCCCcccccchhhhhhhhhccCCHHHHHhhccCCcccccCCCeEEEehhhHHHHHHHHHH
Q psy10541          1 NSLYDWVRDHRVHHKFSDTDADPHNAQRGFFFSHIGWLMQKKSKAVIEKGRQLDLSDLFEDPLVVVFQKYYIYIRFVMCF   80 (152)
Q Consensus         1 ~s~~~Wv~~HR~HH~~sDt~~DPhsp~rGf~~sH~gWll~~~~~~~~~~~~~~~~~Dl~~dp~~~~~~r~y~~~~~~~~~   80 (152)
                      +||++||++||+||++||||+|||||+||||||||||+                                          
T Consensus        52 gs~~~W~~~HR~HH~~sDt~~DPhs~~~gf~~~h~gW~------------------------------------------   89 (178)
T cd03505          52 GSPLWWVADHRLHHRYSDTDGDPHSPKRGFWFSHVGWL------------------------------------------   89 (178)
T ss_pred             cCHHHHHHHHHHhhcccCCCCCCCCcccCcHHHHHhhH------------------------------------------
Confidence            68999999999999999999999999999999999999                                          


Q ss_pred             HhhhhhchheecchhhHHHHHHHHHHHHHhhhcceeeccceeeccCCCCCCCCCCcCCceeeeecccc
Q psy10541         81 FLPAYINTVWLGEDWWISFITMDFIRYVANLNFTFLVNSAAHMYGYKPYDTCRGRRPRRVWSDSRSSQ  148 (152)
Q Consensus        81 ~lp~~i~~~~wg~~~~~~~~~~~~~R~~l~~h~t~~VNSl~H~~G~r~y~~~d~s~nn~~~~~~~~~~  148 (152)
                                           ++++|+++++|+||+|||+||++|+|||+++|+|+||++++++|-.+
T Consensus        90 ---------------------~~~~r~~~~~h~t~~VNs~~H~~G~r~~~~~~~s~n~~~~~llt~GE  136 (178)
T cd03505          90 ---------------------GGLLRIVLVLHATWLVNSLAHMWGYRPYDTRDTSRNNWWVALLTFGE  136 (178)
T ss_pred             ---------------------HHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCCchhhHHHHHHHccc
Confidence                                 67899999999999999999999999999999999999999998654


No 5  
>PF00487 FA_desaturase:  Fatty acid desaturase This entry is only a subset of the Pfam family.;  InterPro: IPR005804  Fatty acid desaturases are enzymes that catalyse the insertion of a double bond at the delta position of fatty acids. There seem to be two distinct families of fatty acid desaturases which do not seem to be evolutionary related. Family 1 is composed of:  Stearoyl-CoA desaturase (SCD) (1.14.19.1 from EC) [].    Family 2 is composed of:  Bacterial fatty acid desaturases. Plant stearoyl-acyl-carrier-protein desaturase (1.14.19.1 from EC) [], this enzyme catalyzes the introduction of a double bond at the delta(9) position of steraoyl-ACP to produce oleoyl-ACP. This enzyme is responsible for the conversion of saturated fatty acids to unsaturated fatty acids in the synthesis of vegetable oils. Cyanobacterial DesA [], an enzyme that can introduce a second cis double bond at the delta(12) position of fatty acid bound to membranes glycerolipids. DesA is involved in chilling tolerance; the phase transition temperature of lipids of cellular membranes being dependent on the degree of unsaturation of fatty acids of the membrane lipids.  This entry contains fatty acid desaturases belonging to Family 1. ; GO: 0006629 lipid metabolic process
Probab=98.09  E-value=4.6e-06  Score=64.47  Aligned_cols=27  Identities=26%  Similarity=0.608  Sum_probs=23.7

Q ss_pred             CcccccccccccccCCCCCC-CCCcccc
Q psy10541          2 SLYDWVRDHRVHHKFSDTDA-DPHNAQR   28 (152)
Q Consensus         2 s~~~Wv~~HR~HH~~sDt~~-DPhsp~r   28 (152)
                      +...|...|++||+++++++ ||.++..
T Consensus        53 ~~~~wr~~H~~HH~~~~~~~~Dpd~~~~   80 (257)
T PF00487_consen   53 PYSSWRISHNRHHHYTNNPDRDPDSWTR   80 (257)
T ss_pred             CHhHhheeeeccccccCCccccCccchh
Confidence            56679999999999999988 9999865


