Query         psy10560
Match_columns 74
No_of_seqs    148 out of 1028
Neff          7.0 
Searched_HMMs 46136
Date          Fri Aug 16 21:32:31 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10560.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10560hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1225|consensus               99.3 3.8E-12 8.2E-17   94.9   6.1   67    2-72    273-346 (525)
  2 KOG1225|consensus               99.1 2.8E-10 6.1E-15   85.0   5.9   67    2-72    242-315 (525)
  3 KOG1226|consensus               98.7 2.1E-08 4.5E-13   77.3   5.3   52   18-69    514-582 (783)
  4 KOG1226|consensus               98.7 2.9E-08 6.2E-13   76.6   5.1   65    4-68    539-621 (783)
  5 PF07974 EGF_2:  EGF-like domai  98.6 4.9E-08 1.1E-12   48.1   3.1   25   42-66      6-32  (32)
  6 smart00051 DSL delta serrate l  97.9 1.2E-05 2.5E-10   45.1   3.1   41   25-66     20-63  (63)
  7 PF12661 hEGF:  Human growth fa  97.4 0.00013 2.8E-09   29.1   1.4   13   54-66      1-13  (13)
  8 KOG4289|consensus               96.8 0.00093   2E-08   55.7   2.8   67    2-69   1230-1318(2531)
  9 KOG4289|consensus               96.6  0.0016 3.5E-08   54.4   2.5   45   25-69   1225-1276(2531)
 10 PF01414 DSL:  Delta serrate li  96.5   0.001 2.2E-08   37.2   0.8   43   24-66     19-63  (63)
 11 PF12955 DUF3844:  Domain of un  96.1  0.0059 1.3E-07   37.3   2.5   38   18-70     13-63  (103)
 12 KOG3607|consensus               96.0   0.005 1.1E-07   48.1   2.3   30   40-69    628-658 (716)
 13 KOG4260|consensus               95.9  0.0067 1.5E-07   43.1   2.7   39   28-68    134-183 (350)
 14 PF00008 EGF:  EGF-like domain   95.7  0.0068 1.5E-07   29.3   1.5   23   43-65      5-32  (32)
 15 cd00055 EGF_Lam Laminin-type e  95.2   0.025 5.5E-07   29.7   2.6   17   52-68     18-34  (50)
 16 KOG1219|consensus               95.1   0.037   8E-07   48.7   4.5   65    2-67   3894-3977(4289)
 17 smart00179 EGF_CA Calcium-bind  94.4   0.087 1.9E-06   25.2   3.3   25   43-67     10-39  (39)
 18 PF00053 Laminin_EGF:  Laminin   94.2    0.03 6.5E-07   29.1   1.4   20   49-68     12-33  (49)
 19 cd00054 EGF_CA Calcium-binding  94.2     0.1 2.2E-06   24.5   3.2   25   43-67     10-38  (38)
 20 cd00053 EGF Epidermal growth f  93.8     0.1 2.2E-06   24.1   2.8   24   43-66      7-35  (36)
 21 PF04863 EGF_alliinase:  Alliin  92.2   0.086 1.9E-06   28.9   1.2   16   54-69     37-52  (56)
 22 smart00181 EGF Epidermal growt  91.9    0.24 5.2E-06   23.3   2.6   24   43-67      7-35  (35)
 23 smart00180 EGF_Lam Laminin-typ  91.3    0.23   5E-06   25.6   2.3   22   49-72     12-35  (46)
 24 PHA02887 EGF-like protein; Pro  91.1    0.23   5E-06   31.2   2.5   25   44-69     94-124 (126)
 25 PF01683 EB:  EB module;  Inter  88.1    0.82 1.8E-05   23.8   2.9   36   24-62     10-46  (52)
 26 KOG1219|consensus               87.5    0.92   2E-05   40.8   4.1   43   28-70   3892-3941(4289)
 27 PHA03099 epidermal growth fact  85.1    0.86 1.9E-05   29.1   2.3   24   47-70     55-84  (139)
 28 PF07645 EGF_CA:  Calcium-bindi  69.1       6 0.00013   19.6   2.2   21   42-62     10-34  (42)
 29 KOG1218|consensus               68.4     7.1 0.00015   26.5   3.1   24   46-69    155-178 (316)
 30 PF09064 Tme5_EGF_like:  Thromb  62.4     9.2  0.0002   18.9   2.0   28   34-64      2-29  (34)
 31 PF12947 EGF_3:  EGF domain;  I  60.3       6 0.00013   19.4   1.2   22   44-65      8-33  (36)
 32 KOG0994|consensus               59.3      14 0.00031   31.5   3.7   20   49-68   1078-1099(1758)
 33 PF05294 Toxin_5:  Scorpion sho  56.0      14  0.0003   17.9   2.0   18   40-57     15-32  (32)
 34 KOG3607|consensus               52.0      10 0.00022   30.1   1.8   23   16-38    628-658 (716)
 35 KOG1217|consensus               50.5      27 0.00059   24.5   3.6   46   24-69    154-208 (487)
 36 PF00954 S_locus_glycop:  S-loc  46.7      19 0.00042   21.2   2.1   23   42-64     84-109 (110)
 37 PF00451 Toxin_2:  Scorpion sho  44.4      16 0.00034   17.7   1.2   12   46-57     20-31  (32)
 38 PF12662 cEGF:  Complement Clr-  40.6      17 0.00038   16.3   0.9   10   54-63      3-12  (24)
 39 PF05453 Toxin_6:  BmTXKS1/BmP0  40.3      26 0.00057   16.5   1.5   20   39-58      5-27  (28)
 40 KOG1836|consensus               32.4      69  0.0015   28.3   3.8   17   53-69    797-814 (1705)
 41 KOG0994|consensus               30.1 1.1E+02  0.0023   26.7   4.4   18   52-69    529-546 (1758)
 42 KOG1214|consensus               23.9 1.4E+02   0.003   25.2   3.9   39   27-65    814-860 (1289)
 43 PF04724 Glyco_transf_17:  Glyc  20.7      72  0.0016   23.2   1.7   18   53-70     35-55  (356)
 44 PF01826 TIL:  Trypsin Inhibito  20.3      97  0.0021   15.8   1.8   14   48-62     29-42  (55)

No 1  
>KOG1225|consensus
Probab=99.31  E-value=3.8e-12  Score=94.86  Aligned_cols=67  Identities=27%  Similarity=0.705  Sum_probs=55.8

Q ss_pred             CCCCCCccccccccccCCCCCCeeeC-------CCCCCCCCCCCCCcccCCCCceEeCCeeEeCCCccCCCCCCCCCC
Q psy10560          2 FHSGVCETQRAAHTYAVSHSGHSEGI-------QDSEHTSLTQPLCDKDCGTHGHCVGDACVCNAGWSGEYCNLQQCD   72 (74)
Q Consensus         2 ~~~~~C~~~~~~c~~~~~Csg~G~c~-------~~~~G~~C~~~~C~~~C~~~G~C~~g~C~C~~g~~G~~C~~~~C~   72 (74)
                      |-|.+|+..  .|  +..||+||.+.       ++|+|.+|++..|+.+|.+||.|+.|+|+|++||+|..|+.++|+
T Consensus       273 f~G~dC~e~--~C--p~~cs~~g~~~~g~CiC~~g~~G~dCs~~~cpadC~g~G~Ci~G~C~C~~Gy~G~~C~~~~C~  346 (525)
T KOG1225|consen  273 FTGDDCDEL--VC--PVDCSGGGVCVDGECICNPGYSGKDCSIRRCPADCSGHGKCIDGECLCDEGYTGELCIQRACS  346 (525)
T ss_pred             CcCCCCCcc--cC--CcccCCCceecCCEeecCCCccccccccccCCccCCCCCcccCCceEeCCCCcCCcccccccC
Confidence            677888873  34  66699987764       578999999888999999999999999999999999999987554


