Psyllid ID: psy1058


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510--
MTPYVKSGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDETLKYFVKSEDYRSVIYNESKAVHGTQGYLPVGLFKNKENNIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIINDQNVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQNTARPDLEIHLLYFQQNDIRNMYLATLIRGTDYITRLEQTEAIRLAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAIITQSDAISYMIGEKCADLVKTSYNIPI
ccccccccccccEEEEcccHHHHHHHHHcccccccEEEEEcccccccccEEccccccccccccccccccccccccccccccccEEcccccccccHHHHHHHHHHHccccccHHHHHHcccccccccccHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHccccccccccccEEEcccEEEEEEEccccEEEEEEEEEcccEEEEEEcccEEEEEccccHHHHHHHHcccccHHHHHHcccccEEEccccccccccccccccEEEcccccHHHHHHHHHHHHHHHHccccccccccccEEEEEEcccccccccccccccccccccccccccccccccEEEccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccEEEEccccEEEEccccccccccccHHHHHHHHHHHHHHHHccccccc
ccccccccccccEEEEEcccHHHHHHHHcccccccEEEEEEcccccccEEEccccEcccccccccEEEEccccccccccccccEEEcccccEEccccHHcHEEEEcccHHHHHHHHHHccccccHHHHHHHHHHHccccccccccccccccccccEEEEccccccccHHHHHHHHHHHHcccccccccccccccccccccccEcccccccHHHHHHHcHHHHcccccEEEEEEEEEEEEEEcccEEEEEEEEEEccEEEEEEEEEEEEEccccccHHHHHHHccEEcHHHHHHccccccEEccccccEEccEEEEEEEEEcHHcHccHHHHHHHHHHHHHHcccccccccHHHcccEEEccccccccccEEEEccccccccccEEcccccccccccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHcccccccccccccccccccEEEccccEEEEccccEEEEcccccccccccccHHHHHHHHHHHHHHHccccccc
mtpyvksgdcfdIIIVGASAAGCVLANRLSEVSSLKVLLIEaggdtpihsripgmssvlslsefdhaylaepsqfaglgvrNARIKItagkglggssAVQNILYqrgtsydyenfaklgyngwgydetlkyfvksedyRSVIYNeskavhgtqgylpvglfknkenNIIREIFETSaqelgypcpkdmndryvdvgfaelpgmtryglrfsaadayltpiagkrtnlyvlkrsKVTKVIINDQNVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLsgigpkahldevkipvkqdlrvgenlklnaqftgpvmafsaplkrtVYSQEMVFKYLVNRigplsnaglwsFTGYIDtlqntarpdLEIHLLYFQQNDIRNMYLATLIRGTDYITRLEQTEAIRLAGGTLMSlnleacsqypwrsthswtcYIRHlttttsnpvgtvmmgnaddpnavvtpdlkvkgikglrvadisvlpnaiitqSDAISYMIGEKCADLVktsynipi
MTPYVKSGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAggdtpihsrIPGMSSVLSLSEFDHAYLAEPSQFAGLGVRNARIKItagkglggssaVQNILYQRGTSYDYENFAKLGYNGWGYDETLKYFVKSEDYRSVIYNESkavhgtqgylpvgLFKNKENNIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAyltpiagkrtnlyvlkrskvtkviindqnvatgveyvnskgetvRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQNTARPDLEIHLLYFQQNDIRNMYLATLIRGTDYITRLEQTEAIRLAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGlrvadisvlpnAIITQSDAISYMIGEKCADLVKTSYNIPI
MTPYVKSGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDETLKYFVKSEDYRSVIYNESKAVHGTQGYLPVGLFKNKENNIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIINDQNVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQNTARPDLEIHLLYFQQNDIRNMYLATLIRGTDYITRLEQTEAIRLAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAIITQSDAISYMIGEKCADLVKTSYNIPI
****VKSGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDETLKYFVKSEDYRSVIYNESKAVHGTQGYLPVGLFKNKENNIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIINDQNVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQNTARPDLEIHLLYFQQNDIRNMYLATLIRGTDYITRLEQTEAIRLAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAIITQSDAISYMIGEKCADLVKTSY****
******S***FDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDETLKYFVKSEDYRSVIYNESKAVHGTQGYLPVGLFKNKENNIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIINDQNVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQNTARPDLEIHLLYFQQNDIRNMYLATLIRGTDYITRLEQTEAIRLAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAIITQSDAISYMIGEKCADLVKTSYNIP*
MTPYVKSGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDETLKYFVKSEDYRSVIYNESKAVHGTQGYLPVGLFKNKENNIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIINDQNVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQNTARPDLEIHLLYFQQNDIRNMYLATLIRGTDYITRLEQTEAIRLAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAIITQSDAISYMIGEKCADLVKTSYNIPI
********DCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDETLKYFVKSEDYRSVIYNESKAVHGTQGYLPVGLFKNKENNIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIINDQNVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQNTARPDLEIHLLYFQQNDIRNMYLATLIRGTDYITRLEQTEAIRLAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAIITQSDAISYMIGEKCADLVKTSYNI**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTPYVKSGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDETLKYFVKSEDYRSVIYNESKAVHGTQGYLPVGLFKNKENNIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIINDQNVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQNTARPDLEIHLLYFQQNDIRNMYLATLIRGTDYITRLEQTEAIRLAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAIITQSDAISYMIGEKCADLVKTSYNIPI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query512 2.2.26 [Sep-21-2011]
P18172625 Glucose dehydrogenase [ac no N/A 0.943 0.772 0.323 3e-62
P18173625 Glucose dehydrogenase [ac no N/A 0.947 0.776 0.317 1e-61
Q8NE62594 Choline dehydrogenase, mi yes N/A 0.935 0.806 0.304 1e-48
A6U6Y8549 Choline dehydrogenase OS= yes N/A 0.914 0.852 0.299 3e-48
Q47944531 L-sorbose 1-dehydrogenase yes N/A 0.916 0.883 0.309 3e-48
C3MIE4549 Choline dehydrogenase OS= no N/A 0.921 0.859 0.300 6e-48
B9JBA2549 Choline dehydrogenase OS= yes N/A 0.914 0.852 0.294 2e-47
Q2KB43549 Choline dehydrogenase OS= no N/A 0.919 0.857 0.290 1e-46
P54223549 Choline dehydrogenase OS= no N/A 0.914 0.852 0.297 1e-46
Q1MJU4549 Choline dehydrogenase OS= no N/A 0.919 0.857 0.290 1e-46
>sp|P18172|DHGL_DROPS Glucose dehydrogenase [acceptor] OS=Drosophila pseudoobscura pseudoobscura GN=Gld PE=3 SV=4 Back     alignment and function desciption
 Score =  239 bits (611), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 181/559 (32%), Positives = 272/559 (48%), Gaps = 76/559 (13%)

Query: 11  FDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLA 70
           +D I++G  +AG V+A+RLSEV   KVLLIEAGGD P+ ++IP M      S+ D+ Y  
Sbjct: 65  YDFIVIGGGSAGSVVASRLSEVPQWKVLLIEAGGDEPVGAQIPSMFLNFIGSDIDYRYNT 124

Query: 71  EPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDETLK 130
           EP + A L     R     GK LGG+S +  ++Y RG   DY+++A  G  GW Y + L 
Sbjct: 125 EPERMACLSSMEQRCYWPRGKVLGGTSVMNGMMYIRGNREDYDDWAAQGNPGWSYQDVLP 184

Query: 131 YFVKSEDYRSVIYNESKAVHGTQGYLPVGLFKNKENNIIREIFETSAQELGYPCPKDMND 190
           +F KSED   +    ++  H   G LPVG F    N  +      + +E+G+   +D+N 
Sbjct: 185 FFKKSEDNLELDAVGTE-YHAKGGLLPVGKFP--YNPPLSYALLKAGEEMGFSV-QDLNG 240

Query: 191 RYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIIND--QNVATG 248
           +    GF       R G+R+S+A A+L P A  R NL++L  + VTKV+I+   +NV  G
Sbjct: 241 QN-STGFMIAQMTARNGIRYSSARAFLRP-ARMRNNLHILLNTTVTKVLIHPGTKNV-VG 297

Query: 249 VEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKI-PVKQDLRVGEN 307
           VE  +  G   ++   KEVI++ GA+ + Q+LLLSG+GPK  L +V + PV     VG+N
Sbjct: 298 VEVSDQFGSMRKILVKKEVIVSGGAVNSPQILLLSGVGPKEDLQKVNVRPVHHLPGVGKN 357