No 6  
>cd03506 Delta6-FADS-like The Delta6 Fatty Acid Desaturase (Delta6-FADS)-like CD includes the integral-membrane enzymes: delta-4, delta-5, delta-6, delta-8, delta-8-sphingolipid, and delta-11 desaturases found in vertebrates, higher plants, fungi, and bacteria. These desaturases are required for the synthesis of highly unsaturated fatty acids (HUFAs), which are mainly esterified into phospholipids and contribute to maintaining membrane fluidity. While HUFAs may be required for cold tolerance in bacteria, plants and fish, the primary role of HUFAs in mammals is cell signaling. These enzymes are described as front-end desaturases because they introduce a double bond between the pre-exiting double bond and the carboxyl (front) end of the fatty acid. Various substrates are involved, with both acyl-coenzyme A (CoA) and acyl-lipid desaturases present in this CD. Acyl-lipid desaturases are localized in the membranes of cyanobacterial thylakoid, plant endoplasmic reticulum (ER), and plastid; an
Probab=95.60  E-value=0.0029  Score=49.58  Aligned_cols=29  Identities=28%  Similarity=0.480  Sum_probs=23.5

Q ss_pred             CcccccccccccccCCCC-CCCCCcccccc
Q psy10541          2 SLYDWVRDHRVHHKFSDT-DADPHNAQRGF   30 (152)
Q Consensus         2 s~~~Wv~~HR~HH~~sDt-~~DPhsp~rGf   30 (152)
                      |..+|-..|..||++++. ++||--.....
T Consensus        47 s~~~w~~~H~~HH~~tn~~~~Dpd~~~~~~   76 (204)
T cd03506          47 SAGWWKNKHNVHHAYTNILGHDPDIDTLPL   76 (204)
T ss_pred             CHHHHHHHHhhhcCcCCCCCCCCCCCcCce
Confidence            667899999999999985 69998765443


No 7  
>cd01060 Membrane-FADS-like The membrane fatty acid desaturase (Membrane_FADS)-like CD includes membrane FADSs, alkane hydroxylases, beta carotene ketolases (CrtW-like), hydroxylases (CrtR-like), and other related proteins. They are present in all groups of organisms with the exception of archaea. Membrane FADSs are non-heme, iron-containing, oxygen-dependent enzymes involved in regioselective introduction of double bonds in fatty acyl aliphatic chains. They play an important role in the maintenance of the proper structure and functioning of biological membranes. Alkane hydroxylases are bacterial, integral-membrane di-iron enzymes that share a requirement for iron and oxygen for activity similar to that of membrane FADSs, and are involved in the initial oxidation of inactivated alkanes. Beta-carotene ketolase and beta-carotene hydroxylase are carotenoid biosynthetic enzymes for astaxanthin and zeaxanthin, respectively. This superfamily domain has extensive hydrophobic regions that would
Probab=94.80  E-value=0.0082  Score=42.27  Aligned_cols=25  Identities=44%  Similarity=0.800  Sum_probs=22.9

Q ss_pred             CcccccccccccccCCCCC-CCCCcc
Q psy10541          2 SLYDWVRDHRVHHKFSDTD-ADPHNA   26 (152)
Q Consensus         2 s~~~Wv~~HR~HH~~sDt~-~DPhsp   26 (152)
                      ++..|...|..||++++++ +||.++
T Consensus        48 ~~~~~~~~H~~HH~~~~~~~~D~~~~   73 (122)
T cd01060          48 SYGWWRRSHRRHHRYTNTPGKDPDSA   73 (122)
T ss_pred             CHHHHHHHHHHHhcCcCCCCCCCccc
Confidence            5678999999999999997 999999