No 2  
>KOG1225|consensus
Probab=99.07  E-value=2.8e-10  Score=84.96  Aligned_cols=67  Identities=25%  Similarity=0.693  Sum_probs=57.3

Q ss_pred             CCCCCCccccccccccCCCCCCeeeC-------CCCCCCCCCCCCCcccCCCCceEeCCeeEeCCCccCCCCCCCCCC
Q psy10560          2 FHSGVCETQRAAHTYAVSHSGHSEGI-------QDSEHTSLTQPLCDKDCGTHGHCVGDACVCNAGWSGEYCNLQQCD   72 (74)
Q Consensus         2 ~~~~~C~~~~~~c~~~~~Csg~G~c~-------~~~~G~~C~~~~C~~~C~~~G~C~~g~C~C~~g~~G~~C~~~~C~   72 (74)
                      |.+..|..  ..|  +..|+++|.|+       ++|+|.+|++.+|+.+|++||.+++++|+|.++|+|.+|+++.||
T Consensus       242 ~~g~~c~~--~~C--~~~c~~~g~c~~G~CIC~~Gf~G~dC~e~~Cp~~cs~~g~~~~g~CiC~~g~~G~dCs~~~cp  315 (525)
T KOG1225|consen  242 YFGPLCST--IYC--PGGCTGRGQCVEGRCICPPGFTGDDCDELVCPVDCSGGGVCVDGECICNPGYSGKDCSIRRCP  315 (525)
T ss_pred             eeCCcccc--ccC--CCCCcccceEeCCeEeCCCCCcCCCCCcccCCcccCCCceecCCEeecCCCccccccccccCC
Confidence            45566662  334  88999888775       589999999999999999999999999999999999999987776


No 3  
>KOG1226|consensus
Probab=98.72  E-value=2.1e-08  Score=77.29  Aligned_cols=52  Identities=33%  Similarity=0.725  Sum_probs=41.5

Q ss_pred             CCCCCCeeeCCC-----------CCCCCCC--CCCCcc----cCCCCceEeCCeeEeCCCccCCCCCCC
Q psy10560         18 VSHSGHSEGIQD-----------SEHTSLT--QPLCDK----DCGTHGHCVGDACVCNAGWSGEYCNLQ   69 (74)
Q Consensus        18 ~~Csg~G~c~~~-----------~~G~~C~--~~~C~~----~C~~~G~C~~g~C~C~~g~~G~~C~~~   69 (74)
                      ..|||+|.|+.+           ++|++|+  +..|+.    .|++||+|..|+|+|.+||+|..|+-+
T Consensus       514 ~vCSgrG~C~CGqC~C~~~~~~~i~G~fCECDnfsC~r~~g~lC~g~G~C~CG~CvC~~GwtG~~C~C~  582 (783)
T KOG1226|consen  514 PVCSGRGDCVCGQCVCHKPDNGKIYGKFCECDNFSCERHKGVLCGGHGRCECGRCVCNPGWTGSACNCP  582 (783)
T ss_pred             CCcCCCCcEeCCceEecCCCCCceeeeeeeccCcccccccCcccCCCCeEeCCcEEcCCCCccCCCCCC
Confidence            379999988633           3588875  556774    499999999999999999999999864


No 4  
>KOG1226|consensus
Probab=98.68  E-value=2.9e-08  Score=76.56  Aligned_cols=65  Identities=23%  Similarity=0.528  Sum_probs=52.6

Q ss_pred             CCCCcccccccccc--CCCCCCeeeC-------CCCCCCCCC----CCCCc----ccCCCCceEeCCeeEeC-CCccCCC
Q psy10560          4 SGVCETQRAAHTYA--VSHSGHSEGI-------QDSEHTSLT----QPLCD----KDCGTHGHCVGDACVCN-AGWSGEY   65 (74)
Q Consensus         4 ~~~C~~~~~~c~~~--~~Csg~G~c~-------~~~~G~~C~----~~~C~----~~C~~~G~C~~g~C~C~-~g~~G~~   65 (74)
                      |..||-+..+|+..  ..|+|||+|.       .+|+|.+|+    ++.|.    ..|++||+|..|+|+|. ++|+|+.
T Consensus       539 G~fCECDnfsC~r~~g~lC~g~G~C~CG~CvC~~GwtG~~C~C~~std~C~~~~G~iCSGrG~C~Cg~C~C~~~~~sG~~  618 (783)
T KOG1226|consen  539 GKFCECDNFSCERHKGVLCGGHGRCECGRCVCNPGWTGSACNCPLSTDTCESSDGQICSGRGTCECGRCKCTDPPYSGEF  618 (783)
T ss_pred             eeeeeccCcccccccCcccCCCCeEeCCcEEcCCCCccCCCCCCCCCccccCCCCceeCCCceeeCCceEcCCCCcCcch
Confidence            66788888877322  3599999874       689999986    55676    36999999999999996 4599999


Q ss_pred             CCC
Q psy10560         66 CNL   68 (74)
Q Consensus        66 C~~   68 (74)
                      |+.
T Consensus       619 CE~  621 (783)
T KOG1226|consen  619 CEK  621 (783)
T ss_pred             hhc
Confidence            987


No 5  
>PF07974 EGF_2:  EGF-like domain;  InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins. The list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied. The functional significance of EGF domains in what appear to be unrelated proteins is not yet clear. However, a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase). The EGF domain includes six cysteine residues which have been shown (in EGF) to be involved in disulphide bonds. The main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet. Subdomains between the conserved cysteines vary in length. This entry contains EGF domains found in a variety of extracellular and membrane proteins
Probab=98.61  E-value=4.9e-08  Score=48.09  Aligned_cols=25  Identities=44%  Similarity=1.188  Sum_probs=22.7

Q ss_pred             ccCCCCceEe--CCeeEeCCCccCCCC
Q psy10560         42 KDCGTHGHCV--GDACVCNAGWSGEYC   66 (74)
Q Consensus        42 ~~C~~~G~C~--~g~C~C~~g~~G~~C   66 (74)
                      ..|++||+|+  .++|+|+++|+|++|
T Consensus         6 ~~C~~~G~C~~~~g~C~C~~g~~G~~C   32 (32)
T PF07974_consen    6 NICSGHGTCVSPCGRCVCDSGYTGPDC   32 (32)
T ss_pred             CccCCCCEEeCCCCEEECCCCCcCCCC
Confidence            3599999999  789999999999987


No 6  
>smart00051 DSL delta serrate ligand.
Probab=97.93  E-value=1.2e-05  Score=45.07  Aligned_cols=41  Identities=24%  Similarity=0.494  Sum_probs=32.6

Q ss_pred             eeCCCCCCCCCCCCCCc--ccCCCCceEeC-CeeEeCCCccCCCC
Q psy10560         25 EGIQDSEHTSLTQPLCD--KDCGTHGHCVG-DACVCNAGWSGEYC   66 (74)
Q Consensus        25 ~c~~~~~G~~C~~~~C~--~~C~~~G~C~~-g~C~C~~g~~G~~C   66 (74)
                      +|..+|.|..|+. .|.  .+..+|.+|.. |.++|.+||+|+.|
T Consensus        20 ~C~~~~yG~~C~~-~C~~~~d~~~~~~Cd~~G~~~C~~Gw~G~~C   63 (63)
T smart00051       20 TCDENYYGEGCNK-FCRPRDDFFGHYTCDENGNKGCLEGWMGPYC   63 (63)
T ss_pred             eCCCCCcCCccCC-EeCcCccccCCccCCcCCCEecCCCCcCCCC
Confidence            4567899999964 343  45778899984 88999999999987


No 7  
>PF12661 hEGF:  Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A.
Probab=97.35  E-value=0.00013  Score=29.14  Aligned_cols=13  Identities=46%  Similarity=1.536  Sum_probs=10.7