Query: 308 LKLN-AQFTGPVM--AFSAPLKRTVYSQEMVFKYLVNRIGPLSNAGL----------WS- 353
           L  + A FT   +  A +APL           +YL+ R G +S  G+          W+ 
Sbjct: 358 LHNHVAYFTNFFIDDADTAPLNWAT-----AMEYLLFRDGLMSGTGISDVTAKMATRWAD 412

Query: 354 ----------FTGYI----------DTLQNTARPDLEIHLLYFQQNDIRNMYLA------ 387
                     F GY+          + L N +R    I +     N     Y+       
Sbjct: 413 RPNLPDLQLYFGGYLASCARTGQVGELLSNNSR---AIQIFPAVLNPKSRGYITLRSADP 469

Query: 388 ------------------TLIRGTDYITRLEQTEAIRLAGGTLMSLNLEACSQYPWRSTH 429
                             TL+ G  +  RL QT  ++  G  L    ++ C  + + S  
Sbjct: 470 LDPPRIFANYLTDERDVKTLVEGIKFAIRLSQTSPLKQYGMRLDKTVVKGCESHAFASDA 529

Query: 430 SWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAIITQS 489
            W C +R  T   ++  G+  MG + DP AVV  +L+V G++GLRV D S++P      +
Sbjct: 530 YWECAVRQNTGPENHQAGSCKMGPSHDPMAVVNHELRVHGVRGLRVMDTSIMPKVTAGNT 589

Query: 490 DAISYMIGEKCADLVKTSY 508
            A + MI EK A L+K ++
Sbjct: 590 HAPAVMIAEKGAYLLKRAW 608





Drosophila pseudoobscura pseudoobscura (taxid: 46245)
EC: 1EC: .EC: 1EC: .EC: 9EC: 9EC: .EC: 1EC: 0
>sp|P18173|DHGL_DROME Glucose dehydrogenase [acceptor] OS=Drosophila melanogaster GN=Gld PE=3 SV=3 Back     alignment and function description
>sp|Q8NE62|CHDH_HUMAN Choline dehydrogenase, mitochondrial OS=Homo sapiens GN=CHDH PE=2 SV=2 Back     alignment and function description
>sp|A6U6Y8|BETA_SINMW Choline dehydrogenase OS=Sinorhizobium medicae (strain WSM419) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|Q47944|SDH_GLUOY L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans PE=3 SV=1 Back     alignment and function description
>sp|C3MIE4|BETA_RHISN Choline dehydrogenase OS=Rhizobium sp. (strain NGR234) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|B9JBA2|BETA_AGRRK Choline dehydrogenase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|Q2KB43|BETA_RHIEC Choline dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|P54223|BETA_RHIME Choline dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=betA PE=3 SV=2 Back     alignment and function description
>sp|Q1MJU4|BETA_RHIL3 Choline dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=betA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query512
48094605612 PREDICTED: glucose dehydrogenase [accept 0.955 0.799 0.346 2e-75
350425613 618 PREDICTED: glucose dehydrogenase [accept 0.957 0.792 0.353 6e-74
156551752 615 PREDICTED: glucose dehydrogenase [accept 0.960 0.8 0.327 2e-72
242008457 635 glucose dehydrogenase precursor, putativ 0.980 0.790 0.332 2e-72
328699482 642 PREDICTED: glucose dehydrogenase [accept 0.958 0.764 0.337 2e-72
328720713 669 PREDICTED: glucose dehydrogenase [accept 0.949 0.726 0.332 3e-72
270009082 622 hypothetical protein TcasGA2_TC015717 [T 0.960 0.790 0.340 5e-72
189238523 624 PREDICTED: similar to glucose dehydrogen 0.960 0.788 0.340 6e-72
91086973 665 PREDICTED: similar to AGAP003782-PA [Tri 0.966 0.744 0.342 1e-71
383860468 621 PREDICTED: glucose dehydrogenase [accept 0.957 0.789 0.331 2e-71
>gi|48094605|ref|XP_394221.1| PREDICTED: glucose dehydrogenase [acceptor] [Apis mellifera] Back     alignment and taxonomy information
 Score =  289 bits (740), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 197/569 (34%), Positives = 287/569 (50%), Gaps = 80/569 (14%)

Query: 11  FDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLA 70
           +D I+VG  +AG V+A+RLSEVS+  VLL+EAGGD    S +P +S  + L++ D  Y  
Sbjct: 51  YDFIVVGGGSAGAVVASRLSEVSNWTVLLLEAGGDETEISDVPLLSGYMQLTDMDWKYQT 110

Query: 71  EPSQFAG--LGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDET 128
            P   +   L +   R     GK LGGSS +  ++Y RG   DY+N+A+LG  GW Y++ 
Sbjct: 111 SPPTTSAYCLAMIGDRCNWPRGKVLGGSSVLNAMVYVRGNRRDYDNWARLGNTGWSYEDV 170

Query: 129 LKYFVKSEDYRSVIYNESKAVHGTQGYLPVGLFKNKENNIIREIFETSAQELGYPCPKDM 188
           L YF+KSED R+  Y      H T GYL V   ++   + +   F  + QELGY   +D+
Sbjct: 171 LPYFLKSEDNRNP-YLARTPYHATGGYLTVQ--ESPWRSPLSIAFLQAGQELGY-ANRDV 226

Query: 189 NDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIINDQNVATG 248
           N  Y   GF    G  R G R S A A+L P+   R NL+V  +++  +++ N+   ATG
Sbjct: 227 NGAY-QTGFMLNQGTIRRGSRCSTAKAFLRPVK-NRPNLHVAMKTQALRIVFNEGRRATG 284

Query: 249 VEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLRVGENL 308
           VE V   G    +   +E++L+AGAI   QLL+LSGIGPK HL E  IPV  DLRVG++L
Sbjct: 285 VE-VLRYGRHHFIRTRREIVLSAGAINTPQLLMLSGIGPKEHLAEFGIPVISDLRVGDHL 343

Query: 309 KLNAQFTGPVMAFSAP--LKRTVYSQ-EMVFKYLVNRIGPLSNAGL----WSFTGYIDTL 361
           + +    G       P  LKR  +    ++ +Y+++  GP++++G+    +  T Y D +
Sbjct: 344 QDHVGLGGLTFVIDEPVSLKRDRFQTLSVMMQYVLHERGPMTDSGVEGVAFVNTRYADKM 403

Query: 362 QNTARPDLEIH---------------LLYFQQNDIRNMY-----------LATLIR---- 391
            +   PD++ H               +L  +++    MY           L  L+R    
Sbjct: 404 DDY--PDIQFHFLPSSINSDGEQIKKILGLRESVYNTMYKPLTGADTWSILPLLLRPKSS 461

Query: 392 ----------------GTDYITRLEQ----------------TEAIRLAGGTLMSLNLEA 419
                             +Y TR E                 T A R  G    ++ +  
Sbjct: 462 GWIRLKSRNPLVYPDINPNYFTRKEDVDVLVDGIRIAMSVSNTTAFRRFGSRPHTIRMPG 521

Query: 420 CSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADIS 479
           C +YP+ +   W C IRH T T  +PVGT  MG   DP AVV P L+V G+KGLRVAD S
Sbjct: 522 CHRYPFDTYDYWECAIRHFTFTIYHPVGTCKMGPRSDPTAVVDPRLRVYGVKGLRVADGS 581

Query: 480 VLPNAIITQSDAISYMIGEKCADLVKTSY 508
           ++P  +    +A   MIGEK +D+VK  +
Sbjct: 582 IMPEIVSGNPNAPIIMIGEKASDMVKEDW 610




Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom:

>gi|350425613|ref|XP_003494176.1| PREDICTED: glucose dehydrogenase [acceptor]-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|156551752|ref|XP_001602133.1| PREDICTED: glucose dehydrogenase [acceptor]-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|242008457|ref|XP_002425020.1| glucose dehydrogenase precursor, putative [Pediculus humanus corporis] gi|212508669|gb|EEB12282.1| glucose dehydrogenase precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|328699482|ref|XP_001951636.2| PREDICTED: glucose dehydrogenase [acceptor]-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328720713|ref|XP_001945176.2| PREDICTED: glucose dehydrogenase [acceptor]-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|270009082|gb|EFA05530.1| hypothetical protein TcasGA2_TC015717 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189238523|ref|XP_972430.2| PREDICTED: similar to glucose dehydrogenase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91086973|ref|XP_973336.1| PREDICTED: similar to AGAP003782-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383860468|ref|XP_003705711.1| PREDICTED: glucose dehydrogenase [acceptor]-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query512
FB|FBgn0030593623 CG9512 [Drosophila melanogaste 0.722 0.593 0.342 8.5e-77
FB|FBgn0030594646 CG9509 [Drosophila melanogaste 0.714 0.566 0.354 1.8e-74
FB|FBgn0030590 703 CG9518 [Drosophila melanogaste 0.695 0.506 0.386 2.9e-74
FB|FBgn0030598626 CG9503 [Drosophila melanogaste 0.701 0.573 0.364 2e-73
FB|FBgn0039415616 CG6142 [Drosophila melanogaste 0.693 0.576 0.375 6e-70
FB|FBgn0030589622 CG9519 [Drosophila melanogaste 0.783 0.644 0.347 3.3e-69
FB|FBgn0030591865 CG9517 [Drosophila melanogaste 0.689 0.408 0.353 1.5e-67
FB|FBgn0030588621 CG9521 [Drosophila melanogaste 0.689 0.568 0.379 6.8e-67
FB|FBgn0001112625 Gld "Glucose dehydrogenase" [D 0.683 0.56 0.364 1.1e-66
FB|FBgn0030596633 CG12398 [Drosophila melanogast 0.607 0.491 0.388 4.8e-64
FB|FBgn0030593 CG9512 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 525 (189.9 bits), Expect = 8.5e-77, Sum P(2) = 8.5e-77
 Identities = 132/385 (34%), Positives = 203/385 (52%)

