Query psy10561
Match_columns 73
No_of_seqs 51 out of 53
Neff 3.3
Searched_HMMs 46136
Date Fri Aug 16 21:33:27 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy10561.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10561hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 KOG4659|consensus 99.6 4.9E-16 1.1E-20 136.8 3.1 48 4-52 440-487 (1899)
2 PF01436 NHL: NHL repeat; Int 77.7 1.2 2.6E-05 22.7 0.8 14 39-52 1-14 (28)
3 PF00058 Ldl_recept_b: Low-den 64.2 3.1 6.6E-05 22.8 0.6 11 38-48 31-41 (42)
4 PF06739 SBBP: Beta-propeller 38.7 15 0.00032 20.0 0.6 16 39-54 12-27 (38)
5 PF02261 Asp_decarbox: Asparta 34.1 8.4 0.00018 26.7 -1.0 24 35-58 16-39 (116)
6 PRK05449 aspartate alpha-decar 27.2 15 0.00032 25.8 -0.7 25 34-58 15-39 (126)
7 PF07806 Nod_GRP: Nodule-speci 27.1 24 0.00053 20.4 0.3 7 66-72 10-16 (38)
8 COG0853 PanD Aspartate 1-decar 27.0 13 0.00028 26.2 -1.0 25 34-58 14-38 (126)
9 cd06383 PBP1_iGluR_AMPA_Like N 25.6 66 0.0014 24.3 2.5 22 45-67 342-363 (368)
10 PRK15382 non-LEE encoded effec 25.1 35 0.00076 27.3 0.9 14 37-50 228-241 (326)
11 PRK15383 type III secretion sy 25.0 35 0.00076 27.3 0.9 14 37-50 236-249 (335)
12 smart00135 LY Low-density lipo 24.6 46 0.00099 16.4 1.0 14 38-51 7-20 (43)
13 cd06919 Asp_decarbox Aspartate 24.3 18 0.00039 24.9 -0.7 25 34-58 14-38 (111)
14 PRK15384 type III secretion sy 24.0 38 0.00082 27.1 0.9 14 37-50 233-246 (336)
15 PF01611 Filo_glycop: Filoviru 23.6 51 0.0011 26.8 1.6 55 7-61 94-157 (364)
16 TIGR00223 panD L-aspartate-alp 23.3 19 0.00042 25.3 -0.7 25 34-58 15-39 (126)
17 PLN03244 alpha-amylase; Provis 23.3 51 0.0011 29.6 1.6 33 38-70 574-606 (872)
18 PF03088 Str_synth: Strictosid 22.5 38 0.00083 21.7 0.6 17 37-53 54-70 (89)
19 PF02822 Antistasin: Antistasi 20.2 77 0.0017 16.2 1.4 17 38-54 7-23 (26)
No 1
>KOG4659|consensus
Probab=99.59 E-value=4.9e-16 Score=136.81 Aligned_cols=48 Identities=46% Similarity=0.828 Sum_probs=46.6
Q ss_pred CCCCCccceEECCcceecCCCCCcCCCCcccchhhhcCCCceeeecCCc
Q psy10561 4 SAPDYNVEPAVGSGERCLPGDEAHCGDGAPARDAKLAYPKGKNYNRSLC 52 (73)
Q Consensus 4 ~d~~~N~EvvaG~Ge~ClP~de~~CGDGG~A~eAtL~~PkGIAvdk~~~ 52 (73)
+|+.+|+|||+|+||+|+|+||+ ||||++|.+|+|++||||||||++.
T Consensus 440 ~d~~~N~evvaG~Ge~Clp~des-CGDGalA~dA~L~~PkGIa~dk~g~ 487 (1899)
T KOG4659|consen 440 QDSRNNYEVVAGDGEVCLPADES-CGDGALAQDAQLIFPKGIAFDKMGN 487 (1899)
T ss_pred cccccCeeEEeccCcCccccccc-cCcchhcccceeccCCceeEccCCc
Confidence 68999999999999999999999 9999999999999999999999985
No 2
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins. For example, the repeat is found in a variety of enzymes of the copper type II, ascorbate-dependent monooxygenase family which catalyse the C terminus alpha-amidation of biological peptides []. In many it occurs in tandem arrays, for example in the ringfinger beta-box, coiled-coil (RBCC) eukaryotic growth regulators []. The 'Brain Tumor' protein (Brat) is one such growth regulator that contains a 6-bladed NHL-repeat beta-propeller [, ]. The NHL repeats are also found in serine/threonine protein kinase (STPK) in diverse range of pathogenic bacteria. These STPK are transmembrane receptors with a intracellular N-terminal kinase domain and extracellular C-terminal sensor domain. In the STPK, PknD, from Mycobacterium tuberculosis, the sensor domain forms a rigid, six-bladed b-propeller composed of NHL repeats with a flexible tether to the transmembrane domain.; GO: 0005515 protein binding; PDB: 3FVZ_A 3FW0_A 1RWL_A 1RWI_A 1Q7F_A.
