Query         psy10561
Match_columns 73
No_of_seqs    51 out of 53
Neff          3.3 
Searched_HMMs 46136
Date          Fri Aug 16 21:33:27 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10561.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10561hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4659|consensus               99.6 4.9E-16 1.1E-20  136.8   3.1   48    4-52    440-487 (1899)
  2 PF01436 NHL:  NHL repeat;  Int  77.7     1.2 2.6E-05   22.7   0.8   14   39-52      1-14  (28)
  3 PF00058 Ldl_recept_b:  Low-den  64.2     3.1 6.6E-05   22.8   0.6   11   38-48     31-41  (42)
  4 PF06739 SBBP:  Beta-propeller   38.7      15 0.00032   20.0   0.6   16   39-54     12-27  (38)
  5 PF02261 Asp_decarbox:  Asparta  34.1     8.4 0.00018   26.7  -1.0   24   35-58     16-39  (116)
  6 PRK05449 aspartate alpha-decar  27.2      15 0.00032   25.8  -0.7   25   34-58     15-39  (126)
  7 PF07806 Nod_GRP:  Nodule-speci  27.1      24 0.00053   20.4   0.3    7   66-72     10-16  (38)
  8 COG0853 PanD Aspartate 1-decar  27.0      13 0.00028   26.2  -1.0   25   34-58     14-38  (126)
  9 cd06383 PBP1_iGluR_AMPA_Like N  25.6      66  0.0014   24.3   2.5   22   45-67    342-363 (368)
 10 PRK15382 non-LEE encoded effec  25.1      35 0.00076   27.3   0.9   14   37-50    228-241 (326)
 11 PRK15383 type III secretion sy  25.0      35 0.00076   27.3   0.9   14   37-50    236-249 (335)
 12 smart00135 LY Low-density lipo  24.6      46 0.00099   16.4   1.0   14   38-51      7-20  (43)
 13 cd06919 Asp_decarbox Aspartate  24.3      18 0.00039   24.9  -0.7   25   34-58     14-38  (111)
 14 PRK15384 type III secretion sy  24.0      38 0.00082   27.1   0.9   14   37-50    233-246 (336)
 15 PF01611 Filo_glycop:  Filoviru  23.6      51  0.0011   26.8   1.6   55    7-61     94-157 (364)
 16 TIGR00223 panD L-aspartate-alp  23.3      19 0.00042   25.3  -0.7   25   34-58     15-39  (126)
 17 PLN03244 alpha-amylase; Provis  23.3      51  0.0011   29.6   1.6   33   38-70    574-606 (872)
 18 PF03088 Str_synth:  Strictosid  22.5      38 0.00083   21.7   0.6   17   37-53     54-70  (89)
 19 PF02822 Antistasin:  Antistasi  20.2      77  0.0017   16.2   1.4   17   38-54      7-23  (26)

No 1  
>KOG4659|consensus
Probab=99.59  E-value=4.9e-16  Score=136.81  Aligned_cols=48  Identities=46%  Similarity=0.828  Sum_probs=46.6

Q ss_pred             CCCCCccceEECCcceecCCCCCcCCCCcccchhhhcCCCceeeecCCc
Q psy10561          4 SAPDYNVEPAVGSGERCLPGDEAHCGDGAPARDAKLAYPKGKNYNRSLC   52 (73)
Q Consensus         4 ~d~~~N~EvvaG~Ge~ClP~de~~CGDGG~A~eAtL~~PkGIAvdk~~~   52 (73)
                      +|+.+|+|||+|+||+|+|+||+ ||||++|.+|+|++||||||||++.
T Consensus       440 ~d~~~N~evvaG~Ge~Clp~des-CGDGalA~dA~L~~PkGIa~dk~g~  487 (1899)
T KOG4659|consen  440 QDSRNNYEVVAGDGEVCLPADES-CGDGALAQDAQLIFPKGIAFDKMGN  487 (1899)
T ss_pred             cccccCeeEEeccCcCccccccc-cCcchhcccceeccCCceeEccCCc
Confidence            68999999999999999999999 9999999999999999999999985


