Diaphorina citri psyllid: psy10541

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
NSLYDWVRDHRVHHKFSDTDADPHNAQRGFFFSHIGWLMQKKSKAVIEKGRQLDLSDLFEDPLVVVFQKYYIYIRFVMCFFLPAYINTVWLGEDWWISFITMDFIRYVANLNFTFLVNSAAHMYGYKPYDTCRGRRPRRVWSDSRSSQTMDT
cccccccHHHHccccccccccccccccccHHHHHHHHccccccHHHHHHccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHcccccc
NSLYDWVRDHRVHHKFSDTDADPHNAQRGFFFSHIGWLMQKKSKAVIEKGRQLDLSDLFEDPLVVVFQKYYIYIRFVMCFFLPAYINTVWLGEDWWISFITMDFIRYVANLNFTFLVNSAAHMYGYKPYDTCRGRRPR**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NSLYDWVRDHRVHHKFSDTDADPHNAQRGFFFSHIGWLMQKKSKAVIEKGRQLDLSDLFEDPLVVVFQKYYIYIRFVMCFFLPAYINTVWLGEDWWISFITMDFIRYVANLNFTFLVNSAAHMYGYKPYDTCRGRRPRRVWSDSRSSQTMDT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Stearoyl-CoA desaturase 5 Fatty acid delta(9)-desaturase that introduces a double bond in fatty acyl-coenzyme A at the delta 9 position.confidentQ2KIA4
Acyl-CoA desaturase 2 Terminal component of the liver microsomal stearyl-CoA desaturase system, that utilizes O(2) and electrons from reduced cytochrome b5 to catalyze the insertion of a double bond into a spectrum of fatty acyl-CoA substrates including palmitoyl-CoA and stearoyl-CoA.confidentQ6P7B9
Stearoyl-CoA desaturase 5 Fatty acid delta-9-desaturase that introduces a double bond in fatty acyl-coenzyme A at the delta-9 position.confidentQ86SK9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0050872 [BP]white fat cell differentiationprobableGO:0032502, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0044763, GO:0045444, GO:0044699
GO:0050873 [BP]brown fat cell differentiationprobableGO:0032502, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0044763, GO:0045444, GO:0044699
GO:0006633 [BP]fatty acid biosynthetic processprobableGO:0006631, GO:0019752, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0016053, GO:0044237
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0004768 [MF]stearoyl-CoA 9-desaturase activityprobableGO:0016215, GO:0016717, GO:0016705, GO:0003824, GO:0003674, GO:0016491
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!