BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy10576
(151 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3T5V|A Chain A, Sac3:thp1:sem1 Complex
pdb|3T5V|D Chain D, Sac3:thp1:sem1 Complex
Length = 316
Score = 68.9 bits (167), Expect = 1e-12, Method: Compositional matrix adjust.
Identities = 37/110 (33%), Positives = 54/110 (49%), Gaps = 1/110 (0%)
Query: 17 FLWDRLRGIRKDIVQQQLCSVNTANILEQCARFHILCFDRLCGEDASIFDEKINTENLNN 76
FLWDR+R IR+D Q + E+ R H+L + + F + E L+
Sbjct: 35 FLWDRMRSIRQDFTYQNYSGPEAVDCNERIVRIHLLILHIMVKSNVE-FSLQQELEQLHK 93
Query: 77 CLQSLIHMYDDLHAQGLVCPNEPEFRAYEILLKLNRGDIIWEFQQLSPHL 126
L +L +YDD+ + G CPNE EFRAY +L K+ Q+L H+
Sbjct: 94 SLITLSEIYDDVRSSGGTCPNEAEFRAYALLSKIRDPQYDENIQRLPKHI 143
>pdb|3AB4|A Chain A, Crystal Structure Of Feedback Inhibition Resistant Mutant
Of Aspartate Kinase From Corynebacterium Glutamicum In
Complex With Lysine And Threonine
pdb|3AB4|C Chain C, Crystal Structure Of Feedback Inhibition Resistant Mutant
Of Aspartate Kinase From Corynebacterium Glutamicum In
Complex With Lysine And Threonine
pdb|3AB4|E Chain E, Crystal Structure Of Feedback Inhibition Resistant Mutant
Of Aspartate Kinase From Corynebacterium Glutamicum In
Complex With Lysine And Threonine
pdb|3AB4|G Chain G, Crystal Structure Of Feedback Inhibition Resistant Mutant
Of Aspartate Kinase From Corynebacterium Glutamicum In
Complex With Lysine And Threonine
pdb|3AB4|I Chain I, Crystal Structure Of Feedback Inhibition Resistant Mutant
Of Aspartate Kinase From Corynebacterium Glutamicum In
Complex With Lysine And Threonine
pdb|3AB4|K Chain K, Crystal Structure Of Feedback Inhibition Resistant Mutant
Of Aspartate Kinase From Corynebacterium Glutamicum In
Complex With Lysine And Threonine
pdb|3AB4|M Chain M, Crystal Structure Of Feedback Inhibition Resistant Mutant
Of Aspartate Kinase From Corynebacterium Glutamicum In
Complex With Lysine And Threonine
pdb|3AB4|O Chain O, Crystal Structure Of Feedback Inhibition Resistant Mutant
Of Aspartate Kinase From Corynebacterium Glutamicum In
Complex With Lysine And Threonine
Length = 421
Score = 31.2 bits (69), Expect = 0.23, Method: Compositional matrix adjust.
Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 1/65 (1%)
Query: 47 ARFHILCFDRLCGEDASIFDEKINTE-NLNNCLQSLIHMYDDLHAQGLVCPNEPEFRAYE 105
A+ +L GE A +F + E N++ LQ++ + D CP RA E
Sbjct: 265 AKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNVFSVEDGTTDITFTCPRSDGRRAME 324
Query: 106 ILLKL 110
IL KL
Sbjct: 325 ILKKL 329
>pdb|3AB4|B Chain B, Crystal Structure Of Feedback Inhibition Resistant Mutant
Of Aspartate Kinase From Corynebacterium Glutamicum In
Complex With Lysine And Threonine
pdb|3AB4|D Chain D, Crystal Structure Of Feedback Inhibition Resistant Mutant
Of Aspartate Kinase From Corynebacterium Glutamicum In
Complex With Lysine And Threonine
pdb|3AB4|F Chain F, Crystal Structure Of Feedback Inhibition Resistant Mutant
Of Aspartate Kinase From Corynebacterium Glutamicum In
Complex With Lysine And Threonine
pdb|3AB4|H Chain H, Crystal Structure Of Feedback Inhibition Resistant Mutant
Of Aspartate Kinase From Corynebacterium Glutamicum In
Complex With Lysine And Threonine
pdb|3AB4|J Chain J, Crystal Structure Of Feedback Inhibition Resistant Mutant
Of Aspartate Kinase From Corynebacterium Glutamicum In
Complex With Lysine And Threonine
pdb|3AB4|L Chain L, Crystal Structure Of Feedback Inhibition Resistant Mutant
Of Aspartate Kinase From Corynebacterium Glutamicum In
Complex With Lysine And Threonine
pdb|3AB4|N Chain N, Crystal Structure Of Feedback Inhibition Resistant Mutant
Of Aspartate Kinase From Corynebacterium Glutamicum In
Complex With Lysine And Threonine
pdb|3AB4|P Chain P, Crystal Structure Of Feedback Inhibition Resistant Mutant
Of Aspartate Kinase From Corynebacterium Glutamicum In
Complex With Lysine And Threonine
Length = 178
Score = 31.2 bits (69), Expect = 0.26, Method: Compositional matrix adjust.
Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 1/65 (1%)
Query: 47 ARFHILCFDRLCGEDASIFDEKINTE-NLNNCLQSLIHMYDDLHAQGLVCPNEPEFRAYE 105
A+ +L GE A +F + E N++ LQ++ + D CP RA E
Sbjct: 16 AKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNVFSVEDGTTDITFTCPRSDGRRAME 75
Query: 106 ILLKL 110
IL KL
Sbjct: 76 ILKKL 80
>pdb|3AAW|A Chain A, Crystal Structure Of Aspartate Kinase From Corynebacterium
Glutamicum In Complex With Lysine And Threonine
pdb|3AAW|C Chain C, Crystal Structure Of Aspartate Kinase From Corynebacterium
Glutamicum In Complex With Lysine And Threonine
pdb|3AB2|A Chain A, Crystal Structure Of Aspartate Kinase From Corynebacterium
Glutamicum In Complex With Threonine
pdb|3AB2|C Chain C, Crystal Structure Of Aspartate Kinase From Corynebacterium
Glutamicum In Complex With Threonine
pdb|3AB2|E Chain E, Crystal Structure Of Aspartate Kinase From Corynebacterium
Glutamicum In Complex With Threonine
pdb|3AB2|G Chain G, Crystal Structure Of Aspartate Kinase From Corynebacterium
Glutamicum In Complex With Threonine
pdb|3AB2|I Chain I, Crystal Structure Of Aspartate Kinase From Corynebacterium
Glutamicum In Complex With Threonine
pdb|3AB2|K Chain K, Crystal Structure Of Aspartate Kinase From Corynebacterium
Glutamicum In Complex With Threonine
pdb|3AB2|M Chain M, Crystal Structure Of Aspartate Kinase From Corynebacterium
Glutamicum In Complex With Threonine
pdb|3AB2|O Chain O, Crystal Structure Of Aspartate Kinase From Corynebacterium
Glutamicum In Complex With Threonine
Length = 421
Score = 30.8 bits (68), Expect = 0.32, Method: Compositional matrix adjust.
Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 1/65 (1%)
Query: 47 ARFHILCFDRLCGEDASIFDEKINTE-NLNNCLQSLIHMYDDLHAQGLVCPNEPEFRAYE 105
A+ +L GE A +F + E N++ LQ++ + D CP RA E
Sbjct: 265 AKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNVSSVEDGTTDITFTCPRSDGRRAME 324
Query: 106 ILLKL 110
IL KL
Sbjct: 325 ILKKL 329
>pdb|2DTJ|A Chain A, Crystal Structure Of Regulatory Subunit Of Aspartate
Kinase From Corynebacterium Glutamicum
pdb|2DTJ|B Chain B, Crystal Structure Of Regulatory Subunit Of Aspartate
Kinase From Corynebacterium Glutamicum
pdb|3AAW|B Chain B, Crystal Structure Of Aspartate Kinase From Corynebacterium
Glutamicum In Complex With Lysine And Threonine
pdb|3AAW|D Chain D, Crystal Structure Of Aspartate Kinase From Corynebacterium
Glutamicum In Complex With Lysine And Threonine
pdb|3AB2|B Chain B, Crystal Structure Of Aspartate Kinase From Corynebacterium
Glutamicum In Complex With Threonine
pdb|3AB2|D Chain D, Crystal Structure Of Aspartate Kinase From Corynebacterium
Glutamicum In Complex With Threonine
pdb|3AB2|F Chain F, Crystal Structure Of Aspartate Kinase From Corynebacterium
Glutamicum In Complex With Threonine
pdb|3AB2|H Chain H, Crystal Structure Of Aspartate Kinase From Corynebacterium
Glutamicum In Complex With Threonine
pdb|3AB2|J Chain J, Crystal Structure Of Aspartate Kinase From Corynebacterium
Glutamicum In Complex With Threonine
pdb|3AB2|L Chain L, Crystal Structure Of Aspartate Kinase From Corynebacterium
Glutamicum In Complex With Threonine
pdb|3AB2|N Chain N, Crystal Structure Of Aspartate Kinase From Corynebacterium
Glutamicum In Complex With Threonine
pdb|3AB2|P Chain P, Crystal Structure Of Aspartate Kinase From Corynebacterium
Glutamicum In Complex With Threonine
Length = 178
Score = 30.4 bits (67), Expect = 0.35, Method: Compositional matrix adjust.
Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 1/65 (1%)
Query: 47 ARFHILCFDRLCGEDASIFDEKINTE-NLNNCLQSLIHMYDDLHAQGLVCPNEPEFRAYE 105
A+ +L GE A +F + E N++ LQ++ + D CP RA E
Sbjct: 16 AKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNVSSVEDGTTDITFTCPRSDGRRAME 75
Query: 106 ILLKL 110
IL KL
Sbjct: 76 ILKKL 80
>pdb|2UV9|A Chain A, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Alpha Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UV9|B Chain B, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Alpha Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UV9|C Chain C, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Alpha Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UV9|D Chain D, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Alpha Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UV9|E Chain E, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Alpha Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UV9|F Chain F, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Alpha Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UVB|A Chain A, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Alpha Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
pdb|2UVB|B Chain B, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Alpha Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
pdb|2UVB|C Chain C, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Alpha Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
pdb|2UVB|D Chain D, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Alpha Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
pdb|2UVB|E Chain E, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Alpha Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
pdb|2UVB|F Chain F, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Alpha Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
Length = 1878
Score = 29.6 bits (65), Expect = 0.64, Method: Composition-based stats.
Identities = 14/42 (33%), Positives = 28/42 (66%), Gaps = 1/42 (2%)
Query: 11 VSQWYDFLWDRLRGIRKDIVQQQLCSVNTAN-ILEQCARFHI 51
+S +YD ++ RLR + ++IV Q + +N +N +L + ++HI
Sbjct: 411 LSMYYDIIFGRLRVVDREIVSQCIQIMNRSNPLLLEFMQYHI 452
>pdb|1S58|A Chain A, The Structure Of B19 Parvovirus Capsid
Length = 554
Score = 27.7 bits (60), Expect = 2.4, Method: Composition-based stats.
Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 4/36 (11%)
Query: 72 ENLNNCLQSLIHMYDDLHAQGLVCPN----EPEFRA 103
ENL C Q MY+ L+ L P+ +P+FR+
Sbjct: 240 ENLEGCSQHFYEMYNPLYGSRLGVPDTLGGDPKFRS 275
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.140 0.443
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,519,637
Number of Sequences: 62578
Number of extensions: 167340
Number of successful extensions: 414
Number of sequences better than 100.0: 11
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 407
Number of HSP's gapped (non-prelim): 11
length of query: 151
length of database: 14,973,337
effective HSP length: 90
effective length of query: 61
effective length of database: 9,341,317
effective search space: 569820337
effective search space used: 569820337
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 47 (22.7 bits)