No 8  
>cd03513 CrtW_beta-carotene-ketolase Beta-carotene ketolase/oxygenase (CrtW, also known as CrtO), the carotenoid astaxanthin biosynthetic enzyme, initially catalyzes the addition of two keto groups to carbons C4 and C4' of beta-carotene. Carotenoids are important natural pigments produced by many microorganisms and plants. Astaxanthin is reported to be an antioxidant, an anti-cancer agent, and an immune system stimulant. A number of bacteria and green algae can convert beta-carotene into astaxanthin by using several ketocarotenoids as intermediates and CrtW and a beta-carotene hydroxylase (CrtZ). CrtW initially converts beta-carotene to canthaxanthin via echinenone, and CrtZ initially mediates the conversion of beta-carotene to zeaxanthin via beta-cryptoxanthin. After a few more intermediates are formed, CrtW and CrtZ act in combination to produce astaxanthin. Sequences of this domain family appear to be structurally related to membrane fatty acid desaturases and alkane hydroxylases. Th
Probab=94.72  E-value=0.026  Score=45.50  Aligned_cols=22  Identities=32%  Similarity=0.578  Sum_probs=18.1

Q ss_pred             ccccccccccccCCCCCCCCCc
Q psy10541          4 YDWVRDHRVHHKFSDTDADPHN   25 (152)
Q Consensus         4 ~~Wv~~HR~HH~~sDt~~DPhs   25 (152)
                      ..|-+.|..||+++.+++||=-
T Consensus        83 ~~~~~~H~~HH~~~~~~~DpD~  104 (225)
T cd03513          83 DRLLRKHHLHHRHPGTAKDPDF  104 (225)
T ss_pred             HHHHHHHHHHcCCCCCCCCCCC
Confidence            4577899999999998888853


No 9  
>cd03512 Alkane-hydroxylase Alkane hydroxylase is a bacterial, integral-membrane di-iron enzyme that shares a requirement for iron and oxygen for activity similar to that of the non-heme integral-membrane acyl coenzyme A (CoA) desaturases and acyl lipid desaturases. The alk genes in Pseudomonas oleovorans encode conversion of alkanes to acyl CoA. The alkane omega-hydroxylase (AlkB) system is responsible for the initial oxidation of inactivated alkanes. It is a three-component system comprising a soluble NADH-rubredoxin reductase (AlkT), a soluble rubredoxin (AlkG), and the integral membrane oxygenase (AlkB). AlkB utilizes the oxygen rebound mechanism to hydroxylate alkanes. This mechanism involves homolytic cleavage of the C-H bond by an electrophilic metal-oxo intermediate to generate a substrate-based radical. As with other members of this superfamily, this domain family has extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. The active
Probab=93.58  E-value=0.086  Score=44.44  Aligned_cols=28  Identities=36%  Similarity=0.699  Sum_probs=21.7

Q ss_pred             cccccccccCCCCCCCCCcccccc-hhhh
Q psy10541          7 VRDHRVHHKFSDTDADPHNAQRGF-FFSH   34 (152)
Q Consensus         7 v~~HR~HH~~sDt~~DPhsp~rGf-~~sH   34 (152)
                      .+++|.||++..|++||=++.+|= +|+.
T Consensus       120 ~~H~~~HH~~v~tp~DP~tar~ge~~y~f  148 (314)
T cd03512         120 IEHVRGHHRYVATPEDPATARRGESFYRF  148 (314)
T ss_pred             eeecccCCCCCCCCCCccccccCccHHHH
Confidence            455679999999999999997654 4443


No 10 
>cd03510 Rhizobitoxine-FADS-like This CD includes the dihydrorhizobitoxine fatty acid desaturase (RtxC) characterized in Bradyrhizobium japonicum USDA110, and other related proteins. Dihydrorhizobitoxine desaturase is reported to be involved in the final step of rhizobitoxine biosynthesis. This domain family appears to be structurally related to the membrane fatty acid desaturases and the alkane hydroxylases. They all share in common extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. Comparison of sequences also reveals the existence of three regions of conserved histidine cluster motifs that contain eight histidine residues: HXXXH, HXX(X)HH, and HXXHH. These histidine residues are reported to be catalytically essential and proposed to be the ligands for the iron atoms contained within homologs, stearoyl CoA desaturase and alkane hydroxylase.
Probab=86.04  E-value=0.2  Score=38.59  Aligned_cols=24  Identities=38%  Similarity=0.563  Sum_probs=20.4