No 2  
>PF01436 NHL:  NHL repeat;  InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins. For example, the repeat is found in a variety of enzymes of the copper type II, ascorbate-dependent monooxygenase family which catalyse the C terminus alpha-amidation of biological peptides []. In many it occurs in tandem arrays, for example in the ringfinger beta-box, coiled-coil (RBCC) eukaryotic growth regulators []. The 'Brain Tumor' protein (Brat) is one such growth regulator that contains a 6-bladed NHL-repeat beta-propeller [, ].  The NHL repeats are also found in serine/threonine protein kinase (STPK) in diverse range of pathogenic bacteria. These STPK are transmembrane receptors with a intracellular N-terminal kinase domain and extracellular C-terminal sensor domain. In the STPK, PknD, from Mycobacterium tuberculosis, the sensor domain forms a rigid, six-bladed b-propeller composed of NHL repeats with a flexible tether to the transmembrane domain.; GO: 0005515 protein binding; PDB: 3FVZ_A 3FW0_A 1RWL_A 1RWI_A 1Q7F_A.
Probab=77.65  E-value=1.2  Score=22.68  Aligned_cols=14  Identities=21%  Similarity=0.418  Sum_probs=11.7

Q ss_pred             hcCCCceeeecCCc
Q psy10561         39 LAYPKGKNYNRSLC   52 (73)
Q Consensus        39 L~~PkGIAvdk~~~   52 (73)
                      |.+|-|||+|+++-
T Consensus         1 f~~P~gvav~~~g~   14 (28)
T PF01436_consen    1 FNYPHGVAVDSDGN   14 (28)
T ss_dssp             BSSEEEEEEETTSE
T ss_pred             CcCCcEEEEeCCCC
Confidence            57899999998774


No 3  
>PF00058 Ldl_recept_b:  Low-density lipoprotein receptor repeat class B;  InterPro: IPR000033  The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells. The LDL receptor binds LDL and transports it into cells by acidic endocytosis. In order to be internalized, the receptor-ligand complex must first cluster into clathrin-coated pits. Once inside the cell, the LDLR separates from its ligand, which is degraded in the lysosomes, while the receptor returns to the cell surface []. The internal dissociation of the LDLR with its ligand is mediated by proton pumps within the walls of the endosome that lower the pH. The LDLR is a multi-domain protein, containing:    The ligand-binding domain contains seven or eight 40-amino acid LDLR class A (cysteine-rich) repeats, each of which contains a coordinated calcium ion and six cysteine residues involved in disulphide bond formation []. Similar domains have been found in other extracellular and membrane proteins [].      The second conserved region contains two EGF repeats, followed by six LDLR class B (YWTD) repeats, and another EGF repeat. The LDLR class B repeats each contain a conserved YWTD motif, and is predicted to form a beta-propeller structure []. This region is critical for ligand release and recycling of the receptor [].     The third domain is rich in serine and threonine residues and contains clustered O-linked carbohydrate chains.     The fourth domain is the hydrophobic transmembrane region.     The fifth domain is the cytoplasmic tail that directs the receptor to clathrin-coated pits.   LDLR is closely related in structure to several other receptors, including LRP1, LRP1b, megalin/LRP2, VLDL receptor, lipoprotein receptor, MEGF7/LRP4, and LRP8/apolipoprotein E receptor2); these proteins participate in a wide range of physiological processes, including the regulation of lipid metabolism, protection against atherosclerosis, neurodevelopment, and transport of nutrients and vitamins []. This entry represents the LDLR classB (YWTD) repeat, the structure of which has been solved []. The six YWTD repeats together fold into a six-bladed beta-propeller. Each blade of the propeller consists of four antiparallel beta-strands; the innermost strand of each blade is labeled 1 and the outermost strand, 4. The sequence repeats are offset with respect to the blades of the propeller, such that any given 40-residue YWTD repeat spans strands 24 of one propeller blade and strand 1 of the subsequent blade. This offset ensures circularization of the propeller because the last strand of the final sequence repeat acts as an innermost strand 1 of the blade that harbors strands 24 from the first sequence repeat. The repeat is found in a variety of proteins that include, vitellogenin receptor from Drosophila melanogaster, low-density lipoprotein (LDL) receptor [], preproepidermal growth factor, and nidogen (entactin).; PDB: 3S2K_A 3S8Z_A 3S8V_B 4A0P_A 3SOB_B 3S94_B 4DG6_A 3SOV_A 3SOQ_A 1NPE_A ....
Probab=64.19  E-value=3.1  Score=22.84  Aligned_cols=11  Identities=27%  Similarity=0.492  Sum_probs=9.8