Q ss_pred             eeEeCCCccCCCC
Q psy10560         54 ACVCNAGWSGEYC   66 (74)
Q Consensus        54 ~C~C~~g~~G~~C   66 (74)
                      +|+|.+||+|+.|
T Consensus         1 ~C~C~~G~~G~~C   13 (13)
T PF12661_consen    1 TCQCPPGWTGPNC   13 (13)
T ss_dssp             EEEE-TTEETTTT
T ss_pred             CccCcCCCcCCCC
Confidence            5899999999987


No 8  
>KOG4289|consensus
Probab=96.81  E-value=0.00093  Score=55.74  Aligned_cols=67  Identities=21%  Similarity=0.450  Sum_probs=50.2

Q ss_pred             CCCCCCccccccccccCCCCCCeeeC-----------CCCCCCCCCCC----CCc-ccCCCCceEeC----C-eeEeCCC
Q psy10560          2 FHSGVCETQRAAHTYAVSHSGHSEGI-----------QDSEHTSLTQP----LCD-KDCGTHGHCVG----D-ACVCNAG   60 (74)
Q Consensus         2 ~~~~~C~~~~~~c~~~~~Csg~G~c~-----------~~~~G~~C~~~----~C~-~~C~~~G~C~~----g-~C~C~~g   60 (74)
                      |-|+.||+....| |...|+++|+|.           ++|+|..|+..    .|. ..|.+.|+|++    + .|+|.+|
T Consensus      1230 FTgd~CeTeiDlC-Ys~pC~nng~C~srEggYtCeCrpg~tGehCEvs~~agrCvpGvC~nggtC~~~~nggf~c~Cp~g 1308 (2531)
T KOG4289|consen 1230 FTGDYCETEIDLC-YSGPCGNNGRCRSREGGYTCECRPGFTGEHCEVSARAGRCVPGVCKNGGTCVNLLNGGFCCHCPYG 1308 (2531)
T ss_pred             CCcccccchhHhh-hcCCCCCCCceEEecCceeEEecCCccccceeeecccCccccceecCCCEEeecCCCceeccCCCc
Confidence            7788899988877 778899998874           57889998754    353 46778888885    2 5778755


Q ss_pred             -ccCCCCCCC
Q psy10560         61 -WSGEYCNLQ   69 (74)
Q Consensus        61 -~~G~~C~~~   69 (74)
                       |.+++|+..
T Consensus      1309 e~e~prC~v~ 1318 (2531)
T KOG4289|consen 1309 EFEDPRCEVT 1318 (2531)
T ss_pred             ccCCCceEEE
Confidence             788888763


No 9  
>KOG4289|consensus
Probab=96.56  E-value=0.0016  Score=54.40  Aligned_cols=45  Identities=27%  Similarity=0.657  Sum_probs=37.8

Q ss_pred             eeCCCCCCCCCCC--CCCc-ccCCCCceEeC----CeeEeCCCccCCCCCCC
Q psy10560         25 EGIQDSEHTSLTQ--PLCD-KDCGTHGHCVG----DACVCNAGWSGEYCNLQ   69 (74)
Q Consensus        25 ~c~~~~~G~~C~~--~~C~-~~C~~~G~C~~----g~C~C~~g~~G~~C~~~   69 (74)
                      +|-++|+|.+|++  ..|. ..|+++|+|..    .+|.|.++|+|..|+..
T Consensus      1225 rCPpGFTgd~CeTeiDlCYs~pC~nng~C~srEggYtCeCrpg~tGehCEvs 1276 (2531)
T KOG4289|consen 1225 RCPPGFTGDYCETEIDLCYSGPCGNNGRCRSREGGYTCECRPGFTGEHCEVS 1276 (2531)
T ss_pred             eCCCCCCcccccchhHhhhcCCCCCCCceEEecCceeEEecCCccccceeee
Confidence            4557899999984  4687 57999999984    58999999999999984


No 10 
>PF01414 DSL:  Delta serrate ligand;  InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates. In Caenorhabditis elegans, two DSL genes, lag-2 and apx-1, influence different cell fate decisions during development []. Molecular interaction between Notch and Serrate, another EGF-homologous transmembrane protein containing a region of striking similarity to Delta, has been shown and the same two EGF repeats of Notch may also constitute a Serrate binding domain [, ].; GO: 0007154 cell communication, 0016020 membrane; PDB: 2VJ2_A.
Probab=96.50  E-value=0.001  Score=37.16  Aligned_cols=43  Identities=21%  Similarity=0.331  Sum_probs=24.5

Q ss_pred             eeeCCCCCCCCCCCCCCcc-cCCCCceEeC-CeeEeCCCccCCCC
Q psy10560         24 SEGIQDSEHTSLTQPLCDK-DCGTHGHCVG-DACVCNAGWSGEYC   66 (74)
Q Consensus        24 G~c~~~~~G~~C~~~~C~~-~C~~~G~C~~-g~C~C~~g~~G~~C   66 (74)
                      =+|..+|.|+.|+..==+. +-.+|-+|.. |+=+|.+||+|+.|
T Consensus        19 v~C~~nyyG~~C~~~C~~~~d~~ghy~Cd~~G~~~C~~Gw~G~~C   63 (63)
T PF01414_consen   19 VVCDENYYGPNCSKFCKPRDDSFGHYTCDSNGNKVCLPGWTGPNC   63 (63)
T ss_dssp             ----TTEETTTT-EE---EEETTEEEEE-SS--EEE-TTEESTTS
T ss_pred             EECCCCCCCccccCCcCCCcCCcCCcccCCCCCCCCCCCCcCCCC
Confidence            3567889999997532222 2456778884 89999999999987


No 11 
>PF12955 DUF3844:  Domain of unknown function (DUF3844);  InterPro: IPR024382 This presumed domain is found in fungal species. It contains 8 largely conserved cysteine residues. This domain is found in proteins thought to be located in the endoplasmic reticulum.
Probab=96.07  E-value=0.0059  Score=37.33  Aligned_cols=38  Identities=29%  Similarity=0.692  Sum_probs=23.5

Q ss_pred             CCCCCCeeeCCCCCCCCCCCCCCcccCCCCceEeCCeeEeCC-------------CccCCCCCCCC
Q psy10560         18 VSHSGHSEGIQDSEHTSLTQPLCDKDCGTHGHCVGDACVCNA-------------GWSGEYCNLQQ   70 (74)
Q Consensus        18 ~~Csg~G~c~~~~~G~~C~~~~C~~~C~~~G~C~~g~C~C~~-------------g~~G~~C~~~~   70 (74)
                      ++|||||+|...+.+.             .+.|  -.|+|.+             .|.|+.|+...
T Consensus        13 n~CsgHG~C~~~~~~~-------------~~~C--~~C~C~~T~~~~~~~~~ktt~W~G~aCqKkD   63 (103)
T PF12955_consen   13 NNCSGHGSCVKKYGSG-------------GGDC--FACKCKPTVVKTGSGKGKTTHWGGPACQKKD   63 (103)
T ss_pred             cCCCCCceEeeccCCC-------------ccce--EEEEeeccccccccccCceeeeccccccccc
Confidence            4677777776555443             1111  2466755             69999998754


No 12 
>KOG3607|consensus
Probab=95.97  E-value=0.005  Score=48.14  Aligned_cols=30  Identities=33%  Similarity=1.037  Sum_probs=26.5

Q ss_pred             CcccCCCCceEeC-CeeEeCCCccCCCCCCC
Q psy10560         40 CDKDCGTHGHCVG-DACVCNAGWSGEYCNLQ   69 (74)
Q Consensus        40 C~~~C~~~G~C~~-g~C~C~~g~~G~~C~~~   69 (74)
                      |+..|++||+|.. ..|+|+++|.+++|++.
T Consensus       628 ~~~~C~g~GVCnn~~~ChC~~gwapp~C~~~  658 (716)
T KOG3607|consen  628 CPTTCNGHGVCNNELNCHCEPGWAPPFCFIF  658 (716)
T ss_pred             cccccCCCcccCCCcceeeCCCCCCCccccc
Confidence            5567999999996 78999999999999874