Q ss_pred             cccccccccccccCCCCCCCCCcc
Q psy10541          3 LYDWVRDHRVHHKFSDTDADPHNA   26 (152)
Q Consensus         3 ~~~Wv~~HR~HH~~sDt~~DPhsp   26 (152)
                      ...|-..|..||+++.+++||--.
T Consensus        70 ~~~~r~~H~~HH~~~~~~~Dpd~~   93 (175)
T cd03510          70 LAAYRRSHLKHHRHLGTEDDPDLA   93 (175)
T ss_pred             HHHHHHHHHHHhCccCCCCCCcHH
Confidence            346778999999999999999876


No 11 
>cd03511 Rhizopine-oxygenase-like This CD includes the putative hydrocarbon oxygenase, MocD, a bacterial rhizopine (3-O-methyl-scyllo-inosamine, 3-O-MSI) oxygenase, and other related proteins. It has been proposed that MocD, MocE (Rieske-like ferredoxin), and MocF (ferredoxin reductase) under the regulation of MocR, act in concert to form a ferredoxin oxygenase system that demethylates 3-O-MSI to form scyllo-inosamine.  This domain family appears to be structurally related to the membrane fatty acid desaturases and the alkane hydroxylases. They all share in common extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. Comparison of sequences also reveals the existence of three regions of conserved histidine cluster motifs that contain eight histidine residues: HXXXH, HXXHH, and HXXHH. These histidine residues are reported to be catalytically essential and proposed to be the ligands for the iron atoms contained within homologs, stearoyl CoA d
Probab=85.06  E-value=0.27  Score=40.31  Aligned_cols=24  Identities=21%  Similarity=0.300  Sum_probs=18.9

Q ss_pred             CcccccccccccccCC-CCCCCCCc
Q psy10541          2 SLYDWVRDHRVHHKFS-DTDADPHN   25 (152)
Q Consensus         2 s~~~Wv~~HR~HH~~s-Dt~~DPhs   25 (152)
                      |...|...|..||+++ |+++||-.
T Consensus        91 ~~~~~~~~H~~HH~~~~~~~~Dpd~  115 (285)
T cd03511          91 PPDFFRWSHARHHRYTQIPGRDPEL  115 (285)
T ss_pred             ChHHHHHHHHHHhcCcCCCCCCCCC
Confidence            4457889999999999 46788854


No 12 
>cd03514 CrtR_beta-carotene-hydroxylase Beta-carotene hydroxylase (CrtR), the carotenoid zeaxanthin biosynthetic enzyme catalyzes the addition of hydroxyl groups to the beta-ionone rings of beta-carotene to form zeaxanthin and is found in bacteria and red algae. Carotenoids are important natural pigments; zeaxanthin and lutein are the only dietary carotenoids that accumulate in the macular region of the retina and lens. It is proposed that these carotenoids protect ocular tissues against photooxidative damage. CrtR does not show overall amino acid sequence similarity to the beta-carotene hydroxylases similar to CrtZ, an astaxanthin biosynthetic beta-carotene hydroxylase. However, CrtR does show sequence similarity to the green alga, Haematococcus pluvialis, beta-carotene ketolase (CrtW), which converts beta-carotene to canthaxanthin. Sequences of the CrtR_beta-carotene-hydroxylase domain family, as well as, the CrtW_beta-carotene-ketolase domain family appear to be structurally related 
Probab=80.21  E-value=0.44  Score=37.60  Aligned_cols=25  Identities=24%  Similarity=0.424  Sum_probs=19.9

Q ss_pred             CcccccccccccccCCCC-CCCCCcc
Q psy10541          2 SLYDWVRDHRVHHKFSDT-DADPHNA   26 (152)
Q Consensus         2 s~~~Wv~~HR~HH~~sDt-~~DPhsp   26 (152)
                      |...|...|..||+++.+ ++||-..
T Consensus        71 ~~~~w~~~H~~HH~~~~~~~~DpD~~   96 (207)
T cd03514          71 PFPVFRRVHMQHHAHTNDPEKDPDHF   96 (207)
T ss_pred             CHHHHHHHHHHHhcCcCcCCcCccHH
Confidence            445788999999999987 4888654