Q ss_pred             hhcCCCceeee
Q psy10561         38 KLAYPKGKNYN   48 (73)
Q Consensus        38 tL~~PkGIAvd   48 (73)
                      .|.+|.|||||
T Consensus        31 ~l~~P~giaVD   41 (42)
T PF00058_consen   31 DLQHPEGIAVD   41 (42)
T ss_dssp             STSSEEEEEEE
T ss_pred             CCCCcCEEEEC
Confidence            38999999998


No 4  
>PF06739 SBBP:  Beta-propeller repeat;  InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller. SBBP stands for Seven Bladed Beta Propeller.
Probab=38.66  E-value=15  Score=19.99  Aligned_cols=16  Identities=13%  Similarity=0.029  Sum_probs=12.7

Q ss_pred             hcCCCceeeecCCcee
Q psy10561         39 LAYPKGKNYNRSLCSR   54 (73)
Q Consensus        39 L~~PkGIAvdk~~~~~   54 (73)
                      ...|.+||||+.+-.-
T Consensus        12 ~~~~~~IavD~~GNiY   27 (38)
T PF06739_consen   12 QDYGNGIAVDSNGNIY   27 (38)
T ss_pred             ceeEEEEEECCCCCEE
Confidence            4578999999998643


No 5  
>PF02261 Asp_decarbox:  Aspartate decarboxylase;  InterPro: IPR003190 Decarboxylation of aspartate is the major route of alanine production in bacteria, and is catalysed by the enzyme aspartate decarboxylase. The enzyme is translated as an inactive proenzyme of two chains, A and B. This family contains both chains of aspartate decarboxylase.; GO: 0004068 aspartate 1-decarboxylase activity, 0006523 alanine biosynthetic process; PDB: 1PYU_C 1AW8_A 1PYQ_B 3TM7_C 1PT1_A 1PQH_A 1PPY_B 1PT0_B 1PQF_A 1PQE_A ....
Probab=34.15  E-value=8.4  Score=26.65  Aligned_cols=24  Identities=25%  Similarity=0.394  Sum_probs=19.6

Q ss_pred             chhhhcCCCceeeecCCceeeeeE
Q psy10561         35 RDAKLAYPKGKNYNRSLCSRVGIT   58 (73)
Q Consensus        35 ~eAtL~~PkGIAvdk~~~~~~~~~   58 (73)
                      ++|-|.|--||++|++++...||.
T Consensus        16 T~a~L~Y~GSitID~~Ll~aagi~   39 (116)
T PF02261_consen   16 TEADLNYEGSITIDEDLLDAAGIL   39 (116)
T ss_dssp             -EEETTSTSCEEEEHHHHHHCT--
T ss_pred             eccccccceeeEECHHHHHHcCCC
Confidence            678899999999999999988874


No 6  
>PRK05449 aspartate alpha-decarboxylase; Provisional
Probab=27.24  E-value=15  Score=25.79  Aligned_cols=25  Identities=24%  Similarity=0.380  Sum_probs=22.0