No 13 
>KOG4260|consensus
Probab=95.95  E-value=0.0067  Score=43.15  Aligned_cols=39  Identities=26%  Similarity=0.744  Sum_probs=30.5

Q ss_pred             CCCCCCCCCCCCCc----ccCCCCceEe-------CCeeEeCCCccCCCCCC
Q psy10560         28 QDSEHTSLTQPLCD----KDCGTHGHCV-------GDACVCNAGWSGEYCNL   68 (74)
Q Consensus        28 ~~~~G~~C~~~~C~----~~C~~~G~C~-------~g~C~C~~g~~G~~C~~   68 (74)
                      .++.|++|..  |+    ..|++.|.|.       .|+|+|++||+|+.|..
T Consensus       134 ~gtyGpdCl~--Cpggser~C~GnG~C~GdGsR~GsGkCkC~~GY~Gp~C~~  183 (350)
T KOG4260|consen  134 DGTYGPDCLQ--CPGGSERPCFGNGSCHGDGSREGSGKCKCETGYTGPLCRY  183 (350)
T ss_pred             CCCcCCcccc--CCCCCcCCcCCCCcccCCCCCCCCCcccccCCCCCccccc
Confidence            4567888864  54    3588888886       36899999999999975


No 14 
>PF00008 EGF:  EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry;  InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins. The list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied. The functional significance of EGF domains in what appear to be unrelated proteins is not yet clear. However, a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase). The EGF domain includes six cysteine residues which have been shown (in EGF) to be involved in disulphide bonds. The main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet. Subdomains between the conserved cysteines vary in length.; GO: 0005515 protein binding; PDB: 1WHE_A 1CCF_A 1APO_A 1WHF_A 2VJ3_A 1TOZ_A 4D90_B 3CFW_A 1EDM_B 1IXA_A ....
Probab=95.75  E-value=0.0068  Score=29.26  Aligned_cols=23  Identities=30%  Similarity=0.962  Sum_probs=18.8

Q ss_pred             cCCCCceEeC-----CeeEeCCCccCCC
Q psy10560         43 DCGTHGHCVG-----DACVCNAGWSGEY   65 (74)
Q Consensus        43 ~C~~~G~C~~-----g~C~C~~g~~G~~   65 (74)
                      .|.++|+|+.     -.|+|.+||+|..
T Consensus         5 ~C~n~g~C~~~~~~~y~C~C~~G~~G~~   32 (32)
T PF00008_consen    5 PCQNGGTCIDLPGGGYTCECPPGYTGKR   32 (32)
T ss_dssp             SSTTTEEEEEESTSEEEEEEBTTEESTT
T ss_pred             cCCCCeEEEeCCCCCEEeECCCCCccCC
Confidence            5788899984     2699999999963


No 15 
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies
Probab=95.16  E-value=0.025  Score=29.68  Aligned_cols=17  Identities=24%  Similarity=0.708  Sum_probs=15.1

Q ss_pred             CCeeEeCCCccCCCCCC
Q psy10560         52 GDACVCNAGWSGEYCNL   68 (74)
Q Consensus        52 ~g~C~C~~g~~G~~C~~   68 (74)
                      .|+|.|.++|+|..|+.
T Consensus        18 ~G~C~C~~~~~G~~C~~   34 (50)
T cd00055          18 TGQCECKPNTTGRRCDR   34 (50)
T ss_pred             CCEEeCCCcCCCCCCCC
Confidence            48999999999999983


No 16 
>KOG1219|consensus
Probab=95.07  E-value=0.037  Score=48.69  Aligned_cols=65  Identities=22%  Similarity=0.466  Sum_probs=42.9

Q ss_pred             CCCCCCccccccccccCCCCCCeeeCC-----------CCCCCCCCCC---CCc-ccCCCCceEeC--C--eeEeCCCcc
Q psy10560          2 FHSGVCETQRAAHTYAVSHSGHSEGIQ-----------DSEHTSLTQP---LCD-KDCGTHGHCVG--D--ACVCNAGWS   62 (74)
Q Consensus         2 ~~~~~C~~~~~~c~~~~~Csg~G~c~~-----------~~~G~~C~~~---~C~-~~C~~~G~C~~--g--~C~C~~g~~   62 (74)
                      |.|..||...-.| -++-|-.-|+|.+           +|+|..|+..   .|. +.|...|.|++  |  .|.|.++|.
T Consensus      3894 ysG~~CEi~~epC-~snPC~~GgtCip~~n~f~CnC~~gyTG~~Ce~~Gi~eCs~n~C~~gg~C~n~~gsf~CncT~g~~ 3972 (4289)
T KOG1219|consen 3894 YSGNHCEIDLEPC-ASNPCLTGGTCIPFYNGFLCNCPNGYTGKRCEARGISECSKNVCGTGGQCINIPGSFHCNCTPGIL 3972 (4289)
T ss_pred             ccCcccccccccc-cCCCCCCCCEEEecCCCeeEeCCCCccCceeecccccccccccccCCceeeccCCceEeccChhHh
Confidence            6677777776655 3456666677742           4577777644   365 45777777775  4  677778888


Q ss_pred             CCCCC
Q psy10560         63 GEYCN   67 (74)
Q Consensus        63 G~~C~   67 (74)
                      |..|.
T Consensus      3973 gr~c~ 3977 (4289)
T KOG1219|consen 3973 GRTCC 3977 (4289)
T ss_pred             cccCc
Confidence            77774


No 17 
>smart00179 EGF_CA Calcium-binding EGF-like domain.
Probab=94.37  E-value=0.087  Score=25.19  Aligned_cols=25  Identities=36%  Similarity=1.036  Sum_probs=19.2

Q ss_pred             cCCCCceEeC----CeeEeCCCcc-CCCCC
Q psy10560         43 DCGTHGHCVG----DACVCNAGWS-GEYCN   67 (74)
Q Consensus        43 ~C~~~G~C~~----g~C~C~~g~~-G~~C~   67 (74)
                      .|..+|.|+.    -.|.|.++|. |..|+
T Consensus        10 ~C~~~~~C~~~~g~~~C~C~~g~~~g~~C~   39 (39)
T smart00179       10 PCQNGGTCVNTVGSYRCECPPGYTDGRNCE   39 (39)
T ss_pred             CcCCCCEeECCCCCeEeECCCCCccCCcCC
Confidence            4666778874    2699999999 88874


No 18 
>PF00053 Laminin_EGF:  Laminin EGF-like (Domains III and V);  InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation. They are composed of distinct but related alpha, beta and gamma chains. The three chains form a cross-shaped molecule that consist of a long arm and three short globular arms. The long arm consist of a coiled coil structure contributed by all three chains and cross-linked by interchain disulphide bonds. Beside different types of globular domains each subunit contains, in its first half, consecutive repeats of about 60 amino acids in length that include eight conserved cysteines []. The tertiary structure [, ] of this domain is remotely similar in its N-terminal to that of the EGF-like module (see PDOC00021 from PROSITEDOC). It is known as a 'LE' or 'laminin-type EGF-like' domain. The number of copies of the LE domain in the different forms of laminins is highly variable; from 3 up to 22 copies have been found. A schematic representation of the topology of the four disulphide bonds in the LE domain is shown below.  +-------------------+ +-|-----------+ | +--------+ +-----------------+ | | | | | | | | xxCxCxxxxxxxxxxxCxxxxxxxCxxCxxxxxGxxCxxCxxgaagxxxxxxxxxxxCxx sssssssssssssssssssssssssssssssssss 'C': conserved cysteine involved in a disulphide bond 'a': conserved aromatic residue 'G': conserved glycine (lower case = less conserved) 's': region similar to the EGF-like domain  In mouse laminin gamma-1 chain, the seventh LE domain has been shown to be the only one that binds with a high affinity to nidogen []. The binding-sites are located on the surface within the loops C1-C3 and C5-C6 [, ]. Long consecutive arrays of LE domains in laminins form rod-like elements of limited flexibility [], which determine the spacing in the formation of laminin networks of basement membranes [].; PDB: 3TBD_A 3ZYG_B 3ZYI_B 2Y38_A 1KLO_A 1NPE_B 3ZYJ_B 1TLE_A.
Probab=94.18  E-value=0.03  Score=29.10  Aligned_cols=20  Identities=35%  Similarity=0.926  Sum_probs=16.2