Query:    11 FDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLA 70
             +D I++G+  +G V+A RL+EV + KVLL+EAGGD PI +           SE+D  Y +
Sbjct:    58 YDFIVIGSGTSGAVVAGRLAEVKNWKVLLLEAGGDPPIETEFVAWHMATQFSEWDWQYHS 117

Query:    71 EPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDETLK 130
             +P+  A + ++        GK LGG++ +  ++Y RGT  D++++ + G  GWGYDE LK
Sbjct:   118 KPNGRACMAMKGESCHWPRGKMLGGTNGMNAMIYARGTRKDFDDWEERGNPGWGYDEVLK 177

Query:   131 YFVKSEDYRSVIYNESKAVHGTQGYLPVGLFKNKENNIIREIFETSAQELGYPCPKDMND 190
             +F K+ED RS   +     HG  G  P+GL     +N  R       QE+GY    D  +
Sbjct:   178 HFRKAEDLRSTRPDYKPGDHGVGG--PMGLNNYVSDNEFRTTIRAGMQEMGYGSAPDFTE 235

Query:   191 RYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRT-NLYVLKRSKVTKVIINDQNVATGV 249
                 VG  ++ G    G R + A ++L     K T NL++L+ + V K+ ++  N A  V
Sbjct:   236 GSF-VGQMDILGTQDGGRRITTARSHLK----KNTPNLHILRHAHVKKINLDRNNRAESV 290

Query:   250 EYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLRVGENLK 309
              +V+   +   V A+KEVI++AGAI + Q+LLLSGIGP  HL  + IPVK DL VGENLK
Sbjct:   291 TFVHRGKKEYTVKASKEVIVSAGAIGSPQILLLSGIGPADHLKSLGIPVKLDLPVGENLK 350

Query:   310 LNAQFTGPVMAFSAPLKRTVYSQEMV---FKYLVNRIGPLSNAGLWSFTGYIDTLQ-NTA 365
              +A     +        R    +E+V   +  L+ R   L +    + TG+I+T      
Sbjct:   351 DHASLP-MIFQIDKSTARKPTEEELVDAMYNLLMGRYSKLLHHEATALTGFINTTSIEGP 409

Query:   366 RPDLEIHLLY--FQQNDIRNMYLAT 388
              PD++    +   Q  +++    AT
Sbjct:   410 NPDIQTTNFFSLMQSPELKGYVAAT 434


GO:0008812 "choline dehydrogenase activity" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0006066 "alcohol metabolic process" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
FB|FBgn0030594 CG9509 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030590 CG9518 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030598 CG9503 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039415 CG6142 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030589 CG9519 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030591 CG9517 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030588 CG9521 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0001112 Gld "Glucose dehydrogenase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030596 CG12398 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B2FQ89BETA_STRMK1, ., 1, ., 9, 9, ., 10.29690.92960.85yesN/A
Q47944SDH_GLUOY1, ., 1, ., 9, 9, ., 3, 20.30900.91600.8832yesN/A
P64264Y1310_MYCBO1, ., 1, ., -, ., -0.31390.91210.8844yesN/A
P64263Y1279_MYCTU1, ., 1, ., -, ., -0.31390.91210.8844yesN/A
A5WA97BETA_PSEP11, ., 1, ., 9, 9, ., 10.30820.93550.8477yesN/A
A6U6Y8BETA_SINMW1, ., 1, ., 9, 9, ., 10.29980.91400.8524yesN/A
B5Y008BETA_KLEP31, ., 1, ., 9, 9, ., 10.31300.93350.8628yesN/A
A7MFA8BETA_CROS81, ., 1, ., 9, 9, ., 10.30210.93940.8604yesN/A
B1LIJ7BETA_ECOSM1, ., 1, ., 9, 9, ., 10.30750.93940.8558yesN/A
Q8UH55BETA_AGRT51, ., 1, ., 9, 9, ., 10.28850.93350.8706yesN/A
B7N8L3BETA_ECOLU1, ., 1, ., 9, 9, ., 10.31290.93940.8651yesN/A
A7ZWV4BETA_ECOHS1, ., 1, ., 9, 9, ., 10.31290.93940.8651yesN/A
Q0T7N0BETA_SHIF81, ., 1, ., 9, 9, ., 10.31090.92770.8543yesN/A
Q8NE62CHDH_HUMAN1, ., 1, ., 9, 9, ., 10.30460.93550.8063yesN/A
A4XPI5BETA_PSEMY1, ., 1, ., 9, 9, ., 10.29290.94530.8566yesN/A
B1J0W6BETA_ECOLC1, ., 1, ., 9, 9, ., 10.30750.93940.8651yesN/A
B7M2V5BETA_ECO8A1, ., 1, ., 9, 9, ., 10.31290.93940.8651yesN/A
B5Z1R0BETA_ECO5E1, ., 1, ., 9, 9, ., 10.31650.93940.8558yesN/A
C6DKY4BETA_PECCP1, ., 1, ., 9, 9, ., 10.30570.93550.8568yesN/A
A7ZI50BETA_ECO241, ., 1, ., 9, 9, ., 10.31290.93940.8651yesN/A
B7MCD0BETA_ECO451, ., 1, ., 9, 9, ., 10.30750.93940.8558yesN/A
Q1RFM3BETA_ECOUT1, ., 1, ., 9, 9, ., 10.30750.93940.8558yesN/A
B1XE52BETA_ECODH1, ., 1, ., 9, 9, ., 10.30750.93940.8651yesN/A
B7UJG4BETA_ECO271, ., 1, ., 9, 9, ., 10.30920.94530.8705yesN/A
B6I074BETA_ECOSE1, ., 1, ., 9, 9, ., 10.31290.93940.8651yesN/A
B4EX94BETA_PROMH1, ., 1, ., 9, 9, ., 10.30280.93550.8630yesN/A
Q8FKI9BETA_ECOL61, ., 1, ., 9, 9, ., 10.30930.93940.8651yesN/A
B7L439BETA_ECO551, ., 1, ., 9, 9, ., 10.31290.93940.8651yesN/A
A6T613BETA_KLEP71, ., 1, ., 9, 9, ., 10.31180.93550.8646yesN/A
Q8BJ64CHDH_MOUSE1, ., 1, ., 9, 9, ., 10.28590.93750.8053yesN/A
B9JBA2BETA_AGRRK1, ., 1, ., 9, 9, ., 10.29430.91400.8524yesN/A
Q4K4K7BETA_PSEF51, ., 1, ., 9, 9, ., 10.29820.93160.8412yesN/A
Q0TKW1BETA_ECOL51, ., 1, ., 9, 9, ., 10.30750.93940.8651yesN/A
B4SHV9BETA_STRM51, ., 1, ., 9, 9, ., 10.29870.92960.85yesN/A
Q3K5H3BETA_PSEPF1, ., 1, ., 9, 9, ., 10.30550.92570.8359yesN/A
B3PTE0BETA_RHIE61, ., 1, ., 9, 9, ., 10.29250.91400.8524yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query512
COG2303542 COG2303, BetA, Choline dehydrogenase and related f 1e-73
PRK02106560 PRK02106, PRK02106, choline dehydrogenase; Validat 1e-68
TIGR01810532 TIGR01810, betA, choline dehydrogenase 1e-56
TIGR03970487 TIGR03970, Rv0697, dehydrogenase, Rv0697 family 8e-48
pfam00732218 pfam00732, GMC_oxred_N, GMC oxidoreductase 6e-29
PLN02785587 PLN02785, PLN02785, Protein HOTHEAD 2e-19
pfam05199139 pfam05199, GMC_oxred_C, GMC oxidoreductase 7e-18
PRK02106560 PRK02106, PRK02106, choline dehydrogenase; Validat 4e-12
TIGR01810532 TIGR01810, betA, choline dehydrogenase 3e-11
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 0.001
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 0.002
pfam05834374 pfam05834, Lycopene_cycl, Lycopene cyclase protein 0.003
PTZ00367567 PTZ00367, PTZ00367, squalene epoxidase; Provisiona 0.003
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 0.004
>gnl|CDD|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
 Score =  242 bits (619), Expect = 1e-73
 Identities = 160/544 (29%), Positives = 233/544 (42%), Gaps = 66/544 (12%)