Q ss_pred             cchhhhcCCCceeeecCCceeeeeE
Q psy10561         34 ARDAKLAYPKGKNYNRSLCSRVGIT   58 (73)
Q Consensus        34 A~eAtL~~PkGIAvdk~~~~~~~~~   58 (73)
                      -++|-|.|=-||++|.+++..+||.
T Consensus        15 VT~a~L~Y~GSitID~~Ll~aagi~   39 (126)
T PRK05449         15 VTEADLNYEGSITIDEDLLDAAGIL   39 (126)
T ss_pred             EeccccccceeEEECHHHHHhcCCC
Confidence            3678899999999999999999884


No 7  
>PF07806 Nod_GRP:  Nodule-specific GRP repeat;  InterPro: IPR012488 The region featured in this family is found repeated in a number of plant proteins, some of which are expressed specifically in nodules formed during symbiotic interactions with certain bacterial species]. Some of these proteins are also termed glycine-rich proteins (GRPs), due to the presence of a glycine-rich C-terminal region in their structures []. Bacterial infection is required for the induction of nodule-specific GRP genes, and it is thought that nodule-specific GRPs may play non-redundant roles required at specific stages of nodule development []. Members of this group of proteins may be cytosolic, whereas others are thought to be membrane-associated []. 
Probab=27.07  E-value=24  Score=20.36  Aligned_cols=7  Identities=57%  Similarity=1.635  Sum_probs=5.7

Q ss_pred             ccccccC
Q psy10561         66 LGFDSWR   72 (73)
Q Consensus        66 ~~~~~~~   72 (73)
                      .|+|+||
T Consensus        10 ~g~D~WR   16 (38)
T PF07806_consen   10 IGIDGWR   16 (38)
T ss_pred             cccccce
Confidence            4789998


No 8  
>COG0853 PanD Aspartate 1-decarboxylase [Coenzyme metabolism]
Probab=26.96  E-value=13  Score=26.22  Aligned_cols=25  Identities=24%  Similarity=0.363  Sum_probs=22.1

Q ss_pred             cchhhhcCCCceeeecCCceeeeeE
Q psy10561         34 ARDAKLAYPKGKNYNRSLCSRVGIT   58 (73)
Q Consensus        34 A~eAtL~~PkGIAvdk~~~~~~~~~   58 (73)
                      -++|-|.|=-||++|.+++...||-
T Consensus        14 VT~A~L~Y~GSitID~dlldaagil   38 (126)
T COG0853          14 VTEADLNYVGSITIDEDLLDAAGIL   38 (126)
T ss_pred             EeecccceEEeEEECHHHHhhcCCC
Confidence            3678899999999999999999874


No 9  
>cd06383 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors. N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors. While this N-terminal domain belongs to the periplasmic-binding fold type I superfamily, the glutamate-binding domain of the iGluR is structurally homologous to the periplasmic-binding fold type II. The LIVBP-like domain of iGluRs is thought to play a role in the initial assembly of iGluR subunits, but it is not well understood how this domain is arranged and functions in intact iGluR. AMPA receptors consist of four types of subunits (GluR1, GluR2, GluR3, and GluR4) which combine to form a tetramer and play an important roles in mediating the rapid excitatory synaptic current.
Probab=25.63  E-value=66  Score=24.35  Aligned_cols=22  Identities=27%  Similarity=0.262  Sum_probs=19.4

Q ss_pred             eeeecCCceeeeeEEeeccCCcc
Q psy10561         45 KNYNRSLCSRVGITVGLHSGGLG   67 (73)
Q Consensus        45 IAvdk~~~~~~~~~~~~~~~~~~   67 (73)
                      |.+|.+| .|...|++.+++++|
T Consensus       342 i~f~~~g-~R~~~~l~~~~~~~~  363 (368)
T cd06383         342 VAIDEGS-SVSTKTIGSWSASLG  363 (368)
T ss_pred             EEEecCc-eeeeeeeeeEecCCC
Confidence            6788877 999999999999886