Probab=77.65 E-value=1.2 Score=22.68 Aligned_cols=14 Identities=21% Similarity=0.418 Sum_probs=11.7
Q ss_pred hcCCCceeeecCCc
Q psy10561 39 LAYPKGKNYNRSLC 52 (73)
Q Consensus 39 L~~PkGIAvdk~~~ 52 (73)
|.+|-|||+|+++-
T Consensus 1 f~~P~gvav~~~g~ 14 (28)
T PF01436_consen 1 FNYPHGVAVDSDGN 14 (28)
T ss_dssp BSSEEEEEEETTSE
T ss_pred CcCCcEEEEeCCCC
Confidence 57899999998774
No 3
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells. The LDL receptor binds LDL and transports it into cells by acidic endocytosis. In order to be internalized, the receptor-ligand complex must first cluster into clathrin-coated pits. Once inside the cell, the LDLR separates from its ligand, which is degraded in the lysosomes, while the receptor returns to the cell surface []. The internal dissociation of the LDLR with its ligand is mediated by proton pumps within the walls of the endosome that lower the pH. The LDLR is a multi-domain protein, containing: The ligand-binding domain contains seven or eight 40-amino acid LDLR class A (cysteine-rich) repeats, each of which contains a coordinated calcium ion and six cysteine residues involved in disulphide bond formation []. Similar domains have been found in other extracellular and membrane proteins []. The second conserved region contains two EGF repeats, followed by six LDLR class B (YWTD) repeats, and another EGF repeat. The LDLR class B repeats each contain a conserved YWTD motif, and is predicted to form a beta-propeller structure []. This region is critical for ligand release and recycling of the receptor []. The third domain is rich in serine and threonine residues and contains clustered O-linked carbohydrate chains. The fourth domain is the hydrophobic transmembrane region. The fifth domain is the cytoplasmic tail that directs the receptor to clathrin-coated pits. LDLR is closely related in structure to several other receptors, including LRP1, LRP1b, megalin/LRP2, VLDL receptor, lipoprotein receptor, MEGF7/LRP4, and LRP8/apolipoprotein E receptor2); these proteins participate in a wide range of physiological processes, including the regulation of lipid metabolism, protection against atherosclerosis, neurodevelopment, and transport of nutrients and vitamins []. This entry represents the LDLR classB (YWTD) repeat, the structure of which has been solved []. The six YWTD repeats together fold into a six-bladed beta-propeller. Each blade of the propeller consists of four antiparallel beta-strands; the innermost strand of each blade is labeled 1 and the outermost strand, 4. The sequence repeats are offset with respect to the blades of the propeller, such that any given 40-residue YWTD repeat spans strands 24 of one propeller blade and strand 1 of the subsequent blade. This offset ensures circularization of the propeller because the last strand of the final sequence repeat acts as an innermost strand 1 of the blade that harbors strands 24 from the first sequence repeat. The repeat is found in a variety of proteins that include, vitellogenin receptor from Drosophila melanogaster, low-density lipoprotein (LDL) receptor [], preproepidermal growth factor, and nidogen (entactin).; PDB: 3S2K_A 3S8Z_A 3S8V_B 4A0P_A 3SOB_B 3S94_B 4DG6_A 3SOV_A 3SOQ_A 1NPE_A ....
Probab=64.19 E-value=3.1 Score=22.84 Aligned_cols=11 Identities=27% Similarity=0.492 Sum_probs=9.8
Q ss_pred hhcCCCceeee
Q psy10561 38 KLAYPKGKNYN 48 (73)
Q Consensus 38 tL~~PkGIAvd 48 (73)
.|.+|.|||||
T Consensus 31 ~l~~P~giaVD 41 (42)
T PF00058_consen 31 DLQHPEGIAVD 41 (42)
T ss_dssp STSSEEEEEEE
T ss_pred CCCCcCEEEEC
Confidence 38999999998
No 4
>PF06739 SBBP: Beta-propeller repeat; InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller. SBBP stands for Seven Bladed Beta Propeller.