Q ss_pred             eEe--CCeeEeCCCccCCCCCC
Q psy10560         49 HCV--GDACVCNAGWSGEYCNL   68 (74)
Q Consensus        49 ~C~--~g~C~C~~g~~G~~C~~   68 (74)
                      .|.  .|+|.|.++|+|+.|+.
T Consensus        12 ~C~~~~G~C~C~~~~~G~~C~~   33 (49)
T PF00053_consen   12 TCDPSTGQCVCKPGTTGPRCDQ   33 (49)
T ss_dssp             SEEETCEEESBSTTEESTTS-E
T ss_pred             cccCCCCEEeccccccCCcCcC
Confidence            565  48999999999999985


No 19 
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.
Probab=94.18  E-value=0.1  Score=24.49  Aligned_cols=25  Identities=36%  Similarity=1.048  Sum_probs=18.8

Q ss_pred             cCCCCceEeC----CeeEeCCCccCCCCC
Q psy10560         43 DCGTHGHCVG----DACVCNAGWSGEYCN   67 (74)
Q Consensus        43 ~C~~~G~C~~----g~C~C~~g~~G~~C~   67 (74)
                      .|..++.|+.    ..|.|.++|.|..|+
T Consensus        10 ~C~~~~~C~~~~~~~~C~C~~g~~g~~C~   38 (38)
T cd00054          10 PCQNGGTCVNTVGSYRCSCPPGYTGRNCE   38 (38)
T ss_pred             CcCCCCEeECCCCCeEeECCCCCcCCcCC
Confidence            4656677764    369999999998774


No 20 
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at  least  one  is  present  in  most EGF-like domains; a subset of these bind calcium.
Probab=93.81  E-value=0.1  Score=24.07  Aligned_cols=24  Identities=42%  Similarity=1.185  Sum_probs=18.1

Q ss_pred             cCCCCceEeC----CeeEeCCCccCC-CC
Q psy10560         43 DCGTHGHCVG----DACVCNAGWSGE-YC   66 (74)
Q Consensus        43 ~C~~~G~C~~----g~C~C~~g~~G~-~C   66 (74)
                      .|..++.|+.    .+|.|.++|.|. .|
T Consensus         7 ~C~~~~~C~~~~~~~~C~C~~g~~g~~~C   35 (36)
T cd00053           7 PCSNGGTCVNTPGSYRCVCPPGYTGDRSC   35 (36)
T ss_pred             CCCCCCEEecCCCCeEeECCCCCcccCCc
Confidence            4556677764    479999999998 65


No 21 
>PF04863 EGF_alliinase:  Alliinase EGF-like domain;  InterPro: IPR006947 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species. Allicin is synthesised from sulphoxide cysteine derivatives by alliinase, whose C-S lyase activity cleaves C(beta)-S(gamma) bonds. It is thought that this enzyme forms part of a primitive plant defence system [].; GO: 0016846 carbon-sulfur lyase activity; PDB: 1LK9_B 2HOX_C 2HOR_A.
Probab=92.19  E-value=0.086  Score=28.88  Aligned_cols=16  Identities=31%  Similarity=0.862  Sum_probs=10.8

Q ss_pred             eeEeCCCccCCCCCCC
Q psy10560         54 ACVCNAGWSGEYCNLQ   69 (74)
Q Consensus        54 ~C~C~~g~~G~~C~~~   69 (74)
                      .|.|..-|.|++|++.
T Consensus        37 ~CECn~Cy~GpdCS~~   52 (56)
T PF04863_consen   37 VCECNSCYGGPDCSTL   52 (56)
T ss_dssp             --EE-TTEESTTS-EE
T ss_pred             cccccCCcCCCCcccC
Confidence            6899999999999874


No 22 
>smart00181 EGF Epidermal growth factor-like domain.
Probab=91.93  E-value=0.24  Score=23.30  Aligned_cols=24  Identities=29%  Similarity=1.038  Sum_probs=17.2

Q ss_pred             cCCCCceEeC----CeeEeCCCccC-CCCC
Q psy10560         43 DCGTHGHCVG----DACVCNAGWSG-EYCN   67 (74)
Q Consensus        43 ~C~~~G~C~~----g~C~C~~g~~G-~~C~   67 (74)
                      .|..+ +|+.    .+|.|.+||.| ..|+
T Consensus         7 ~C~~~-~C~~~~~~~~C~C~~g~~g~~~C~   35 (35)
T smart00181        7 PCSNG-TCINTPGSYTCSCPPGYTGDKRCE   35 (35)
T ss_pred             CCCCC-EEECCCCCeEeECCCCCccCCccC
Confidence            35555 6764    37999999999 7664


No 23 
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai.
Probab=91.29  E-value=0.23  Score=25.64  Aligned_cols=22  Identities=27%  Similarity=0.912  Sum_probs=17.4

Q ss_pred             eEe--CCeeEeCCCccCCCCCCCCCC
Q psy10560         49 HCV--GDACVCNAGWSGEYCNLQQCD   72 (74)
Q Consensus        49 ~C~--~g~C~C~~g~~G~~C~~~~C~   72 (74)
                      .|.  .|+|.|.++|+|..|+  .|+
T Consensus        12 ~C~~~~G~C~C~~~~~G~~C~--~C~   35 (46)
T smart00180       12 TCDPDTGQCECKPNVTGRRCD--RCA   35 (46)
T ss_pred             cccCCCCEEECCCCCCCCCCC--cCC
Confidence            454  4799999999999998  454


No 24 
>PHA02887 EGF-like protein; Provisional
Probab=91.10  E-value=0.23  Score=31.21  Aligned_cols=25  Identities=36%  Similarity=1.067  Sum_probs=20.6

Q ss_pred             CCCCceEeC------CeeEeCCCccCCCCCCC
Q psy10560         44 CGTHGHCVG------DACVCNAGWSGEYCNLQ   69 (74)
Q Consensus        44 C~~~G~C~~------g~C~C~~g~~G~~C~~~   69 (74)
                      |- ||.|.-      -.|+|+.||+|..|+..
T Consensus        94 Ci-HG~C~yI~dL~epsCrC~~GYtG~RCE~v  124 (126)
T PHA02887         94 CI-NGECMNIIDLDEKFCICNKGYTGIRCDEV  124 (126)
T ss_pred             ee-CCEEEccccCCCceeECCCCcccCCCCcc
Confidence            55 789962      47999999999999864


No 25 
>PF01683 EB:  EB module;  InterPro: IPR006149  The EB domain has no known function. It is found in several Caenorhabditis sp. and Drosophila sp. proteins. The domain contains 8 conserved cysteines that probably form four disulphide bridges and is found associated with kunitz domains IPR002223 from INTERPRO 
Probab=88.13  E-value=0.82  Score=23.76  Aligned_cols=36  Identities=19%  Similarity=0.453  Sum_probs=24.4