No 10 
>PRK15382 non-LEE encoded effector protein NleB; Provisional
Probab=25.06  E-value=35  Score=27.26  Aligned_cols=14  Identities=21%  Similarity=0.223  Sum_probs=11.7

Q ss_pred             hhhcCCCceeeecC
Q psy10561         37 AKLAYPKGKNYNRS   50 (73)
Q Consensus        37 AtL~~PkGIAvdk~   50 (73)
                      -+|+.|+|||||-+
T Consensus       228 G~ly~PDGIavhV~  241 (326)
T PRK15382        228 GVLYAPDGIAVHVD  241 (326)
T ss_pred             ccEEcCCceEEEEE
Confidence            47899999999853


No 11 
>PRK15383 type III secretion system protein; Provisional
Probab=24.98  E-value=35  Score=27.30  Aligned_cols=14  Identities=29%  Similarity=0.368  Sum_probs=11.7

Q ss_pred             hhhcCCCceeeecC
Q psy10561         37 AKLAYPKGKNYNRS   50 (73)
Q Consensus        37 AtL~~PkGIAvdk~   50 (73)
                      -+|+.|+|||||-+
T Consensus       236 G~ly~PDGIavhV~  249 (335)
T PRK15383        236 GTLYLPDGIAIHVS  249 (335)
T ss_pred             ccEEcCCceEEEEE
Confidence            47899999999853


No 12 
>smart00135 LY Low-density lipoprotein-receptor YWTD domain. Type "B" repeats in low-density lipoprotein (LDL) receptor that  plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.
Probab=24.61  E-value=46  Score=16.42  Aligned_cols=14  Identities=21%  Similarity=0.209  Sum_probs=11.3

Q ss_pred             hhcCCCceeeecCC
Q psy10561         38 KLAYPKGKNYNRSL   51 (73)
Q Consensus        38 tL~~PkGIAvdk~~   51 (73)
                      .+..|.|||+|-..
T Consensus         7 ~~~~~~~la~d~~~   20 (43)
T smart00135        7 GLGHPNGLAVDWIE   20 (43)
T ss_pred             CCCCcCEEEEeecC
Confidence            67889999999654


No 13 
>cd06919 Asp_decarbox Aspartate alpha-decarboxylase or L-aspartate 1-decarboxylase, a pyruvoyl group-dependent  decarboxylase in beta-alanine production. Decarboxylation of aspartate is  the major route of beta-alanine production in bacteria, and is catalyzed  by the enzyme L-aspartate decarboxylase (ADC), EC:4.1.1.11 which  requires a pyruvoyl group for its activity. The pyruvoyl cofactor is  covalently bound to the enzyme. The protein is synthesized as a  proenzyme and cleaved via self-processing at Gly23-Ser24 to yield an  alpha chain (C-terminal fragment) and beta chain (N-terminal fragment),  and the pyruvoyl group. Beta-alanine is required for the biosynthesis of  pantothenate, in which the enzyme plays a critical regulatory role. The  active site of the tetrameric enzyme is located at the interface of two  subunits, with a Lysine and a Histidine from the beta chain of one  subunit forming the active site with residues from the alpha chain of  the adjacent subunit. This alignment 
Probab=24.29  E-value=18  Score=24.90  Aligned_cols=25  Identities=24%  Similarity=0.376  Sum_probs=21.9

Q ss_pred             cchhhhcCCCceeeecCCceeeeeE
Q psy10561         34 ARDAKLAYPKGKNYNRSLCSRVGIT   58 (73)
Q Consensus        34 A~eAtL~~PkGIAvdk~~~~~~~~~   58 (73)
                      -++|-|.|--||++|.+++...||.
T Consensus        14 VT~a~L~YeGSitID~~Ll~aagi~   38 (111)
T cd06919          14 VTEADLNYEGSITIDEDLLEAAGIL   38 (111)
T ss_pred             EeccccccceeEEECHHHHHhcCCC
Confidence            3678899999999999999998874