Probab=38.66 E-value=15 Score=19.99 Aligned_cols=16 Identities=13% Similarity=0.029 Sum_probs=12.7
Q ss_pred hcCCCceeeecCCcee
Q psy10561 39 LAYPKGKNYNRSLCSR 54 (73)
Q Consensus 39 L~~PkGIAvdk~~~~~ 54 (73)
...|.+||||+.+-.-
T Consensus 12 ~~~~~~IavD~~GNiY 27 (38)
T PF06739_consen 12 QDYGNGIAVDSNGNIY 27 (38)
T ss_pred ceeEEEEEECCCCCEE
Confidence 4578999999998643
No 5
>PF02261 Asp_decarbox: Aspartate decarboxylase; InterPro: IPR003190 Decarboxylation of aspartate is the major route of alanine production in bacteria, and is catalysed by the enzyme aspartate decarboxylase. The enzyme is translated as an inactive proenzyme of two chains, A and B. This family contains both chains of aspartate decarboxylase.; GO: 0004068 aspartate 1-decarboxylase activity, 0006523 alanine biosynthetic process; PDB: 1PYU_C 1AW8_A 1PYQ_B 3TM7_C 1PT1_A 1PQH_A 1PPY_B 1PT0_B 1PQF_A 1PQE_A ....
Probab=34.15 E-value=8.4 Score=26.65 Aligned_cols=24 Identities=25% Similarity=0.394 Sum_probs=19.6
Q ss_pred chhhhcCCCceeeecCCceeeeeE
Q psy10561 35 RDAKLAYPKGKNYNRSLCSRVGIT 58 (73)
Q Consensus 35 ~eAtL~~PkGIAvdk~~~~~~~~~ 58 (73)
++|-|.|--||++|++++...||.
T Consensus 16 T~a~L~Y~GSitID~~Ll~aagi~ 39 (116)
T PF02261_consen 16 TEADLNYEGSITIDEDLLDAAGIL 39 (116)
T ss_dssp -EEETTSTSCEEEEHHHHHHCT--
T ss_pred eccccccceeeEECHHHHHHcCCC
Confidence 678899999999999999988874
No 6
>PRK05449 aspartate alpha-decarboxylase; Provisional
Probab=27.24 E-value=15 Score=25.79 Aligned_cols=25 Identities=24% Similarity=0.380 Sum_probs=22.0
Q ss_pred cchhhhcCCCceeeecCCceeeeeE
Q psy10561 34 ARDAKLAYPKGKNYNRSLCSRVGIT 58 (73)
Q Consensus 34 A~eAtL~~PkGIAvdk~~~~~~~~~ 58 (73)
-++|-|.|=-||++|.+++..+||.
T Consensus 15 VT~a~L~Y~GSitID~~Ll~aagi~ 39 (126)
T PRK05449 15 VTEADLNYEGSITIDEDLLDAAGIL 39 (126)
T ss_pred EeccccccceeEEECHHHHHhcCCC
Confidence 3678899999999999999999884
No 7
>PF07806 Nod_GRP: Nodule-specific GRP repeat; InterPro: IPR012488 The region featured in this family is found repeated in a number of plant proteins, some of which are expressed specifically in nodules formed during symbiotic interactions with certain bacterial species]. Some of these proteins are also termed glycine-rich proteins (GRPs), due to the presence of a glycine-rich C-terminal region in their structures []. Bacterial infection is required for the induction of nodule-specific GRP genes, and it is thought that nodule-specific GRPs may play non-redundant roles required at specific stages of nodule development []. Members of this group of proteins may be cytosolic, whereas others are thought to be membrane-associated [].