Q ss_pred             eeeCC-CCCCCCCCCCCCcccCCCCceEeCCeeEeCCCcc
Q psy10560         24 SEGIQ-DSEHTSLTQPLCDKDCGTHGHCVGDACVCNAGWS   62 (74)
Q Consensus        24 G~c~~-~~~G~~C~~~~C~~~C~~~G~C~~g~C~C~~g~~   62 (74)
                      |.|.+ -..|..|+..   ..|.+...|+.++|+|.++|.
T Consensus        10 ~~C~~~~~~g~~C~~~---~qC~~~s~C~~g~C~C~~g~~   46 (52)
T PF01683_consen   10 GQCVPRVQPGESCESD---EQCIGGSVCVNGRCQCPPGYV   46 (52)
T ss_pred             CEECccCCCCCCCCCc---CCCCCcCEEcCCEeECCCCCE
Confidence            55543 2457777632   134477889999999999875


No 26 
>KOG1219|consensus
Probab=87.46  E-value=0.92  Score=40.79  Aligned_cols=43  Identities=23%  Similarity=0.577  Sum_probs=34.6

Q ss_pred             CCCCCCCCCCC--CCc-ccCCCCceEeC----CeeEeCCCccCCCCCCCC
Q psy10560         28 QDSEHTSLTQP--LCD-KDCGTHGHCVG----DACVCNAGWSGEYCNLQQ   70 (74)
Q Consensus        28 ~~~~G~~C~~~--~C~-~~C~~~G~C~~----g~C~C~~g~~G~~C~~~~   70 (74)
                      ..|.|..|+..  .|. +.|-..|+|+.    -.|.|..+|+|..|+...
T Consensus      3892 sqysG~~CEi~~epC~snPC~~GgtCip~~n~f~CnC~~gyTG~~Ce~~G 3941 (4289)
T KOG1219|consen 3892 SQYSGNHCEIDLEPCASNPCLTGGTCIPFYNGFLCNCPNGYTGKRCEARG 3941 (4289)
T ss_pred             ccccCcccccccccccCCCCCCCCEEEecCCCeeEeCCCCccCceeeccc
Confidence            35789999844  565 57999999985    379999999999998763


No 27 
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional
Probab=85.10  E-value=0.86  Score=29.10  Aligned_cols=24  Identities=33%  Similarity=0.884  Sum_probs=19.0

Q ss_pred             CceEeC------CeeEeCCCccCCCCCCCC
Q psy10560         47 HGHCVG------DACVCNAGWSGEYCNLQQ   70 (74)
Q Consensus        47 ~G~C~~------g~C~C~~g~~G~~C~~~~   70 (74)
                      ||.|.-      -.|+|+.||+|..|+...
T Consensus        55 HG~C~yI~dl~~~~CrC~~GYtGeRCEh~d   84 (139)
T PHA03099         55 HGDCIHARDIDGMYCRCSHGYTGIRCQHVV   84 (139)
T ss_pred             CCEEEeeccCCCceeECCCCccccccccee
Confidence            577752      369999999999998753


No 28 
>PF07645 EGF_CA:  Calcium-binding EGF domain;  InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins. Many of these proteins require calcium for their biological function and a calcium-binding site has been found at the N terminus of some EGF-like domains []. Calcium-binding may be crucial for numerous protein-protein interactions. For human coagulation factor IX it has been shown [] that the calcium-ligands form a pentagonal bipyramid. The first, third and fourth conserved negatively charged or polar residues are side chain ligands. The latter is possibly hydroxylated (see aspartic acid and asparagine hydroxylation site) []. A conserved aromatic residue, as well as the second conserved negative residue, are thought to be involved in stabilising the calcium-binding site. As in non-calcium binding EGF-like domains, there are six conserved cysteines and the structure of both types is very similar as calcium-binding induces only strictly local structural changes [].  +------------------+ +---------+ | | | | nxnnC-x(3,14)-C-x(3,7)-CxxbxxxxaxC-x(1,6)-C-x(8,13)-Cx | | +------------------+ 'n': negatively charged or polar residue [DEQN] 'b': possibly beta-hydroxylated residue [DN] 'a': aromatic amino acid 'C': cysteine, involved in disulphide bond 'x': any amino acid. ; GO: 0005509 calcium ion binding; PDB: 2VJ3_A 1TOZ_A 1LMJ_A 1UZQ_A 1UZK_A 1UZJ_B 1UZP_A 1EMO_A 1EMN_A 2RR0_A ....
Probab=69.08  E-value=6  Score=19.61  Aligned_cols=21  Identities=33%  Similarity=1.047  Sum_probs=16.7

Q ss_pred             ccCCCCceEeC----CeeEeCCCcc
Q psy10560         42 KDCGTHGHCVG----DACVCNAGWS   62 (74)
Q Consensus        42 ~~C~~~G~C~~----g~C~C~~g~~   62 (74)
                      ..|..++.|++    ..|+|.+||.
T Consensus        10 ~~C~~~~~C~N~~Gsy~C~C~~Gy~   34 (42)
T PF07645_consen   10 HNCPENGTCVNTEGSYSCSCPPGYE   34 (42)
T ss_dssp             SSSSTTSEEEEETTEEEEEESTTEE
T ss_pred             CcCCCCCEEEcCCCCEEeeCCCCcE
Confidence            35777889985    3799999998


No 29 
>KOG1218|consensus
Probab=68.44  E-value=7.1  Score=26.54  Aligned_cols=24  Identities=25%  Similarity=0.765  Sum_probs=18.3

Q ss_pred             CCceEeCCeeEeCCCccCCCCCCC
Q psy10560         46 THGHCVGDACVCNAGWSGEYCNLQ   69 (74)
Q Consensus        46 ~~G~C~~g~C~C~~g~~G~~C~~~   69 (74)
                      .+-.+..+.|.|.+||.|..+...
T Consensus       155 ~~~~~~~~~c~c~~g~~g~~~~~~  178 (316)
T KOG1218|consen  155 GGCDCKNGICTCQPGFVGVFCVES  178 (316)
T ss_pred             cccCCCCCceeccCCccccccccc
Confidence            334455688999999999998765


No 30 
>PF09064 Tme5_EGF_like:  Thrombomodulin like fifth domain, EGF-like;  InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet. Disulphide pairing, however, is not of the usual 1-3, 2-4, 5-6 type; rather 1-2, 3-4, 5-6 pairing is found. Its extended major sheet (strands beta-2 and beta-3 and the connecting loop) projects into thrombin's active site groove. This domain is required for interaction of thrombomodulin with thrombin, and subsequent activation of protein-C []. ; GO: 0004888 transmembrane signaling receptor activity, 0016021 integral to membrane
Probab=62.39  E-value=9.2  Score=18.88  Aligned_cols=28  Identities=25%  Similarity=0.623  Sum_probs=18.2

Q ss_pred             CCCCCCCcccCCCCceEeCCeeEeCCCccCC
Q psy10560         34 SLTQPLCDKDCGTHGHCVGDACVCNAGWSGE   64 (74)
Q Consensus        34 ~C~~~~C~~~C~~~G~C~~g~C~C~~g~~G~   64 (74)
                      +|.+..|+..|..+-   .++|.|.+||.-.
T Consensus         2 fCn~t~CpA~CDpn~---~~~C~CPeGyIld   29 (34)
T PF09064_consen    2 FCNQTECPADCDPNS---PGQCFCPEGYILD   29 (34)
T ss_pred             ccccccCCCccCCCC---CCceeCCCceEec
Confidence            466677776665321   2589999998643


No 31 
>PF12947 EGF_3:  EGF domain;  InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins.; PDB: 2NPR_A 1N1I_C 1B9W_A 1YO8_A 2RHP_A.
Probab=60.32  E-value=6  Score=19.41  Aligned_cols=22  Identities=27%  Similarity=0.933  Sum_probs=14.2