No 14 
>PRK15384 type III secretion system protein; Provisional
Probab=24.00  E-value=38  Score=27.14  Aligned_cols=14  Identities=14%  Similarity=0.237  Sum_probs=11.7

Q ss_pred             hhhcCCCceeeecC
Q psy10561         37 AKLAYPKGKNYNRS   50 (73)
Q Consensus        37 AtL~~PkGIAvdk~   50 (73)
                      -+|+.|+|||||-+
T Consensus       233 G~ly~PDGIavhV~  246 (336)
T PRK15384        233 GGIYIPDGIAVHVE  246 (336)
T ss_pred             ccEEcCCceEEEEE
Confidence            47899999999853


No 15 
>PF01611 Filo_glycop:  Filovirus glycoprotein;  InterPro: IPR002561 This entry represents an extracellular domain from the envelope glycoprotein of Ebola virus sp. and Lake Victoria marburgvirus. The extracellular domain is also produced as a separate transcript that gives rise to a non-structural, secreted glycoprotein, which is produced in large amounts and has an unknown function []. Processing of the protein may be involved in viral pathogenicity [].; PDB: 3VE0_I 3CSY_O 3S88_I.
Probab=23.64  E-value=51  Score=26.83  Aligned_cols=55  Identities=22%  Similarity=0.267  Sum_probs=27.9

Q ss_pred             CCccceEECCcceecCCCCCcCCCCccc-----chhhhcCCCceeeecCCc----eeeeeEEee
Q psy10561          7 DYNVEPAVGSGERCLPGDEAHCGDGAPA-----RDAKLAYPKGKNYNRSLC----SRVGITVGL   61 (73)
Q Consensus         7 ~~N~EvvaG~Ge~ClP~de~~CGDGG~A-----~eAtL~~PkGIAvdk~~~----~~~~~~~~~   61 (73)
                      +.|+||.==+|..|||.....=-|--++     ..-+=-.|-|+|+||.|.    .|+.-||-.
T Consensus        94 CYNleIkk~dGsecLp~pP~gvRgfPrCryVHkvqGtgPcpgg~AfHk~GAFFLYDRlASTviY  157 (364)
T PF01611_consen   94 CYNLEIKKPDGSECLPDPPDGVRGFPRCRYVHKVQGTGPCPGGIAFHKWGAFFLYDRLASTVIY  157 (364)
T ss_dssp             EEEEEEBETTSEBSS----TT----S-EEEEEEEEEE----SSEEEETTS-EEEESSEEESS--
T ss_pred             eeceEeeCCCCccccCCCCccccCCccceeEeeeccCCCCCCcceeecccceeeecccceeeEe
Confidence            3578888899999997655433333332     233445688999999874    566555533


No 16 
>TIGR00223 panD L-aspartate-alpha-decarboxylase. Members of this family are aspartate 1-decarboxylase, the enzyme that makes beta-alanine and C02 from aspartate. Beta-alanine is then used to make the vitamin pantothenate, from which coenzyme A is made. Aspartate 1-decarboxylase is synthesized as a proenzyme, then cleaved to an alpha (C-terminal) and beta (N-terminal) subunit with a pyruvoyl group.
Probab=23.29  E-value=19  Score=25.25  Aligned_cols=25  Identities=24%  Similarity=0.353  Sum_probs=22.0

Q ss_pred             cchhhhcCCCceeeecCCceeeeeE
Q psy10561         34 ARDAKLAYPKGKNYNRSLCSRVGIT   58 (73)
Q Consensus        34 A~eAtL~~PkGIAvdk~~~~~~~~~   58 (73)
                      -++|-|.|=-||++|.+++...||.
T Consensus        15 VT~a~L~Y~GSItID~~Lm~aagi~   39 (126)
T TIGR00223        15 VTHANLNYEGSITIDEDLLDAAGIL   39 (126)
T ss_pred             EeccccccceeEEECHHHHHhcCCC
Confidence            3678899999999999999998874