No 13 
>PLN03199 delta6-acyl-lipid desaturase-like protein; Provisional
Probab=73.88  E-value=1.1  Score=39.85  Aligned_cols=18  Identities=28%  Similarity=0.508  Sum_probs=16.2

Q ss_pred             CcccccccccccccCCCC
Q psy10541          2 SLYDWVRDHRVHHKFSDT   19 (152)
Q Consensus         2 s~~~Wv~~HR~HH~~sDt   19 (152)
                      |..+|-..|-.||.++..
T Consensus       209 S~~wW~~~Hn~HH~~tN~  226 (485)
T PLN03199        209 SMQWWKNKHNGHHAVPNL  226 (485)
T ss_pred             ChHHHHHHHhhhhcCcCc
Confidence            667999999999999984


No 14 
>PLN03198 delta6-acyl-lipid desaturase; Provisional
Probab=61.77  E-value=2.7  Score=38.03  Aligned_cols=20  Identities=25%  Similarity=0.360  Sum_probs=17.2

Q ss_pred             CcccccccccccccCCCCCC
Q psy10541          2 SLYDWVRDHRVHHKFSDTDA   21 (152)
Q Consensus         2 s~~~Wv~~HR~HH~~sDt~~   21 (152)
                      |..+|-..|..||.++...+
T Consensus       284 s~~~W~~~Hn~HH~~tN~~~  303 (526)
T PLN03198        284 STGWWKEKHNLHHAAPNECD  303 (526)
T ss_pred             CHHHHHHHHHHhccCCCCCC
Confidence            56799999999999998753


No 15 
>cd03507 Delta12-FADS-like The Delta12 Fatty Acid Desaturase (Delta12-FADS)-like CD includes the integral-membrane enzymes, delta-12 acyl-lipid desaturases, oleate 12-hydroxylases, omega3 and omega6 fatty acid desaturases, and other related proteins, found in a wide range of organisms including higher plants, green algae, diatoms, nematodes, fungi, and bacteria. The expression of these proteins appears to be temperature dependent: decreases in temperature result in increased levels of fatty acid desaturation within membrane lipids subsequently altering cell membrane fluidity. An important enzyme for the production of polyunsaturates in plants is the oleate delta-12 desaturase (Arabidopsis FAD2) of the endoplasmic reticulum. This enzyme accepts l-acyl-2-oleoyl-sn-glycero-3-phosphocholine as substrate and requires NADH:cytochrome b oxidoreductase, cytochrome b, and oxygen for activity. FAD2 converts oleate(18:1) to linoleate (18:2) and is closely related to oleate 12-hydroxylase which cat
Probab=60.35  E-value=2.5  Score=33.59  Aligned_cols=23  Identities=22%  Similarity=0.411  Sum_probs=18.2

Q ss_pred             cccccccccccccCCCC-CCCCCc
Q psy10541          3 LYDWVRDHRVHHKFSDT-DADPHN   25 (152)
Q Consensus         3 ~~~Wv~~HR~HH~~sDt-~~DPhs   25 (152)
                      .-.|...|.+||+++.. ++||-.
T Consensus        81 ~~~w~~~H~~HH~~~~~~~~D~~~  104 (222)
T cd03507          81 YHSWRISHNRHHAHTGNLEGDEVW  104 (222)
T ss_pred             hHHHHHHHHHHHhccCCCCCCCcc
Confidence            35688999999999875 777654


No 16 
>cd03508 Delta4-sphingolipid-FADS-like The Delta4-sphingolipid Fatty Acid Desaturase (Delta4-sphingolipid-FADS)-like CD includes the integral-membrane enzymes, dihydroceramide Delta-4 desaturase, involved in the synthesis of sphingosine; and the human membrane fatty acid (lipid) desaturase (MLD), reported to modulate biosynthesis of the epidermal growth factor receptor; and other related proteins. These proteins are found in various eukaryotes including vertebrates, higher plants, and fungi. Studies show that MLD is localized to the endoplasmic reticulum. As with other members of this superfamily, this domain family has extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. Comparison of sequences also reveals the existence of three regions of conserved histidine cluster motifs that contain eight histidine residues: HXXXH, HXXHH, and HXXHH. These histidine residues are reported to be catalytically essential and proposed to be the ligands for
Probab=59.73  E-value=3.4  Score=34.46  Aligned_cols=22  Identities=23%  Similarity=0.427  Sum_probs=16.8