Query: 11  FDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGG-DTPIHSRIPGMSSVLSLSEFDHAYL 69
           +D +IVG+ +AG VLA RLS+ + L VL++EAGG D     ++P   + L        Y 
Sbjct: 8   YDYVIVGSGSAGSVLAARLSD-AGLSVLVLEAGGPDRRPLIQMPAAYAFL---MNGPRYD 63

Query: 70  AEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKL-GYNGWGYDET 128
                     +R   +    GK LGGSS++  ++Y RG   D++ +A+  G  GW YD+ 
Sbjct: 64  WGFRTEPEPHLRGRELAWPRGKVLGGSSSINGMVYVRGHPEDFDAWAQESGAPGWPYDDV 123

Query: 129 LKYFVKSEDYRSVIYNESKAVHGTQGYLPVGLFKNKENNIIREIFETSAQELGYPCPKDM 188
           L YF ++ED   V   + +  HG  G  P+ +   +  N I   F  + ++LG+P   D 
Sbjct: 124 LPYFKRAEDLLGVGGQDLRTWHGGGG--PLPVSPPRSPNPIARAFIEAGEQLGFPTTPDP 181

Query: 189 NDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIINDQNVATG 248
           N    + GF         G R+SAA AYL P   KR NL +L  ++V ++++ + + A G
Sbjct: 182 NGADQE-GFGPYCVTICNGRRWSAARAYLKPAL-KRPNLTLLTGARVRRILL-EGDRAVG 238

Query: 249 VEYVNSKGETVRVT-ANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLR-VGE 306
           VE     G T+    A +EV+L AGAI + +LLLLSGIGP  HL E  I V   L  VG+
Sbjct: 239 VEVEIGDGGTIETAVAAREVVLAAGAINSPKLLLLSGIGPADHLLEHGIDVVGRLPGVGQ 298

Query: 307 NLK----LNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLS----NAGLWSFTGYI 358
           NL+    +   F        + L           +YL+ R GP +      G        
Sbjct: 299 NLQDHLEIYVAFEATEPTNDSVLSLFSKLGIGADRYLLTRDGPGATNHFEGGFVRSGP-- 356

Query: 359 DTLQNTARPDLEIHL--LYFQQNDIRNMYLATLI--------RGT--------------- 393
                   PD + H   L          +  TL         RG+               
Sbjct: 357 ----AGEYPDGQYHFAPLPLAIRAAGAEHGFTLHVGPMRPKSRGSVTLRSPDPDNRPVID 412

Query: 394 -----DYITRLEQTEAIRLAGG-----TLMSLNLEACSQYPWRSTHSWTC-YIRHLTTTT 442
                    R      IRL         L +      +  P  +T       IR L  T 
Sbjct: 413 PNYLSAEGDRAIFRAGIRLTREIIGQPALDARRKAELAPGPRVTTDEDISAAIRFLARTA 472

Query: 443 SNPVGTVMMGNADDPNAVV-TPDLKVKGIKGLRVADISVLPNAIITQSDAISYMIGEKCA 501
            +P+GT  MG   DP AVV  P L+V G++ LRV D SV+P +     +     + E+ A
Sbjct: 473 YHPMGTCRMG--SDPAAVVDDPYLRVHGLENLRVVDASVMPTSTGVNPNLTIIALAERAA 530