Q ss_pred             CCCCceEeC----CeeEeCCCccCCC
Q psy10560         44 CGTHGHCVG----DACVCNAGWSGEY   65 (74)
Q Consensus        44 C~~~G~C~~----g~C~C~~g~~G~~   65 (74)
                      |..+-.|+.    .+|+|.+||.|..
T Consensus         8 C~~nA~C~~~~~~~~C~C~~Gy~GdG   33 (36)
T PF12947_consen    8 CHPNATCTNTGGSYTCTCKPGYEGDG   33 (36)
T ss_dssp             S-TTCEEEE-TTSEEEEE-CEEECCS
T ss_pred             CCCCcEeecCCCCEEeECCCCCccCC
Confidence            445555653    4799999999864


No 32 
>KOG0994|consensus
Probab=59.31  E-value=14  Score=31.53  Aligned_cols=20  Identities=30%  Similarity=0.973  Sum_probs=16.9

Q ss_pred             eEe--CCeeEeCCCccCCCCCC
Q psy10560         49 HCV--GDACVCNAGWSGEYCNL   68 (74)
Q Consensus        49 ~C~--~g~C~C~~g~~G~~C~~   68 (74)
                      .|+  .|+|+|.|||.|..|+.
T Consensus      1078 qCN~ftGQCqCkpGfGGR~C~q 1099 (1758)
T KOG0994|consen 1078 QCNEFTGQCQCKPGFGGRTCSQ 1099 (1758)
T ss_pred             cccccccceeccCCCCCcchhH
Confidence            465  48999999999999875


No 33 
>PF05294 Toxin_5:  Scorpion short toxin;  InterPro: IPR007958 This family contains various secreted scorpion short toxins which seem to be unrelated to those described in IPR001947 from INTERPRO.; GO: 0009405 pathogenesis, 0005576 extracellular region; PDB: 1SIS_A 1CHL_A.
Probab=56.01  E-value=14  Score=17.94  Aligned_cols=18  Identities=44%  Similarity=1.394  Sum_probs=13.1

Q ss_pred             CcccCCCCceEeCCeeEe
Q psy10560         40 CDKDCGTHGHCVGDACVC   57 (74)
Q Consensus        40 C~~~C~~~G~C~~g~C~C   57 (74)
                      |..-|.++|.|...+|+|
T Consensus        15 C~~CCgg~GkC~GpqClC   32 (32)
T PF05294_consen   15 CRDCCGGRGKCFGPQCLC   32 (32)
T ss_dssp             HHHHCTTSEEEETTEEEE
T ss_pred             HHHHhCCCCeEcCCcccC
Confidence            334477888888878876


No 34 
>KOG3607|consensus
Probab=51.97  E-value=10  Score=30.13  Aligned_cols=23  Identities=9%  Similarity=-0.133  Sum_probs=18.5

Q ss_pred             ccCCCCCCeeeC--------CCCCCCCCCCC
Q psy10560         16 YAVSHSGHSEGI--------QDSEHTSLTQP   38 (74)
Q Consensus        16 ~~~~Csg~G~c~--------~~~~G~~C~~~   38 (74)
                      ++..|++||+|+        .+|.+++|+..
T Consensus       628 ~~~~C~g~GVCnn~~~ChC~~gwapp~C~~~  658 (716)
T KOG3607|consen  628 CPTTCNGHGVCNNELNCHCEPGWAPPFCFIF  658 (716)
T ss_pred             cccccCCCcccCCCcceeeCCCCCCCccccc
Confidence            577899999986        57889998753


No 35 
>KOG1217|consensus
Probab=50.52  E-value=27  Score=24.46  Aligned_cols=46  Identities=24%  Similarity=0.572  Sum_probs=34.2

Q ss_pred             eeeCCCCCCCCCCCC--CCc---ccCCCCceEeC----CeeEeCCCccCCCCCCC
Q psy10560         24 SEGIQDSEHTSLTQP--LCD---KDCGTHGHCVG----DACVCNAGWSGEYCNLQ   69 (74)
Q Consensus        24 G~c~~~~~G~~C~~~--~C~---~~C~~~G~C~~----g~C~C~~g~~G~~C~~~   69 (74)
                      -.|..+|.+..+...  .|.   ..|...+.|.+    ..|.|.++|.|..|+..
T Consensus       154 c~C~~g~~~~~~~~~~~~C~~~~~~c~~~~~C~~~~~~~~C~c~~~~~~~~~~~~  208 (487)
T KOG1217|consen  154 CSCTEGYEGEPCETDLDECIQYSSPCQNGGTCVNTGGSYLCSCPPGYTGSTCETT  208 (487)
T ss_pred             eeeCCCcccccccccccccccCCCCcCCCcccccCCCCeeEeCCCCccCCcCcCC
Confidence            456678888888753  675   23777888875    25999999999998764


No 36 
>PF00954 S_locus_glycop:  S-locus glycoprotein family;  InterPro: IPR000858 In Brassicaceae, self-incompatible plants have a self/non-self recognition system, which involves the inability of flowering plants to achieve self-fertilisation. This is sporophytically controlled by multiple alleles at a single locus (S). There are a total of 50 different S alleles in Brassica oleracea. S-locus glycoproteins, as well as S-receptor kinases, are in linkage with the S-alleles []. Most of the proteins within this family contain apple-like domain (IPR003609 from INTERPRO), which is predicted to possess protein- and/or carbohydrate-binding functions.; GO: 0048544 recognition of pollen
Probab=46.71  E-value=19  Score=21.19  Aligned_cols=23  Identities=30%  Similarity=0.813  Sum_probs=18.3

Q ss_pred             ccCCCCceEeC---CeeEeCCCccCC
Q psy10560         42 KDCGTHGHCVG---DACVCNAGWSGE   64 (74)
Q Consensus        42 ~~C~~~G~C~~---g~C~C~~g~~G~   64 (74)
                      ..|+..|.|..   .+|.|.+||...
T Consensus        84 ~~CG~~g~C~~~~~~~C~Cl~GF~P~  109 (110)
T PF00954_consen   84 GFCGPNGICNSNNSPKCSCLPGFEPK  109 (110)
T ss_pred             cccCCccEeCCCCCCceECCCCcCCC
Confidence            46888999974   479999999754


No 37 
>PF00451 Toxin_2:  Scorpion short toxin, BmKK2;  InterPro: IPR001947 Scorpion venoms contain a variety of peptides toxic to mammals, insects and crustaceans. Among these peptides there is a family of short toxins (30 to 40 residues) [, ] including charybdotoxin, kaliotoxin [], noxiustoxin [] and iberiotoxin [, ]. Charybdotoxin consists of a single polypeptide chain and is a potent, selective inhibitor of calcium-activated potassium channels in pituitary and aortic smooth muscle cells - the toxin reversibly blocks channel activity by interacting at the external pore of the channel protein[]. The tertiary structure of the toxins comprises a 3-stranded beta-sheet and a short helix, and is stabilised by a number of disulphide bridges [] as shown in the following schematic representation:  +---------------------+ | | | | xxxxxxxCxxxxxCxxxCxxxxxxxxxxxCxxxxCxCxxx | | | | | +----------------+ | +----------------------+ 'C': conserved cysteine involved in a disulphide bond.  ; GO: 0008200 ion channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region; PDB: 1TSK_A 2PTA_A 1BIG_A 3ODV_A 2UVS_A 2KTX_A 1XSW_A 1KTX_A 1WMT_A 1PNH_A ....
Probab=44.41  E-value=16  Score=17.68  Aligned_cols=12  Identities=33%  Similarity=1.154  Sum_probs=10.2

Q ss_pred             CCceEeCCeeEe
Q psy10560         46 THGHCVGDACVC   57 (74)
Q Consensus        46 ~~G~C~~g~C~C   57 (74)
                      .+|.|++++|.|
T Consensus        20 ~~gKCmN~kC~C   31 (32)
T PF00451_consen   20 LNGKCMNGKCKC   31 (32)
T ss_dssp             SEEEEETTEEEE
T ss_pred             CCCCccCCCcee
Confidence            468999999987