Q ss_pred             cccccccccccCCCCC-CCCCcc
Q psy10541          5 DWVRDHRVHHKFSDTD-ADPHNA   26 (152)
Q Consensus         5 ~Wv~~HR~HH~~sDt~-~DPhsp   26 (152)
                      .|-..|..||+++.++ +||=-+
T Consensus        96 ~~r~~H~~HH~~~n~~~~DpDi~  118 (289)
T cd03508          96 SFKKYHLEHHRYLGEDGLDTDIP  118 (289)
T ss_pred             HHHHHHHHhccCCCCCCCCCCcc
Confidence            4788999999999754 477544


No 17 
>cd03509 DesA_FADS-like Fatty acid desaturase protein family subgroup, a delta-12 acyl-lipid desaturase-like, DesA-like, yet uncharacterized subgroup of membrane fatty acid desaturase proteins found in alpha-, beta-, and gamma-proteobacteria. Sequences of this domain family appear to be structurally related to membrane fatty acid desaturases and alkane hydroxylases. They all share in common extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. Comparison of these sequences also reveals three regions of conserved histidine cluster motifs that contain eight histidine residues: HXXXH, HXXHH, and HXXHH. These histidine residues are reported to be catalytically essential and proposed to be the ligands for the iron atoms contained within homologs, stearoyl CoA desaturase and alkane hydroxylase.
Probab=54.31  E-value=4  Score=33.96  Aligned_cols=23  Identities=26%  Similarity=0.462  Sum_probs=17.8

Q ss_pred             ccccccccccccCCC---CCCCCCcc
Q psy10541          4 YDWVRDHRVHHKFSD---TDADPHNA   26 (152)
Q Consensus         4 ~~Wv~~HR~HH~~sD---t~~DPhsp   26 (152)
                      ..|-..|-.||++++   .+.||-+.
T Consensus        75 ~~wr~~H~~HH~~~nl~~~~~Dpd~~  100 (288)
T cd03509          75 TRYRDTHLAHHRDEDLTDPGDDPESN  100 (288)
T ss_pred             HHHHHHHHHHcCCCCCCCCCCCCccc
Confidence            468889999999985   35788654


No 18 
>PLN02505 omega-6 fatty acid desaturase
Probab=51.46  E-value=4.5  Score=35.15  Aligned_cols=22  Identities=27%  Similarity=0.672  Sum_probs=17.7

Q ss_pred             CcccccccccccccCCCC-CCCC
Q psy10541          2 SLYDWVRDHRVHHKFSDT-DADP   23 (152)
Q Consensus         2 s~~~Wv~~HR~HH~~sDt-~~DP   23 (152)
                      +...|-..|+.||+++.. ++||
T Consensus       133 p~~~Wr~~H~~HH~~tn~~~~D~  155 (381)
T PLN02505        133 PYFSWKYSHRRHHSNTGSLERDE  155 (381)
T ss_pred             CHHHHHHHHHHHhhccCCCCCCc
Confidence            345789999999999974 7776


No 19 
>PLN02498 omega-3 fatty acid desaturase
Probab=49.69  E-value=5.1  Score=35.68  Aligned_cols=22  Identities=27%  Similarity=0.540  Sum_probs=17.5

Q ss_pred             cccccccccccccCCC-CCCCCC
Q psy10541          3 LYDWVRDHRVHHKFSD-TDADPH   24 (152)
Q Consensus         3 ~~~Wv~~HR~HH~~sD-t~~DPh   24 (152)
                      .-.|-..|+.||+++. .|+||-
T Consensus       198 y~~Wr~sH~~HH~~Tn~~e~D~~  220 (450)
T PLN02498        198 YHGWRISHRTHHQNHGHVENDES  220 (450)
T ss_pred             HHHHHHHHHHHhcCCCCCCCCCC
Confidence            3568899999999997 477764