Query: 502 DLVK 505
           D + 
Sbjct: 531 DHIL 534


Length = 542

>gnl|CDD|235000 PRK02106, PRK02106, choline dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|233581 TIGR01810, betA, choline dehydrogenase Back     alignment and domain information
>gnl|CDD|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family Back     alignment and domain information
>gnl|CDD|216089 pfam00732, GMC_oxred_N, GMC oxidoreductase Back     alignment and domain information
>gnl|CDD|215420 PLN02785, PLN02785, Protein HOTHEAD Back     alignment and domain information
>gnl|CDD|218493 pfam05199, GMC_oxred_C, GMC oxidoreductase Back     alignment and domain information
>gnl|CDD|235000 PRK02106, PRK02106, choline dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|233581 TIGR01810, betA, choline dehydrogenase Back     alignment and domain information
>gnl|CDD|235787 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|218770 pfam05834, Lycopene_cycl, Lycopene cyclase protein Back     alignment and domain information
>gnl|CDD|240384 PTZ00367, PTZ00367, squalene epoxidase; Provisional Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 512
KOG1238|consensus623 100.0
PRK02106560 choline dehydrogenase; Validated 100.0
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 100.0
COG2303542 BetA Choline dehydrogenase and related flavoprotei 100.0
PLN02785587 Protein HOTHEAD 100.0
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 100.0
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 100.0
PF05199144 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR0078 99.94
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.57
PRK07121492 hypothetical protein; Validated 99.57
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.56
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 99.55
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 99.54
PRK08274466 tricarballylate dehydrogenase; Validated 99.54
PRK06481506 fumarate reductase flavoprotein subunit; Validated 99.54
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.53
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 99.48
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 99.47
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 99.47
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.47
PRK06175433 L-aspartate oxidase; Provisional 99.46
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 99.46
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 99.45
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 99.44
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.44
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 99.43
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.42
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 99.42
PRK12839572 hypothetical protein; Provisional 99.41
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 99.4
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 99.39
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 99.39
PRK07804541 L-aspartate oxidase; Provisional 99.38
PLN02815 594 L-aspartate oxidase 99.38
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 99.38
PRK12842574 putative succinate dehydrogenase; Reviewed 99.38
COG2081408 Predicted flavoproteins [General function predicti 99.37
COG0579429 Predicted dehydrogenase [General function predicti 99.37
PRK08275 554 putative oxidoreductase; Provisional 99.37
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 99.36
PRK07395 553 L-aspartate oxidase; Provisional 99.36
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 99.36
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 99.36
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 99.35
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 99.35
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 99.35
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 99.35
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 99.35
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 99.35
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 99.34
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 99.34
PRK08071510 L-aspartate oxidase; Provisional 99.33
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 99.33
PRK09077536 L-aspartate oxidase; Provisional 99.32
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 99.31
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 99.31
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 99.3
PRK07512513 L-aspartate oxidase; Provisional 99.28
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 99.28
PTZ00383497 malate:quinone oxidoreductase; Provisional 99.27
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 99.26
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.24
PLN02464627 glycerol-3-phosphate dehydrogenase 99.24
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 99.22
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 99.21
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.21
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 99.2
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 99.2
PRK11728393 hydroxyglutarate oxidase; Provisional 99.2
PLN02661357 Putative thiazole synthesis 99.19
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 99.18
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 99.18
PRK08401466 L-aspartate oxidase; Provisional 99.18
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 99.16
PRK05257494 malate:quinone oxidoreductase; Validated 99.15
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 99.15
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 99.14
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 99.14
PRK13339497 malate:quinone oxidoreductase; Reviewed 99.13
COG3573552 Predicted oxidoreductase [General function predict 99.13
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.12
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 99.11
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 99.1
PRK11259376 solA N-methyltryptophan oxidase; Provisional 99.1
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 99.09
KOG4254|consensus561 99.09
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 99.07
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 99.05
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 99.01
PRK10157428 putative oxidoreductase FixC; Provisional 98.99
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 98.99
KOG2820|consensus399 98.99
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.97
KOG0042|consensus 680 98.97
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.91
PRK10015429 oxidoreductase; Provisional 98.9
KOG1298|consensus509 98.87
PRK13977576 myosin-cross-reactive antigen; Provisional 98.86
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.86
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.86
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.86
KOG2404|consensus477 98.85
TIGR02730493 carot_isom carotene isomerase. Members of this fam 98.83
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.83
PRK06185407 hypothetical protein; Provisional 98.78
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.77
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.74
PRK07208479 hypothetical protein; Provisional 98.72
PLN02985514 squalene monooxygenase 98.72
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.7
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.69
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.68
PRK06126545 hypothetical protein; Provisional 98.67
KOG2844|consensus 856 98.65
KOG2415|consensus 621 98.65
PRK06370463 mercuric reductase; Validated 98.64
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.63
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.63
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.63
PRK08244493 hypothetical protein; Provisional 98.62
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 98.61
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 98.6
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.6
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 98.58
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.55
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; 98.55
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.54
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.53
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 98.53
PLN02507499 glutathione reductase 98.53
PRK06847375 hypothetical protein; Provisional 98.52
TIGR02053463 MerA mercuric reductase. This model represents the 98.52
PRK06116450 glutathione reductase; Validated 98.51
PRK06184502 hypothetical protein; Provisional 98.51
PRK09126392 hypothetical protein; Provisional 98.5
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.5
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.49
PRK06834488 hypothetical protein; Provisional 98.49
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.49
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.49
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.48
PRK07045388 putative monooxygenase; Reviewed 98.47
PLN02697529 lycopene epsilon cyclase 98.46
KOG2665|consensus453 98.46
PLN02463447 lycopene beta cyclase 98.46
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.45
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.45
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.44
PRK11445351 putative oxidoreductase; Provisional 98.44
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.44
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 98.43
PRK07233434 hypothetical protein; Provisional 98.43
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.4
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 98.4
PLN02612567 phytoene desaturase 98.39
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 98.38
PRK08132547 FAD-dependent oxidoreductase; Provisional 98.37
PRK07588391 hypothetical protein; Provisional 98.37
PRK07190487 hypothetical protein; Provisional 98.36
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.36
KOG2853|consensus509 98.36
PRK08163396 salicylate hydroxylase; Provisional 98.36
PRK07236386 hypothetical protein; Provisional 98.35
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.33
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.31
KOG2852|consensus380 98.31
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 98.31
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 98.3
PRK06753373 hypothetical protein; Provisional 98.25
TIGR01816 565 sdhA_forward succinate dehydrogenase, flavoprotein 98.24
PRK05868372 hypothetical protein; Validated 98.2
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.2
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 98.19
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.19
PRK07538413 hypothetical protein; Provisional 98.17
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 98.15
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.13
PLN02487569 zeta-carotene desaturase 98.13
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.12
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.1
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 98.08
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 98.06
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 98.06
PRK09897534 hypothetical protein; Provisional 98.05
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 98.04
PTZ00058561 glutathione reductase; Provisional 98.04
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.03
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.03
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.01
KOG1335|consensus506 98.0
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.0
PRK08013400 oxidoreductase; Provisional 98.0
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.99
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 97.99
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 97.99
KOG0029|consensus501 97.98
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.96
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.96
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.95
KOG0405|consensus478 97.95
KOG1399|consensus448 97.94
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.94
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.94
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.92
KOG2311|consensus 679 97.92
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 97.9
PRK14694468 putative mercuric reductase; Provisional 97.9
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 97.89
PTZ00367567 squalene epoxidase; Provisional 97.89
PRK13748561 putative mercuric reductase; Provisional 97.89
PRK06996398 hypothetical protein; Provisional 97.88
PLN02546558 glutathione reductase 97.88
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 97.87
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.84
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 97.83
PTZ00153659 lipoamide dehydrogenase; Provisional 97.81
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 97.81
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.79
PTZ00052499 thioredoxin reductase; Provisional 97.79
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 97.78
PLN02268435 probable polyamine oxidase 97.77
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.74
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.72
PRK08294634 phenol 2-monooxygenase; Provisional 97.71
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 97.7
COG1231450 Monoamine oxidase [Amino acid transport and metabo 97.69
PLN02576496 protoporphyrinogen oxidase 97.68
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.67
COG3349485 Uncharacterized conserved protein [Function unknow 97.67
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.65
PRK10262321 thioredoxin reductase; Provisional 97.63
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.63
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 97.61
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 97.59
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.59
PLN02676487 polyamine oxidase 97.58
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.56
PLN02568539 polyamine oxidase 97.56
PRK09564444 coenzyme A disulfide reductase; Reviewed 97.54
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 97.54
PRK14727479 putative mercuric reductase; Provisional 97.53
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.51
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 97.5
PRK12416463 protoporphyrinogen oxidase; Provisional 97.47
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 97.46
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 97.44
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.42
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.41
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 97.41
PRK12831464 putative oxidoreductase; Provisional 97.41
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.41
PLN02529738 lysine-specific histone demethylase 1 97.36
PRK06475400 salicylate hydroxylase; Provisional 97.35
PRK07846451 mycothione reductase; Reviewed 97.34
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 97.33
KOG2614|consensus420 97.33
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 97.32
KOG2960|consensus328 97.31
COG2907447 Predicted NAD/FAD-binding protein [General functio 97.31
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 97.3
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 97.27
PLN02328808 lysine-specific histone demethylase 1 homolog 97.27
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 97.27
KOG4716|consensus503 97.19
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.17
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 97.17
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.16
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 97.13
PRK12779 944 putative bifunctional glutamate synthase subunit b 97.12
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.12
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.12
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 97.04
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 97.03
PRK098531019 putative selenate reductase subunit YgfK; Provisio 97.02
PLN02852491 ferredoxin-NADP+ reductase 97.01
KOG0685|consensus498 96.97
PRK06567 1028 putative bifunctional glutamate synthase subunit b 96.94
PRK12814652 putative NADPH-dependent glutamate synthase small 96.93
KOG1276|consensus491 96.88
PLN03000 881 amine oxidase 96.86
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 96.83
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 96.71
PRK14989 847 nitrite reductase subunit NirD; Provisional 96.71
KOG0404|consensus322 96.7
PRK12770352 putative glutamate synthase subunit beta; Provisio 96.7
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 96.7
PTZ00318424 NADH dehydrogenase-like protein; Provisional 96.68
KOG3855|consensus481 96.65
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 96.62
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 96.61
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 96.59
PLN02976 1713 amine oxidase 96.58
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 96.54
PTZ00188506 adrenodoxin reductase; Provisional 96.52
PRK12771564 putative glutamate synthase (NADPH) small subunit; 96.38
PRK06327475 dihydrolipoamide dehydrogenase; Validated 96.37
PRK13984604 putative oxidoreductase; Provisional 96.29
PRK10262321 thioredoxin reductase; Provisional 96.21
COG4529474 Uncharacterized protein conserved in bacteria [Fun 96.21
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 96.12
PRK12831464 putative oxidoreductase; Provisional 96.06
KOG1439|consensus440 95.91
KOG2403|consensus 642 95.88
PRK13512438 coenzyme A disulfide reductase; Provisional 95.87
KOG4405|consensus547 95.78
KOG1800|consensus468 95.6
COG5044434 MRS6 RAB proteins geranylgeranyltransferase compon 95.54
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 95.41
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 95.35
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 95.34
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 95.26
KOG1336|consensus478 95.18
KOG3851|consensus446 94.86
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 94.72
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 94.68
KOG2755|consensus334 94.58
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 94.35
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 94.32
KOG0399|consensus2142 94.11
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 93.97
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 93.65
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 93.6
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 93.19
PRK05976472 dihydrolipoamide dehydrogenase; Validated 93.14
COG0569225 TrkA K+ transport systems, NAD-binding component [ 92.99
PRK05708305 2-dehydropantoate 2-reductase; Provisional 92.93
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 92.8
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 92.47
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 92.46
PRK07846451 mycothione reductase; Reviewed 92.46
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 92.44
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 92.32
TIGR02053463 MerA mercuric reductase. This model represents the 92.32
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 92.28
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 92.15
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 92.12
PRK06249313 2-dehydropantoate 2-reductase; Provisional 92.1
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 91.94
PRK06370463 mercuric reductase; Validated 91.92
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.85
PRK13512438 coenzyme A disulfide reductase; Provisional 91.8
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 91.6
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.56
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 91.52
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 91.43
KOG3923|consensus342 91.34
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 91.34
PRK12921305 2-dehydropantoate 2-reductase; Provisional 91.14
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 91.05
PRK06718202 precorrin-2 dehydrogenase; Reviewed 91.03
PRK14989 847 nitrite reductase subunit NirD; Provisional 91.03
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 91.0
PRK06292460 dihydrolipoamide dehydrogenase; Validated 90.89
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.68
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.66
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 90.57
PTZ00153659 lipoamide dehydrogenase; Provisional 90.51
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 90.48
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.36
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.21
PRK06116450 glutathione reductase; Validated 90.15
PRK07845466 flavoprotein disulfide reductase; Reviewed 90.13
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 90.13
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 90.03
PLN02507499 glutathione reductase 89.91
PRK09564444 coenzyme A disulfide reductase; Reviewed 89.81
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 89.71
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 89.67
PTZ00058561 glutathione reductase; Provisional 89.66
PRK04148134 hypothetical protein; Provisional 89.64
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 89.63
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 89.56
PRK065671028 putative bifunctional glutamate synthase subunit b 89.53
PRK06719157 precorrin-2 dehydrogenase; Validated 89.5
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.46
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 89.45
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 89.36
PRK08229341 2-dehydropantoate 2-reductase; Provisional 89.28
PLN02546558 glutathione reductase 89.23
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 89.17
PRK15116268 sulfur acceptor protein CsdL; Provisional 89.15
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 89.1
PRK13748561 putative mercuric reductase; Provisional 88.96
PRK14694468 putative mercuric reductase; Provisional 88.83
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 88.76
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 88.74
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 88.69
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 88.69
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 88.54
PRK14727479 putative mercuric reductase; Provisional 88.49
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 88.33
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 88.11
PRK12770352 putative glutamate synthase subunit beta; Provisio 88.08
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 88.05
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 88.0
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 87.89
PTZ00052499 thioredoxin reductase; Provisional 87.82
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 87.61
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 87.56
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 87.55
cd01483143 E1_enzyme_family Superfamily of activating enzymes 87.54
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 87.52
KOG2304|consensus298 87.48
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 87.45
PTZ00318424 NADH dehydrogenase-like protein; Provisional 87.25
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 86.99
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 86.78
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 86.63
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 86.62
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 86.45
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 86.21
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 86.07
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 85.87
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 85.85
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 85.7
PRK12549284 shikimate 5-dehydrogenase; Reviewed 85.56
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 85.27
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 85.12
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 85.09
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 84.79
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 84.6
PLN02353473 probable UDP-glucose 6-dehydrogenase 84.26
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.25
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 84.23
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 84.2
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 83.91
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 83.89
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 83.85
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 83.76
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 83.61
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 83.58
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 83.45
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 83.37
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 83.11
PRK07417279 arogenate dehydrogenase; Reviewed 83.05
PRK12548289 shikimate 5-dehydrogenase; Provisional 82.91
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 82.71
PRK08328231 hypothetical protein; Provisional 82.59
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 82.43
PRK11730715 fadB multifunctional fatty acid oxidation complex 82.43
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 82.3
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 82.27
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 82.14
PLN02172461 flavin-containing monooxygenase FMO GS-OX 81.98
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 81.97
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 81.95
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 81.91
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 81.79
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 81.76
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 81.66
PRK08223287 hypothetical protein; Validated 81.6
cd01490435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 81.59
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 81.41
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 81.23
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 80.95
PRK06223307 malate dehydrogenase; Reviewed 80.9
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 80.66
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 80.6
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 80.51
PTZ00082321 L-lactate dehydrogenase; Provisional 80.41
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 80.39
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 80.26
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 80.25
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 80.11
>KOG1238|consensus Back     alignment and domain information
Probab=100.00  E-value=4.6e-90  Score=680.03  Aligned_cols=497  Identities=39%  Similarity=0.587  Sum_probs=444.7