Probab=27.07 E-value=24 Score=20.36 Aligned_cols=7 Identities=57% Similarity=1.635 Sum_probs=5.7
Q ss_pred ccccccC
Q psy10561 66 LGFDSWR 72 (73)
Q Consensus 66 ~~~~~~~ 72 (73)
.|+|+||
T Consensus 10 ~g~D~WR 16 (38)
T PF07806_consen 10 IGIDGWR 16 (38)
T ss_pred cccccce
Confidence 4789998
No 8
>COG0853 PanD Aspartate 1-decarboxylase [Coenzyme metabolism]
Probab=26.96 E-value=13 Score=26.22 Aligned_cols=25 Identities=24% Similarity=0.363 Sum_probs=22.1
Q ss_pred cchhhhcCCCceeeecCCceeeeeE
Q psy10561 34 ARDAKLAYPKGKNYNRSLCSRVGIT 58 (73)
Q Consensus 34 A~eAtL~~PkGIAvdk~~~~~~~~~ 58 (73)
-++|-|.|=-||++|.+++...||-
T Consensus 14 VT~A~L~Y~GSitID~dlldaagil 38 (126)
T COG0853 14 VTEADLNYVGSITIDEDLLDAAGIL 38 (126)
T ss_pred EeecccceEEeEEECHHHHhhcCCC
Confidence 3678899999999999999999874
No 9
>cd06383 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors. N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors. While this N-terminal domain belongs to the periplasmic-binding fold type I superfamily, the glutamate-binding domain of the iGluR is structurally homologous to the periplasmic-binding fold type II. The LIVBP-like domain of iGluRs is thought to play a role in the initial assembly of iGluR subunits, but it is not well understood how this domain is arranged and functions in intact iGluR. AMPA receptors consist of four types of subunits (GluR1, GluR2, GluR3, and GluR4) which combine to form a tetramer and play an important roles in mediating the rapid excitatory synaptic current.
Probab=25.63 E-value=66 Score=24.35 Aligned_cols=22 Identities=27% Similarity=0.262 Sum_probs=19.4
Q ss_pred eeeecCCceeeeeEEeeccCCcc
Q psy10561 45 KNYNRSLCSRVGITVGLHSGGLG 67 (73)
Q Consensus 45 IAvdk~~~~~~~~~~~~~~~~~~ 67 (73)
|.+|.+| .|...|++.+++++|
T Consensus 342 i~f~~~g-~R~~~~l~~~~~~~~ 363 (368)
T cd06383 342 VAIDEGS-SVSTKTIGSWSASLG 363 (368)
T ss_pred EEEecCc-eeeeeeeeeEecCCC
Confidence 6788877 999999999999886
No 10
>PRK15382 non-LEE encoded effector protein NleB; Provisional
Probab=25.06 E-value=35 Score=27.26 Aligned_cols=14 Identities=21% Similarity=0.223 Sum_probs=11.7
Q ss_pred hhhcCCCceeeecC
Q psy10561 37 AKLAYPKGKNYNRS 50 (73)
Q Consensus 37 AtL~~PkGIAvdk~ 50 (73)
-+|+.|+|||||-+
T Consensus 228 G~ly~PDGIavhV~ 241 (326)
T PRK15382 228 GVLYAPDGIAVHVD 241 (326)
T ss_pred ccEEcCCceEEEEE
Confidence 47899999999853
No 11
>PRK15383 type III secretion system protein; Provisional
Probab=24.98 E-value=35 Score=27.30 Aligned_cols=14 Identities=29% Similarity=0.368 Sum_probs=11.7
Q ss_pred hhhcCCCceeeecC
Q psy10561 37 AKLAYPKGKNYNRS 50 (73)
Q Consensus 37 AtL~~PkGIAvdk~ 50 (73)
-+|+.|+|||||-+
T Consensus 236 G~ly~PDGIavhV~ 249 (335)
T PRK15383 236 GTLYLPDGIAIHVS 249 (335)
T ss_pred ccEEcCCceEEEEE
Confidence 47899999999853
No 12
>smart00135 LY Low-density lipoprotein-receptor YWTD domain. Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.
Probab=24.61 E-value=46 Score=16.42 Aligned_cols=14 Identities=21% Similarity=0.209 Sum_probs=11.3
Q ss_pred hhcCCCceeeecCC
Q psy10561 38 KLAYPKGKNYNRSL 51 (73)
Q Consensus 38 tL~~PkGIAvdk~~ 51 (73)
.+..|.|||+|-..