No 20 
>PLN02598 omega-6 fatty acid desaturase
Probab=46.81  E-value=6.7  Score=34.56  Aligned_cols=20  Identities=25%  Similarity=0.473  Sum_probs=16.8

Q ss_pred             ccccccccccccCCC-CCCCC
Q psy10541          4 YDWVRDHRVHHKFSD-TDADP   23 (152)
Q Consensus         4 ~~Wv~~HR~HH~~sD-t~~DP   23 (152)
                      -.|-..|+.||+++. .++||
T Consensus       174 ~~wr~~H~~HH~~tn~~~~D~  194 (421)
T PLN02598        174 EPWRIKHNTHHAHTNKLVMDT  194 (421)
T ss_pred             HHHHHHHHHHccCcCCCCCCC
Confidence            468889999999997 57885


No 21 
>COG3239 DesA Fatty acid desaturase [Lipid metabolism]
Probab=44.11  E-value=8.8  Score=32.68  Aligned_cols=23  Identities=22%  Similarity=0.310  Sum_probs=18.1

Q ss_pred             cccccccccccccCCCCCCCCCc
Q psy10541          3 LYDWVRDHRVHHKFSDTDADPHN   25 (152)
Q Consensus         3 ~~~Wv~~HR~HH~~sDt~~DPhs   25 (152)
                      +..|=..|..||+++.+++||..
T Consensus       112 ~~~wR~~H~~HH~~t~~~~~d~~  134 (343)
T COG3239         112 PVFWRISHNQHHAHTNILDDDPE  134 (343)
T ss_pred             hhhhhhhHHHhhcccCCCCCCHH
Confidence            34566679999999998888843


No 22 
>COG3080 FrdD Fumarate reductase subunit D [Energy production and conversion]
Probab=43.97  E-value=5  Score=29.16  Aligned_cols=14  Identities=43%  Similarity=0.930  Sum_probs=11.8

Q ss_pred             ccccccccccCCCC
Q psy10541          6 WVRDHRVHHKFSDT   19 (152)
Q Consensus         6 Wv~~HR~HH~~sDt   19 (152)
                      |.+.||.||.--|-
T Consensus        76 w~a~HRihHgmhdl   89 (118)
T COG3080          76 WCALHRIHHGMHDL   89 (118)
T ss_pred             HHHHHHHHhhhhhe
Confidence            88999999987764


No 23 
>PLN02579 sphingolipid delta-4 desaturase
Probab=41.06  E-value=9.6  Score=32.38  Aligned_cols=23  Identities=22%  Similarity=0.353  Sum_probs=17.9

Q ss_pred             ccccccccccccCCC-CCCCCCcc
Q psy10541          4 YDWVRDHRVHHKFSD-TDADPHNA   26 (152)
Q Consensus         4 ~~Wv~~HR~HH~~sD-t~~DPhsp   26 (152)
                      .+|-+.|..||+++. .+.||--|
T Consensus       124 ~~~~~~H~~HH~~~n~~~~D~Di~  147 (323)
T PLN02579        124 VTFQKYHLEHHRFQGVDGIDMDIP  147 (323)
T ss_pred             HHHHHHHHHHccCCCCCCCCCCCC
Confidence            368889999999996 35577765


No 24 
>PF12475 Amdo_NSP:  Amdovirus non-structural protein ;  InterPro: IPR020960  This domain family is found in viruses, and is approximately 50 amino acids in length. This family contains proteins of each of the three types of Amdovirus non-structural protein []. 
Probab=40.55  E-value=22  Score=21.97  Aligned_cols=26  Identities=27%  Similarity=0.884  Sum_probs=20.2

Q ss_pred             CCCCCCCCCcccccchhhhhhhhhccCCHHH
Q psy10541         16 FSDTDADPHNAQRGFFFSHIGWLMQKKSKAV   46 (152)
Q Consensus        16 ~sDt~~DPhsp~rGf~~sH~gWll~~~~~~~   46 (152)
                      |+|.+.||--...-+     ||++.+.+.+.
T Consensus         1 Y~Dkd~dPkd~t~sL-----~w~~k~~n~DL   26 (48)
T PF12475_consen    1 YTDKDNDPKDVTKSL-----GWFLKTTNKDL   26 (48)
T ss_pred             CCCCCCCccccccch-----HHHHHHhhHHH
Confidence            789999999887665     99987665543