Q ss_pred             CCCcccEEEECCChhHHHHHHHHhCCCCCeEEEEcCcCCCCCCCccCCccccccCCccccceecccccCcccCCCCceee
Q psy1058           7 SGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLAEPSQFAGLGVRNARIK   86 (512)
Q Consensus         7 ~~~~~DviVVGsG~aG~~~A~~La~~~g~~VlvlE~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   86 (512)
                      ...+||+||||||.|||++|.+|+|.+..+|||||+|+........|.....+..+.++|.|.+.|+...+....+..+.
T Consensus        54 ~~~~yDyIVVGgGtAGcvlAarLSEn~~~~VLLLEaGg~~~~~~~~p~~~~~~q~s~~dw~y~t~Ps~~ac~~m~~~~c~  133 (623)
T KOG1238|consen   54 LDSSYDYIVVGGGTAGCVLAARLSENPNWSVLLLEAGGDPPLYSDPPLLAANLQLSLYDWSYHTEPSQHACLAMSEDRCY  133 (623)
T ss_pred             cccCCCEEEECCCchhHHHHHhhccCCCceEEEEecCCCCcccccchHHHHHhccccccccCcCccChhhhhhhcCCcee
Confidence            45689999999999999999999998899999999999887777888777778888999999999999999999999999


Q ss_pred             eecCcccchhhhhcCceeecCChhhHHHHHHcCCCCCChhhHHHHHHHhccCcCCCcCCCCCCCCCCCceeeccCCCCCc
Q psy1058          87 ITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDETLKYFVKSEDYRSVIYNESKAVHGTQGYLPVGLFKNKEN  166 (512)
Q Consensus        87 ~~~g~~lGG~s~~~~~~~~r~~~~~~~~~~~~g~~~w~~~~l~~~~~~~e~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~  166 (512)
                      |+||+++||+|.+|+|+|.|++..||+.|++.++++|+|+++.+||+++|....+.... .++|+..|++.+....+.  
T Consensus       134 wpRGrVLGGsS~iN~m~Y~RG~r~Dyd~W~~~gnpgW~y~~vl~yf~k~E~~~~~~~~~-~~y~~~~g~~~ve~~~~~--  210 (623)
T KOG1238|consen  134 WPRGRVLGGSSVLNAMFYVRGNRRDYDRWAAEGNPGWSYDEVLPYFKKSEDKVVPDPEL-TPYHGAGGPLLVEAGVYP--  210 (623)
T ss_pred             cCccceecccccccceEEecCCccchHHHHHhcCCCCCHHHHHHHHHHHhhccCCCccc-CcccccCCcceecccccc--
Confidence            99999999999999999999999999999999999999999999999999988766554 458999999999888888  


Q ss_pred             chHHHHHHHHHHHcCCCCCCCCCCCCcccceeecccccCCCeecchhhhhhhcccCCCCCEEEEcCcEEEEEEec-CCCe
Q psy1058         167 NIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIIN-DQNV  245 (512)
Q Consensus       167 ~~~~~~~~~~~~~~G~~~~~~~~~~~~~~g~~~~~~~~~~~~r~~~~~~~l~~~~~~~~g~~v~~~~~V~~i~~~-~~~~  245 (512)
                      .+....+.++.++.|.+.. |+++.. ..|+.....+..++.|+++..+|+.++...++|+.+..++.|++|.+| .+.+
T Consensus       211 ~~~~~~~~~ag~e~G~~~~-D~nG~~-~tg~~~l~~t~~~g~R~s~~~a~l~~~~~~R~NL~~~~~~~vtrvl~D~~~~~  288 (623)
T KOG1238|consen  211 NNLFTAFHRAGTEIGGSIF-DRNGER-HTGASLLQYTIRNGIRVSLAKAYLKPIRLTRPNLHISRNAAVTRVLIDPAGKR  288 (623)
T ss_pred             CchhhHhHHhHHhcCCCcc-CCCCcc-ccchhhhhccccCCEEEEehhhhhhhhhccCccccccccceEEEEEEcCCCce
Confidence            8899999999999996555 999999 999999999999999999999999998833889999999999999998 6789


Q ss_pred             EEEEEEEecCCeEEEEecCcEEEEcCCchhcHHHHHHcCCCChhhhccCCCCcccccc-cccccccccCCCcceEEecCC
Q psy1058         246 ATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLR-VGENLKLNAQFTGPVMAFSAP  324 (512)
Q Consensus       246 v~GV~~~~~~g~~~~v~A~k~VVlaaGa~~t~~lL~~Sgig~~~~l~~~gi~~~~~~~-vG~~l~dh~~~~~~~~~~~~~  324 (512)
                      +.||++....|++++++|+|+|||||||++||+|||+|||||.++|++.||+++.++| ||+||+||+..+ +.+.+..+
T Consensus       289 a~gv~~~~~~~~~~~v~a~kEVILSAGAi~SPQLLMLSGIGP~~~L~~~gIpvv~dLP~VG~nLqDH~~~~-~~~~~~~~  367 (623)
T KOG1238|consen  289 AKGVEFVRDGGKEHTVKARKEVILSAGAINSPQLLMLSGIGPADHLKKLGIPVVLDLPGVGQNLQDHPMNP-GFVFSTNP  367 (623)
T ss_pred             EEEEEEEecCceeeeecccceEEEeccccCCHHHHHHcCCCcHHHHHhcCCCeeccCcccccccccccccc-eeeecCCC
Confidence            9999999823799999999999999999999999999999999999999999999999 999999999996 54444443


