BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy10576
         (151 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3T5V|A Chain A, Sac3:thp1:sem1 Complex
 pdb|3T5V|D Chain D, Sac3:thp1:sem1 Complex
          Length = 316

 Score = 68.9 bits (167), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 54/110 (49%), Gaps = 1/110 (0%)

Query: 17  FLWDRLRGIRKDIVQQQLCSVNTANILEQCARFHILCFDRLCGEDASIFDEKINTENLNN 76
           FLWDR+R IR+D   Q        +  E+  R H+L    +   +   F  +   E L+ 
Sbjct: 35  FLWDRMRSIRQDFTYQNYSGPEAVDCNERIVRIHLLILHIMVKSNVE-FSLQQELEQLHK 93

Query: 77  CLQSLIHMYDDLHAQGLVCPNEPEFRAYEILLKLNRGDIIWEFQQLSPHL 126
            L +L  +YDD+ + G  CPNE EFRAY +L K+         Q+L  H+
Sbjct: 94  SLITLSEIYDDVRSSGGTCPNEAEFRAYALLSKIRDPQYDENIQRLPKHI 143


>pdb|3AB4|A Chain A, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
 pdb|3AB4|C Chain C, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
 pdb|3AB4|E Chain E, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
 pdb|3AB4|G Chain G, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
 pdb|3AB4|I Chain I, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
 pdb|3AB4|K Chain K, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
 pdb|3AB4|M Chain M, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
 pdb|3AB4|O Chain O, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
          Length = 421

 Score = 31.2 bits (69), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 1/65 (1%)

Query: 47  ARFHILCFDRLCGEDASIFDEKINTE-NLNNCLQSLIHMYDDLHAQGLVCPNEPEFRAYE 105
           A+  +L      GE A +F    + E N++  LQ++  + D        CP     RA E
Sbjct: 265 AKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNVFSVEDGTTDITFTCPRSDGRRAME 324

Query: 106 ILLKL 110
           IL KL
Sbjct: 325 ILKKL 329


>pdb|3AB4|B Chain B, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
 pdb|3AB4|D Chain D, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
 pdb|3AB4|F Chain F, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
 pdb|3AB4|H Chain H, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
 pdb|3AB4|J Chain J, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
 pdb|3AB4|L Chain L, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
 pdb|3AB4|N Chain N, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
 pdb|3AB4|P Chain P, Crystal Structure Of Feedback Inhibition Resistant Mutant
           Of Aspartate Kinase From Corynebacterium Glutamicum In
           Complex With Lysine And Threonine
          Length = 178

 Score = 31.2 bits (69), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 1/65 (1%)

Query: 47  ARFHILCFDRLCGEDASIFDEKINTE-NLNNCLQSLIHMYDDLHAQGLVCPNEPEFRAYE 105
           A+  +L      GE A +F    + E N++  LQ++  + D        CP     RA E
Sbjct: 16  AKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNVFSVEDGTTDITFTCPRSDGRRAME 75

Query: 106 ILLKL 110
           IL KL
Sbjct: 76  ILKKL 80


>pdb|3AAW|A Chain A, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Lysine And Threonine
 pdb|3AAW|C Chain C, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Lysine And Threonine
 pdb|3AB2|A Chain A, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
 pdb|3AB2|C Chain C, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
 pdb|3AB2|E Chain E, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
 pdb|3AB2|G Chain G, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
 pdb|3AB2|I Chain I, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
 pdb|3AB2|K Chain K, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
 pdb|3AB2|M Chain M, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
 pdb|3AB2|O Chain O, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
          Length = 421

 Score = 30.8 bits (68), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 1/65 (1%)

Query: 47  ARFHILCFDRLCGEDASIFDEKINTE-NLNNCLQSLIHMYDDLHAQGLVCPNEPEFRAYE 105
           A+  +L      GE A +F    + E N++  LQ++  + D        CP     RA E
Sbjct: 265 AKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNVSSVEDGTTDITFTCPRSDGRRAME 324

Query: 106 ILLKL 110
           IL KL
Sbjct: 325 ILKKL 329


>pdb|2DTJ|A Chain A, Crystal Structure Of Regulatory Subunit Of Aspartate
           Kinase From Corynebacterium Glutamicum
 pdb|2DTJ|B Chain B, Crystal Structure Of Regulatory Subunit Of Aspartate
           Kinase From Corynebacterium Glutamicum
 pdb|3AAW|B Chain B, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Lysine And Threonine
 pdb|3AAW|D Chain D, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Lysine And Threonine
 pdb|3AB2|B Chain B, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
 pdb|3AB2|D Chain D, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
 pdb|3AB2|F Chain F, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
 pdb|3AB2|H Chain H, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
 pdb|3AB2|J Chain J, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
 pdb|3AB2|L Chain L, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
 pdb|3AB2|N Chain N, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
 pdb|3AB2|P Chain P, Crystal Structure Of Aspartate Kinase From Corynebacterium
           Glutamicum In Complex With Threonine
          Length = 178

 Score = 30.4 bits (67), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 1/65 (1%)

Query: 47  ARFHILCFDRLCGEDASIFDEKINTE-NLNNCLQSLIHMYDDLHAQGLVCPNEPEFRAYE 105
           A+  +L      GE A +F    + E N++  LQ++  + D        CP     RA E
Sbjct: 16  AKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNVSSVEDGTTDITFTCPRSDGRRAME 75

Query: 106 ILLKL 110
           IL KL
Sbjct: 76  ILKKL 80


>pdb|2UV9|A Chain A, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Alpha Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UV9|B Chain B, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Alpha Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UV9|C Chain C, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Alpha Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UV9|D Chain D, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Alpha Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UV9|E Chain E, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Alpha Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UV9|F Chain F, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Alpha Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UVB|A Chain A, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Alpha Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
 pdb|2UVB|B Chain B, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Alpha Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
 pdb|2UVB|C Chain C, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Alpha Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
 pdb|2UVB|D Chain D, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Alpha Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
 pdb|2UVB|E Chain E, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Alpha Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
 pdb|2UVB|F Chain F, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Alpha Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
          Length = 1878

 Score = 29.6 bits (65), Expect = 0.64,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 28/42 (66%), Gaps = 1/42 (2%)

Query: 11  VSQWYDFLWDRLRGIRKDIVQQQLCSVNTAN-ILEQCARFHI 51
           +S +YD ++ RLR + ++IV Q +  +N +N +L +  ++HI
Sbjct: 411 LSMYYDIIFGRLRVVDREIVSQCIQIMNRSNPLLLEFMQYHI 452


>pdb|1S58|A Chain A, The Structure Of B19 Parvovirus Capsid
          Length = 554

 Score = 27.7 bits (60), Expect = 2.4,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 4/36 (11%)

Query: 72  ENLNNCLQSLIHMYDDLHAQGLVCPN----EPEFRA 103
           ENL  C Q    MY+ L+   L  P+    +P+FR+
Sbjct: 240 ENLEGCSQHFYEMYNPLYGSRLGVPDTLGGDPKFRS 275


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.140    0.443 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,519,637
Number of Sequences: 62578
Number of extensions: 167340
Number of successful extensions: 414
Number of sequences better than 100.0: 11
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 407
Number of HSP's gapped (non-prelim): 11
length of query: 151
length of database: 14,973,337
effective HSP length: 90
effective length of query: 61
effective length of database: 9,341,317
effective search space: 569820337
effective search space used: 569820337
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 47 (22.7 bits)