No 25 
>KOG4232|consensus
Probab=31.67  E-value=72  Score=28.37  Aligned_cols=25  Identities=32%  Similarity=0.476  Sum_probs=20.5

Q ss_pred             CCcccccccccccccCCCC-CCCCCc
Q psy10541          1 NSLYDWVRDHRVHHKFSDT-DADPHN   25 (152)
Q Consensus         1 ~s~~~Wv~~HR~HH~~sDt-~~DPhs   25 (152)
                      .|+-||...|-.||.++.. ++||=.
T Consensus       190 ~sa~WW~~~H~~HHa~pN~~~~DpDi  215 (430)
T KOG4232|consen  190 FSAAWWKSHHNQHHAAPNSLDKDPDI  215 (430)
T ss_pred             ccHHHHHHHHhhhhccCccCCCCccc
Confidence            3677999999999999985 667654


No 26 
>PRK05470 fumarate reductase subunit D; Provisional
Probab=28.82  E-value=11  Score=27.57  Aligned_cols=13  Identities=46%  Similarity=1.025  Sum_probs=10.5

Q ss_pred             ccccccccccCCC
Q psy10541          6 WVRDHRVHHKFSD   18 (152)
Q Consensus         6 Wv~~HR~HH~~sD   18 (152)
                      |.+.||.||--=|
T Consensus        76 Wh~~HRihHglHD   88 (118)
T PRK05470         76 WCGLHRIHHGMHD   88 (118)
T ss_pred             HHHHHHHHHHHhc
Confidence            8888999987655


No 27 
>PF13045 DUF3905:  Protein of unknown function (DUF3905)
Probab=25.43  E-value=43  Score=22.93  Aligned_cols=25  Identities=20%  Similarity=0.201  Sum_probs=22.5

Q ss_pred             eeccceeeccCCCCCCCCCCcCCce
Q psy10541        116 LVNSAAHMYGYKPYDTCRGRRPRRV  140 (152)
Q Consensus       116 ~VNSl~H~~G~r~y~~~d~s~nn~~  140 (152)
                      +||+.+=+.|..-|++.+++-|+|-
T Consensus        29 FvN~~GVvIGDs~Y~S~~SPL~~WS   53 (84)
T PF13045_consen   29 FVNSFGVVIGDSDYNSPNSPLENWS   53 (84)
T ss_pred             cccccCeEecccccCCCCCchhhcc
Confidence            6899999999999999999988864


No 28 
>cd00547 QFR_TypeD_subunitD Quinol:fumarate reductase (QFR) Type D subfamily, 13kD hydrophobic subunit D; QFR couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, the opposite reaction to that catalyzed by the related protein, succinate:quinine oxidoreductase (SQR). QFRs oxidize low potential quinols such as menaquinol and are involved in anaerobic respiration with fumarate as the terminal electron acceptor. SQR and QFR share a common subunit arrangement, composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Members of this subfamily are classified as Type D as they contain two transmembrane subunits (C and D) and no heme groups.  The structural arrangement allows efficient electron transfer between the catalytic subunit, through iron-sulfur centers, and the transmembrane subunit containing the electron donor (quinol). The quinone binding site resides in the transmembrane subunits.
Probab=24.58  E-value=16  Score=26.75  Aligned_cols=13  Identities=46%  Similarity=1.020  Sum_probs=10.7

Q ss_pred             ccccccccccCCC
Q psy10541          6 WVRDHRVHHKFSD   18 (152)
Q Consensus         6 Wv~~HR~HH~~sD   18 (152)
                      |.+.||.||--=|
T Consensus        72 Wh~~HRihh~lHD   84 (115)
T cd00547          72 WHAMHRIHHGLHD   84 (115)
T ss_pred             HHHHHHHHHhhhc
Confidence            8888999987666


Done!