Q ss_pred             c---ccccccHHHHHHHhhcCCCCCCCcccceEEEEEecCCCC---CCCCeEEEEecccc--------------------
Q psy1058         325 L---KRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQNT---ARPDLEIHLLYFQQ--------------------  378 (512)
Q Consensus       325 ~---~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~---~~p~~~~~~~~~~~--------------------  378 (512)
                      .   .........+.+|+....||+...+ .+..+|++.....   ++||+++++.....                    
T Consensus       368 ~~~~~~~~~~~~~~~~yl~~~~G~~~~~~-~e~~~f~~t~~~~~~~~~PD~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~  446 (623)
T KOG1238|consen  368 VELSLIRLVGITTVGQYLEGGSGPLASPG-VETLGFINTVSSNLSLDWPDIELHFVAGSLSSDGLTALRKALGEIYQALF  446 (623)
T ss_pred             ccccccccccchHHHHHHHcCCCCcccCc-ceeeEEeccccccCcCCCCCeeEEeccccccccchhhhhhhcchHHHHhh
Confidence            1   1222335678899999999998765 6788998877653   77888877644321                    


Q ss_pred             ----------------------------------chhhHHH------HHHHHHHHHHHHHHhcchhHHHhcccccccCCc
Q psy1058         379 ----------------------------------NDIRNMY------LATLIRGTDYITRLEQTEAIRLAGGTLMSLNLE  418 (512)
Q Consensus       379 ----------------------------------~~~~~~y------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  418 (512)
                                                        +.++++|      ++.++++++.+.++.++++|++++..++..++|
T Consensus       447 ~~~~~~~~~~i~~~~l~P~SrG~l~L~s~nP~~~P~I~~NY~~~p~Dv~~~vegi~~~~~l~~s~af~~~~~r~~~~~~~  526 (623)
T KOG1238|consen  447 GELTNSDSFVIFPKLLRPKSRGRLKLRSTNPRDNPLITPNYFTHPEDVATLVEGIRTIIRLSNSKAFQRFGARLWKKPVP  526 (623)
T ss_pred             hhhhcCceeEEeehhcCCCccceEEecCCCCCcCceeccCcCCCHHHHHHHHHHHHHHHHHHcCHHHHHhcchhccccCC
Confidence                                              1122335      899999999999999999999999999988999


Q ss_pred             cCCCCCCCCHHHHHHHHHhhcCCCccccccccccCCCCCCCccCCCCeEeccCCcEEEeeccCCCCCCCCchHHHHHHHH
Q psy1058         419 ACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAIITQSDAISYMIGE  498 (512)
Q Consensus       419 ~~~~~~~~~~~~~~~~~~~~~~~~~H~~Gt~~Mg~~~~~~~VvD~~~rv~g~~nl~V~D~Sv~P~~~~~np~lTi~ala~  498 (512)
                      +|......++++|+||+|.+..+.||++|||+||+..|+++|||+++||||++||||+|+|+||.+|++||.+|+++|||
T Consensus       527 ~c~~~~~~sd~yw~c~~R~~~~TiyH~~GtckMGp~~D~~aVVD~~lrV~Gv~~LRVVDaSimP~~psgN~nA~v~MIge  606 (623)
T KOG1238|consen  527 GCDLLAFLSDAYWECFCRHTVVTIYHYSGTCKMGPSSDPTAVVDPQLRVHGVRGLRVVDASIMPESPSGNPNAPVMMIGE  606 (623)
T ss_pred             CcccccCCCHHHHHHHHHhccceeeccCCceEeCCccCCCcccCCcceeccccCceEeeccccCCCCCCCccHHHHHHHH
Confidence            99988899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhcCC
Q psy1058         499 KCADLVKTSYNI  510 (512)
Q Consensus       499 r~a~~i~~~~~~  510 (512)
                      |+|+.|+++|..
T Consensus       607 k~ad~Ik~~~~~  618 (623)
T KOG1238|consen  607 KAADMIKEEWLA  618 (623)
T ss_pred             HHHHHHHHHhhh
Confidence            999999999854



>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PF05199 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR007867 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>KOG2311|consensus Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>KOG2960|consensus Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>KOG1276|consensus Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>KOG3855|consensus Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG1439|consensus Back     alignment and domain information
>KOG2403|consensus Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>KOG4405|consensus Back     alignment and domain information
>KOG1800|consensus Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>KOG3851|consensus Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>KOG2755|consensus Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>KOG3923|consensus Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>KOG2304|consensus Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query512
2jbv_A546 Crystal Structure Of Choline Oxidase Reveals Insigh 3e-34
3ljp_A546 Crystal Structure Of Choline Oxidase V464a Mutant L 3e-34
3nne_A546 Crystal Structure Of Choline Oxidase S101a Mutant L 5e-34
3t37_A526 Crystal Structure Of Pyridoxine 4-Oxidase From Meso 2e-24
3fim_B566 Crystal Structure Of Aryl-Alcohol-Oxidase From Pleu 2e-23
3fim_B566 Crystal Structure Of Aryl-Alcohol-Oxidase From Pleu 2e-09
1gpe_A587 Glucose Oxidase From Penicillium Amagasakiense Leng 3e-20
1cf3_A583 Glucose Oxidase From Apergillus Niger Length = 583 3e-20
3q9t_A577 Crystal Structure Analysis Of Formate Oxidase Lengt 1e-19
3q9t_A577 Crystal Structure Analysis Of Formate Oxidase Lengt 2e-08
1ju2_A536 Crystal Structure Of The Hydroxynitrile Lyase From 2e-11
3gdn_A521 Almond Hydroxynitrile Lyase In Complex With Benzald 2e-11
3red_A521 3.0 A Structure Of The Prunus Mume Hydroxynitrile L 5e-11
1kdg_A546 Crystal Structure Of The Flavin Domain Of Cellobios 2e-05
1naa_A541 Cellobiose Dehydrogenase Flavoprotein Fragment In C 3e-05
>pdb|2JBV|A Chain A, Crystal Structure Of Choline Oxidase Reveals Insights Into The Catalytic Mechanism Length = 546 Back     alignment and structure

Iteration: 1

Score = 143 bits (360), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 157/553 (28%), Positives = 237/553 (42%), Gaps = 93/553 (16%) Query: 11 FDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSL--------S 62 FD I+VG +AG +A RLSE ++ V L+EAG D G+ VL L S Sbjct: 14 FDYIVVGGGSAGAAVAARLSEDPAVSVALVEAGPDDR------GVPEVLQLDRWMELLES 67 Query: 63 EFDHAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENF-AKLGYN 121 +D Y EP + +R+AR K+ +GG S+ + + D + + AK G Sbjct: 68 GYDWDYPIEPQENGNSFMRHARAKV-----MGGCSSHNSCIAFWAPREDLDEWEAKYGAT 122 Query: 122 GWGYDETLKYFVKSEDYRSVIYNESKAVHGTQGYLPVGLFKNKENNIIREIFETSAQELG 181 GW + + + E HG G PV L + + ++ G Sbjct: 123 GWNAEAAWPLYKRLETNEDA--GPDAPHHGDSG--PVHLMNVPPKDPTGVALLDACEQAG 178 Query: 182 YPCPKDMNDRYVDVGFAELPGMTRY--GLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVI 239 P K N V A + R G R S++ +Y+ PI ++ N +L + +++ Sbjct: 179 IPRAK-FNTGTTVVNGANFFQINRRADGTRSSSSVSYIHPIV-EQENFTLLTGLRARQLV 236 Query: 240 INDQNVATGVEYVNSK-GETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPV 298 + TGV+ V+S G T R+TA EV+L+ GAI +LL+LSGIGP AHL E I V Sbjct: 237 FDADRRCTGVDIVDSAFGHTHRLTARNEVVLSTGAIDTPKLLMLSGIGPAAHLAEHGIEV 296 Query: 299 KQDLR-VGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGY 357 D VGE+L+ + + V+ F A Q MV + + W + Sbjct: 297 LVDSPGVGEHLQDHPEG---VVQFEA-------KQPMVAE----------STQWWEIGIF 336 Query: 358 IDTLQNTARPDLEIHL--LYFQQNDIRNMYLAT-------------------LIRGTD-- 394 T RPDL +H + F N +R+ Y T +R D Sbjct: 337 TPTEDGLDRPDLMMHYGSVPFDMNTLRHGYPTTENGFSLTPNVTHARSRGTVRLRSRDFR 396 Query: 395 --------YITRLEQTEAIRLAGGTLMSLNLEA-CSQYPW-----------RSTHSWTCY 434 Y T E + + G + + A + W ++ Y Sbjct: 397 DKPMVDPRYFTDPEGHDMRVMVAGIRKAREIAAQPAMAEWTGRELSPGVEAQTDEELQDY 456 Query: 435 IRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAIITQSDAISY 494 IR T +PVGTV MG +D + + P+L+VKG+ GLRVAD SV+P + + Sbjct: 457 IRKTHNTVYHPVGTVRMGAVEDEMSPLDPELRVKGVTGLRVADASVMPEHVTVNPNITVM 516 Query: 495 MIGEKCADLVKTS 507 MIGE+CADL++++ Sbjct: 517 MIGERCADLIRSA 529
>pdb|3LJP|A Chain A, Crystal Structure Of Choline Oxidase V464a Mutant Length = 546 Back     alignment and structure
>pdb|3NNE|A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant Length = 546 Back     alignment and structure
>pdb|3T37|A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti Length = 526 Back     alignment and structure
>pdb|3FIM|B Chain B, Crystal Structure Of Aryl-Alcohol-Oxidase From Pleurotus Eryingii Length = 566 Back     alignment and structure
>pdb|3FIM|B Chain B, Crystal Structure Of Aryl-Alcohol-Oxidase From Pleurotus Eryingii Length = 566 Back     alignment and structure
>pdb|1GPE|A Chain A, Glucose Oxidase From Penicillium Amagasakiense Length = 587 Back     alignment and structure
>pdb|1CF3|A Chain A, Glucose Oxidase From Apergillus Niger Length = 583 Back     alignment and structure
>pdb|3Q9T|A Chain A, Crystal Structure Analysis Of Formate Oxidase Length = 577 Back     alignment and structure
>pdb|3Q9T|A Chain A, Crystal Structure Analysis Of Formate Oxidase Length = 577 Back     alignment and structure
>pdb|1JU2|A Chain A, Crystal Structure Of The Hydroxynitrile Lyase From Almond Length = 536 Back     alignment and structure
>pdb|3GDN|A Chain A, Almond Hydroxynitrile Lyase In Complex With Benzaldehyde Length = 521 Back     alignment and structure
>pdb|3RED|A Chain A, 3.0 A Structure Of The Prunus Mume Hydroxynitrile Lyase Isozyme-1 Length = 521 Back     alignment and structure
>pdb|1KDG|A Chain A, Crystal Structure Of The Flavin Domain Of Cellobiose Dehydrogenase Length = 546 Back     alignment and structure
>pdb|1NAA|A Chain A, Cellobiose Dehydrogenase Flavoprotein Fragment In Complex With Cellobionolactam Length = 541 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query512
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 1e-128
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 1e-122
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 1e-121
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 1e-103
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 8e-96
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 5e-91
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 4e-20
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 8e-87
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 6e-20
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 6e-86
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 4e-18
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 8e-27
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 3e-23
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 1e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 2e-04
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 3e-04
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 6e-04
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 8e-04
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Length = 587 Back     alignment and structure
 Score =  385 bits (992), Expect = e-128
 Identities = 127/580 (21%), Positives = 200/580 (34%), Gaps = 95/580 (16%)