T Consensus 7 ~~~~~~~la~d~~~ 20 (43)
T smart00135 7 GLGHPNGLAVDWIE 20 (43)
T ss_pred CCCCcCEEEEeecC
Confidence 67889999999654
No 13
>cd06919 Asp_decarbox Aspartate alpha-decarboxylase or L-aspartate 1-decarboxylase, a pyruvoyl group-dependent decarboxylase in beta-alanine production. Decarboxylation of aspartate is the major route of beta-alanine production in bacteria, and is catalyzed by the enzyme L-aspartate decarboxylase (ADC), EC:4.1.1.11 which requires a pyruvoyl group for its activity. The pyruvoyl cofactor is covalently bound to the enzyme. The protein is synthesized as a proenzyme and cleaved via self-processing at Gly23-Ser24 to yield an alpha chain (C-terminal fragment) and beta chain (N-terminal fragment), and the pyruvoyl group. Beta-alanine is required for the biosynthesis of pantothenate, in which the enzyme plays a critical regulatory role. The active site of the tetrameric enzyme is located at the interface of two subunits, with a Lysine and a Histidine from the beta chain of one subunit forming the active site with residues from the alpha chain of the adjacent subunit. This alignment
Probab=24.29 E-value=18 Score=24.90 Aligned_cols=25 Identities=24% Similarity=0.376 Sum_probs=21.9
Q ss_pred cchhhhcCCCceeeecCCceeeeeE
Q psy10561 34 ARDAKLAYPKGKNYNRSLCSRVGIT 58 (73)
Q Consensus 34 A~eAtL~~PkGIAvdk~~~~~~~~~ 58 (73)
-++|-|.|--||++|.+++...||.
T Consensus 14 VT~a~L~YeGSitID~~Ll~aagi~ 38 (111)
T cd06919 14 VTEADLNYEGSITIDEDLLEAAGIL 38 (111)
T ss_pred EeccccccceeEEECHHHHHhcCCC
Confidence 3678899999999999999998874
No 14
>PRK15384 type III secretion system protein; Provisional
Probab=24.00 E-value=38 Score=27.14 Aligned_cols=14 Identities=14% Similarity=0.237 Sum_probs=11.7
Q ss_pred hhhcCCCceeeecC
Q psy10561 37 AKLAYPKGKNYNRS 50 (73)
Q Consensus 37 AtL~~PkGIAvdk~ 50 (73)
-+|+.|+|||||-+
T Consensus 233 G~ly~PDGIavhV~ 246 (336)
T PRK15384 233 GGIYIPDGIAVHVE 246 (336)
T ss_pred ccEEcCCceEEEEE
Confidence 47899999999853
No 15
>PF01611 Filo_glycop: Filovirus glycoprotein; InterPro: IPR002561 This entry represents an extracellular domain from the envelope glycoprotein of Ebola virus sp. and Lake Victoria marburgvirus. The extracellular domain is also produced as a separate transcript that gives rise to a non-structural, secreted glycoprotein, which is produced in large amounts and has an unknown function []. Processing of the protein may be involved in viral pathogenicity [].; PDB: 3VE0_I 3CSY_O 3S88_I.
Probab=23.64 E-value=51 Score=26.83 Aligned_cols=55 Identities=22% Similarity=0.267 Sum_probs=27.9
Q ss_pred CCccceEECCcceecCCCCCcCCCCccc-----chhhhcCCCceeeecCCc----eeeeeEEee
Q psy10561 7 DYNVEPAVGSGERCLPGDEAHCGDGAPA-----RDAKLAYPKGKNYNRSLC----SRVGITVGL 61 (73)
Q Consensus 7 ~~N~EvvaG~Ge~ClP~de~~CGDGG~A-----~eAtL~~PkGIAvdk~~~----~~~~~~~~~ 61 (73)
+.|+||.==+|..|||.....=-|--++ ..-+=-.|-|+|+||.|. .|+.-||-.
T Consensus 94 CYNleIkk~dGsecLp~pP~gvRgfPrCryVHkvqGtgPcpgg~AfHk~GAFFLYDRlASTviY 157 (364)
T PF01611_consen 94 CYNLEIKKPDGSECLPDPPDGVRGFPRCRYVHKVQGTGPCPGGIAFHKWGAFFLYDRLASTVIY 157 (364)
T ss_dssp EEEEEEBETTSEBSS----TT----S-EEEEEEEEEE----SSEEEETTS-EEEESSEEESS--
T ss_pred eeceEeeCCCCccccCCCCccccCCccceeEeeeccCCCCCCcceeecccceeeecccceeeEe
Confidence 3578888899999997655433333332 233445688999999874 566555533
No 16
>TIGR00223 panD L-aspartate-alpha-decarboxylase. Members of this family are aspartate 1-decarboxylase, the enzyme that makes beta-alanine and C02 from aspartate. Beta-alanine is then used to make the vitamin pantothenate, from which coenzyme A is made. Aspartate 1-decarboxylase is synthesized as a proenzyme, then cleaved to an alpha (C-terminal) and beta (N-terminal) subunit with a pyruvoyl group.