No 17 
>PLN03244 alpha-amylase; Provisional
Probab=23.29  E-value=51  Score=29.60  Aligned_cols=33  Identities=27%  Similarity=0.316  Sum_probs=28.3

Q ss_pred             hhcCCCceeeecCCceeeeeEEeeccCCccccc
Q psy10561         38 KLAYPKGKNYNRSLCSRVGITVGLHSGGLGFDS   70 (73)
Q Consensus        38 tL~~PkGIAvdk~~~~~~~~~~~~~~~~~~~~~   70 (73)
                      ...+|.-|+|..+--.--++|.-...||||||.
T Consensus       574 h~~~P~~itIAEDsS~~P~vt~Pv~~GGLGFDY  606 (872)
T PLN03244        574 HALHPKIITIAEDATYYPGLCEPTSQGGLGFDY  606 (872)
T ss_pred             HHhCCCeEEEEEcCCCCcCccccCCCCCCCccc
Confidence            456799899998888888889889999999994


No 18 
>PF03088 Str_synth:  Strictosidine synthase;  InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4.3.3.2 from EC), a key enzyme in alkaloid biosynthesis. It catalyses the Pictet-Spengler stereospecific condensation of tryptamine with secologanin to form strictosidine []. The structure of the native enzyme from the Indian medicinal plant Rauvolfia serpentina (Serpentwood) (Devilpepper) represents the first example of a six-bladed four-stranded beta-propeller fold from the plant kingdom [].; GO: 0016844 strictosidine synthase activity, 0009058 biosynthetic process; PDB: 2FPB_A 2V91_B 2FP8_A 3V1S_B 2FPC_A 2VAQ_A 2FP9_B.
Probab=22.49  E-value=38  Score=21.73  Aligned_cols=17  Identities=18%  Similarity=0.266  Sum_probs=13.0

Q ss_pred             hhhcCCCceeeecCCce
Q psy10561         37 AKLAYPKGKNYNRSLCS   53 (73)
Q Consensus        37 AtL~~PkGIAvdk~~~~   53 (73)
                      --|.+|-|||+.++.=+
T Consensus        54 ~~L~fpNGVals~d~~~   70 (89)
T PF03088_consen   54 DGLYFPNGVALSPDESF   70 (89)
T ss_dssp             EEESSEEEEEE-TTSSE
T ss_pred             hCCCccCeEEEcCCCCE
Confidence            35889999999999754


No 19 
>PF02822 Antistasin:  Antistasin family;  InterPro: IPR004094 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.  This group of serine protease inhibitors belong to MEROPS inhibitor family I15, clan IO. They inhibit serine peptidases of the S1 family (IPR001254 from INTERPRO) [] and are characterised by a well conserved pattern of cysteine residues. Many of the proteins that belong to this family are anti-coagulants.; GO: 0004867 serine-type endopeptidase inhibitor activity; PDB: 1HIA_I 1BX8_A 1BX7_A 3BG4_D 1C9P_B 1EJA_B 1SKZ_A.
Probab=20.17  E-value=77  Score=16.23  Aligned_cols=17  Identities=18%  Similarity=0.419  Sum_probs=9.9

Q ss_pred             hhcCCCceeeecCCcee
Q psy10561         38 KLAYPKGKNYNRSLCSR   54 (73)
Q Consensus        38 tL~~PkGIAvdk~~~~~   54 (73)
                      ++.=|-|...|++||..
T Consensus         7 ~~~C~~Gf~~D~~GC~~   23 (26)
T PF02822_consen    7 RMYCPYGFKTDENGCPT   23 (26)
T ss_dssp             S---TT-EEE-TTSSEE
T ss_pred             CCcCCCcccCCCCCCCc
Confidence            55668899999999963


Done!