No 38 
>PF12662 cEGF:  Complement Clr-like EGF-like
Probab=40.57  E-value=17  Score=16.34  Aligned_cols=10  Identities=30%  Similarity=0.949  Sum_probs=8.4

Q ss_pred             eeEeCCCccC
Q psy10560         54 ACVCNAGWSG   63 (74)
Q Consensus        54 ~C~C~~g~~G   63 (74)
                      +|+|.+||+.
T Consensus         3 ~C~C~~Gy~l   12 (24)
T PF12662_consen    3 TCSCPPGYQL   12 (24)
T ss_pred             EeeCCCCCcC
Confidence            6899999974


No 39 
>PF05453 Toxin_6:  BmTXKS1/BmP02 toxin family;  InterPro: IPR008911 This family consists of several scorpion toxins which act by blocking small conductance calcium activated potassium ion channels in their victim.; GO: 0008200 ion channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region; PDB: 1ACW_A 1DU9_A 1WM8_A 2KTC_A 1WM7_A.
Probab=40.31  E-value=26  Score=16.51  Aligned_cols=20  Identities=30%  Similarity=0.838  Sum_probs=13.1

Q ss_pred             CCcccCCCCc---eEeCCeeEeC
Q psy10560         39 LCDKDCGTHG---HCVGDACVCN   58 (74)
Q Consensus        39 ~C~~~C~~~G---~C~~g~C~C~   58 (74)
                      .||-.|.+.+   .|.+++|+|.
T Consensus         5 ~Cp~hC~~k~ak~~c~n~~C~C~   27 (28)
T PF05453_consen    5 ECPMHCKGKNAKPTCDNGKCNCN   27 (28)
T ss_dssp             CHHHCCCTTT-EEEEETTEEEEE
T ss_pred             cchhhhcccCCcccccCceeecC
Confidence            3555676554   5777888875


No 40 
>KOG1836|consensus
Probab=32.44  E-value=69  Score=28.27  Aligned_cols=17  Identities=29%  Similarity=0.770  Sum_probs=15.0

Q ss_pred             CeeE-eCCCccCCCCCCC
Q psy10560         53 DACV-CNAGWSGEYCNLQ   69 (74)
Q Consensus        53 g~C~-C~~g~~G~~C~~~   69 (74)
                      ++|+ |.++|+|..|+..
T Consensus       797 ~iCk~Cp~gytG~rCe~c  814 (1705)
T KOG1836|consen  797 VVCKNCPPGYTGLRCEEC  814 (1705)
T ss_pred             eecCCCCCCCcccccccC
Confidence            6898 9999999999863


No 41 
>KOG0994|consensus
Probab=30.13  E-value=1.1e+02  Score=26.74  Aligned_cols=18  Identities=22%  Similarity=0.588  Sum_probs=15.7

Q ss_pred             CCeeEeCCCccCCCCCCC
Q psy10560         52 GDACVCNAGWSGEYCNLQ   69 (74)
Q Consensus        52 ~g~C~C~~g~~G~~C~~~   69 (74)
                      .|+|.|.+++.|..|+..
T Consensus       529 sGqC~CRe~~~GR~c~~~  546 (1758)
T KOG0994|consen  529 SGQCECREHMLGRRCEQV  546 (1758)
T ss_pred             cCcccccccccccccccc
Confidence            389999999999999864


No 42 
>KOG1214|consensus
Probab=23.85  E-value=1.4e+02  Score=25.23  Aligned_cols=39  Identities=18%  Similarity=0.492  Sum_probs=25.7

Q ss_pred             CCCCCCCC--C-CCCCCc-ccCCCCceEeC----CeeEeCCCccCCC
Q psy10560         27 IQDSEHTS--L-TQPLCD-KDCGTHGHCVG----DACVCNAGWSGEY   65 (74)
Q Consensus        27 ~~~~~G~~--C-~~~~C~-~~C~~~G~C~~----g~C~C~~g~~G~~   65 (74)
                      .++|.|+-  | +...|. ..|...-.|++    -.|+|.+||.|+.
T Consensus       814 LPGfsGDG~~c~dvDeC~psrChp~A~CyntpgsfsC~C~pGy~GDG  860 (1289)
T KOG1214|consen  814 LPGFSGDGHQCTDVDECSPSRCHPAATCYNTPGSFSCRCQPGYYGDG  860 (1289)
T ss_pred             cCCccCCccccccccccCccccCCCceEecCCCcceeecccCccCCC
Confidence            46665533  3 344554 45776777875    3799999999864


No 43 
>PF04724 Glyco_transf_17:  Glycosyltransferase family 17;  InterPro: IPR006813 This family represents beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (2.4.1.144 from EC). This enzyme transfers the bisecting GlcNAc to the core mannose of complex N-glycans. The addition of this residue is regulated during development and has functional consequences for receptor signalling, cell adhesion, and tumour progression [, ].; GO: 0003830 beta-1,4-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity, 0006487 protein N-linked glycosylation, 0016020 membrane
Probab=20.70  E-value=72  Score=23.24  Aligned_cols=18  Identities=33%  Similarity=1.121  Sum_probs=14.6

Q ss_pred             CeeEeCCCccC-CC--CCCCC
Q psy10560         53 DACVCNAGWSG-EY--CNLQQ   70 (74)
Q Consensus        53 g~C~C~~g~~G-~~--C~~~~   70 (74)
                      ..|.|.|+|.| ++  |.+|.
T Consensus        35 ~~~~~rp~w~~~~~~~~~ip~   55 (356)
T PF04724_consen   35 ISCFCRPGWHGPPDPFCGIPH   55 (356)
T ss_pred             eEEeccCccCCCCCCCCCCCc
Confidence            47999999999 66  88763


No 44 
>PF01826 TIL:  Trypsin Inhibitor like cysteine rich domain;  InterPro: IPR002919 This domain is found in proteinase inhibitors as well as in many extracellular proteins. The domain typically contains ten cysteine residues that form five disulphide bonds. The cysteine residues that form the disulphide bonds are 1-7, 2-6, 3-5, 4-10 and 8-9. This inhibitor domain belongs to MEROPS inhibitor family I8 (clan IA). Proteins containing this domain inhibit peptidases belonging to families S1 (IPR001254 from INTERPRO), S8 (IPR000209 from INTERPRO), and M4 (IPR001570 from INTERPRO) [] and are restricted to the chordata, nematoda, arthropoda and echinodermata. Examples of proteins containing this domain are:  chymotrypsin/elastase inhibitor from Ascaris suum (pig roundworm) Acp62F protein from Drosophila melanogaster  Bombina trypsin inhibitor from Bombina maxima (large-webbed bell toad) Bombyx subtilisin inhibitor from Bombyx mori (silk moth) von Willebrand factor ; PDB: 2P3F_N 1HX2_A 1CCV_A 1EAI_D 2H9E_C 1COU_A 1ATE_A 1ATB_A 1ATD_A 1ATA_A ....
Probab=20.28  E-value=97  Score=15.77  Aligned_cols=14  Identities=36%  Similarity=1.058  Sum_probs=9.5

Q ss_pred             ceEeCCeeEeCCCcc
Q psy10560         48 GHCVGDACVCNAGWS   62 (74)
Q Consensus        48 G~C~~g~C~C~~g~~   62 (74)
                      ..|+.| |.|.+||.
T Consensus        29 ~~C~~g-C~C~~G~v   42 (55)
T PF01826_consen   29 EPCVEG-CFCPPGYV   42 (55)
T ss_dssp             SS-ESE-EEETTTEE
T ss_pred             CCCCcc-CCCCCCee
Confidence            446666 89988875


Done!