Probab=23.29 E-value=19 Score=25.25 Aligned_cols=25 Identities=24% Similarity=0.353 Sum_probs=22.0
Q ss_pred cchhhhcCCCceeeecCCceeeeeE
Q psy10561 34 ARDAKLAYPKGKNYNRSLCSRVGIT 58 (73)
Q Consensus 34 A~eAtL~~PkGIAvdk~~~~~~~~~ 58 (73)
-++|-|.|=-||++|.+++...||.
T Consensus 15 VT~a~L~Y~GSItID~~Lm~aagi~ 39 (126)
T TIGR00223 15 VTHANLNYEGSITIDEDLLDAAGIL 39 (126)
T ss_pred EeccccccceeEEECHHHHHhcCCC
Confidence 3678899999999999999998874
No 17
>PLN03244 alpha-amylase; Provisional
Probab=23.29 E-value=51 Score=29.60 Aligned_cols=33 Identities=27% Similarity=0.316 Sum_probs=28.3
Q ss_pred hhcCCCceeeecCCceeeeeEEeeccCCccccc
Q psy10561 38 KLAYPKGKNYNRSLCSRVGITVGLHSGGLGFDS 70 (73)
Q Consensus 38 tL~~PkGIAvdk~~~~~~~~~~~~~~~~~~~~~ 70 (73)
...+|.-|+|..+--.--++|.-...||||||.
T Consensus 574 h~~~P~~itIAEDsS~~P~vt~Pv~~GGLGFDY 606 (872)
T PLN03244 574 HALHPKIITIAEDATYYPGLCEPTSQGGLGFDY 606 (872)
T ss_pred HHhCCCeEEEEEcCCCCcCccccCCCCCCCccc
Confidence 456799899998888888889889999999994
No 18
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4.3.3.2 from EC), a key enzyme in alkaloid biosynthesis. It catalyses the Pictet-Spengler stereospecific condensation of tryptamine with secologanin to form strictosidine []. The structure of the native enzyme from the Indian medicinal plant Rauvolfia serpentina (Serpentwood) (Devilpepper) represents the first example of a six-bladed four-stranded beta-propeller fold from the plant kingdom [].; GO: 0016844 strictosidine synthase activity, 0009058 biosynthetic process; PDB: 2FPB_A 2V91_B 2FP8_A 3V1S_B 2FPC_A 2VAQ_A 2FP9_B.
Probab=22.49 E-value=38 Score=21.73 Aligned_cols=17 Identities=18% Similarity=0.266 Sum_probs=13.0
Q ss_pred hhhcCCCceeeecCCce
Q psy10561 37 AKLAYPKGKNYNRSLCS 53 (73)
Q Consensus 37 AtL~~PkGIAvdk~~~~ 53 (73)
--|.+|-|||+.++.=+
T Consensus 54 ~~L~fpNGVals~d~~~ 70 (89)
T PF03088_consen 54 DGLYFPNGVALSPDESF 70 (89)
T ss_dssp EEESSEEEEEE-TTSSE
T ss_pred hCCCccCeEEEcCCCCE
Confidence 35889999999999754
No 19
>PF02822 Antistasin: Antistasin family; InterPro: IPR004094 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties. This group of serine protease inhibitors belong to MEROPS inhibitor family I15, clan IO. They inhibit serine peptidases of the S1 family (IPR001254 from INTERPRO) [] and are characterised by a well conserved pattern of cysteine residues. Many of the proteins that belong to this family are anti-coagulants.; GO: 0004867 serine-type endopeptidase inhibitor activity; PDB: 1HIA_I 1BX8_A 1BX7_A 3BG4_D 1C9P_B 1EJA_B 1SKZ_A.
Probab=20.17 E-value=77 Score=16.23 Aligned_cols=17 Identities=18% Similarity=0.419 Sum_probs=9.9
Q ss_pred hhcCCCceeeecCCcee
Q psy10561 38 KLAYPKGKNYNRSLCSR 54 (73)
Q Consensus 38 tL~~PkGIAvdk~~~~~ 54 (73)
++.=|-|...|++||..
T Consensus 7 ~~~C~~Gf~~D~~GC~~ 23 (26)
T PF02822_consen 7 RMYCPYGFKTDENGCPT 23 (26)
T ss_dssp S---TT-EEE-TTSSEE
T ss_pred CCcCCCcccCCCCCCCc
Confidence 55668899999999963
Done!