Query: 7   SGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGG---DTPIHSRIPGMSSVLSLSE 63
           +G  +D II G    G  +A +L+E   +KVL+IE G    +       P     +  + 
Sbjct: 21  AGKTYDYIIAGGGLTGLTVAAKLTENPKIKVLVIEKGFYESNDGAIIEDPNAYGQIFGTT 80

Query: 64  FDHAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKL-GYNG 122
            D  YL  P     +  R     I AGKGLGGS+ +    + R      +++ K+ G  G
Sbjct: 81  VDQNYLTVP----LINNR--TNNIKAGKGLGGSTLINGDSWTRPDKVQIDSWEKVFGMEG 134

Query: 123 WGYDETLKYFVKSEDYR-------SVIYNESKAVHGTQGYLPVGLFKN-KENNIIREIFE 174
           W +D   +Y  K+E  R       +  ++ +   HGT G +  G   N +  + I +   
Sbjct: 135 WNWDNMFEYMKKAEAARTPTAAQLAAGHSFNATCHGTNGTVQSGARDNGQPWSPIMKALM 194

Query: 175 TSAQELGYPCPKDMNDRYVDVGFAELPG-MTRYGLRFSAADAYLTPIAGKRTNLYVLKRS 233
            +   LG P  +D        G + +   +    +R  AA A+L P   +R+NL +L   
Sbjct: 195 NTVSALGVPVQQDFL-CGHPRGVSMIMNNLDENQVRVDAARAWLLPNY-QRSNLEILTGQ 252

Query: 234 KVTKVIINDQN---VATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAH 290
            V KV+         A GV +  +K     V A  EV+L AG+  +  +L  SGIG K+ 
Sbjct: 253 MVGKVLFKQTASGPQAVGVNFGTNKAVNFDVFAKHEVLLAAGSAISPLILEYSGIGLKSV 312

Query: 291 LDEVKIPVKQDLRVGENL----------KLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLV 340
           LD+  +    DL VG N+          + ++   G   A            E    Y  
Sbjct: 313 LDQANVTQLLDLPVGINMQDQTTTTVSSRASSAGAGQGQAVFFANF-----TETFGDYAP 367

Query: 341 NRIGPL-SNAGLW-SFTGYIDTLQNTARPDLEIHLLYFQQNDIRNMYLATLIRGTDYIT- 397
                L +    W   T       N     ++         D    +    +     I  
Sbjct: 368 QARDLLNTKLDQWAEETVARGGFHNVTALKVQYENYRNWLLDEDVAFAELFMDTEGKINF 427

Query: 398 -------------------------------------RLEQTEAIRLA-----GGTLMSL 415
                                                 L Q  A +LA      G +   
Sbjct: 428 DLWDLIPFTRGSVHILSSDPYLWQFANDPKFFLNEFDLLGQAAASKLARDLTSQGAMKEY 487

Query: 416 NLE----ACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIK 471
                    +     +   W+ Y+        + V +  M  + +   VV    KV G +
Sbjct: 488 FAGETLPGYNLVQNATLSQWSDYVLQNFRPNWHAVSSCSMM-SRELGGVVDATAKVYGTQ 546

Query: 472 GLRVADISVLPNAII---TQSDAISYMIGEKCADLVKTSY 508
           GLRV D S+ P   +        I Y +  K AD +   Y
Sbjct: 547 GLRVIDGSIPPT-QVSSHVM--TIFYGMALKVADAILDDY 583


>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Length = 583 Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Length = 566 Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Length = 546 Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Length = 536 Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Length = 577 Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Length = 577 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Length = 546 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Length = 546 Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Length = 526 Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Length = 526 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504 Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query512
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 100.0
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 100.0
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 100.0
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 100.0
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 100.0
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 100.0
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 100.0
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 100.0
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 100.0
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 100.0
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 100.0
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 99.68
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.52
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 99.49
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 99.43
3dme_A369 Conserved exported protein; structural genomics, P 99.43
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 99.42
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 99.41
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 99.4
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 99.39
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 99.38
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.37
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.34
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.34
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.34
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.34
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.33
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.33
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 99.32
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 99.29
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.27
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 99.24
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 99.19
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.18
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.16
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 99.16
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.13
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 99.12
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.11
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 99.11
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.1
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 99.1
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 99.08
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 99.07
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 99.06
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.05
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 99.03
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.01
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.99
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.95
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.94
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.84
3atr_A453 Conserved archaeal protein; saturating double bond 98.83
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.83
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.82
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.82
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.82
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 98.8
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.78
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 98.77
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.73
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.72
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.72
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.71
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.7
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.7
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.7
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.69
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.68
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.62
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 98.62
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.61
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.59
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.59
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.59
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.58
2bry_A497 NEDD9 interacting protein with calponin homology a 98.56
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.55
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.54
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.5
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 98.5
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.5
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 98.49
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.49
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.45
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.4
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 98.38
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.38
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.37
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.37
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 98.36
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.35
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.34
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.33
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 98.31
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.31
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.29
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.28
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 98.26
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 98.2
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.19
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 98.12
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.12
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.07
2cul_A232 Glucose-inhibited division protein A-related PROT 98.04
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 98.03
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.01
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 98.0
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 98.0
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 97.99
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.98
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 97.98
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.96
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.96
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 97.95
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.95
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 97.94
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.93
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.93
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 97.93
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.93
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.92
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 97.91
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 97.91
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 97.91
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.9
4dna_A463 Probable glutathione reductase; structural genomic 97.9
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.88
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.87
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 97.87
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.87
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.86
2ywl_A180 Thioredoxin reductase related protein; uncharacter 97.85
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 97.84
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.83
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.83
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.82
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 97.82
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 97.81
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.81
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 97.79
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.79
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.78
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 97.77
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.77
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 97.75
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 97.74
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.73
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 97.72
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.71
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.71
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 97.71
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.71
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 97.7
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 97.7
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.69
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.69
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 97.69
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.69
1ojt_A482 Surface protein; redox-active center, glycolysis, 97.68
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.68
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.67
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.67
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.67
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.66
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 97.66
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.64
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.64
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 97.64
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.64
4gut_A776 Lysine-specific histone demethylase 1B; histone de 97.61
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 97.61
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.6
1fec_A490 Trypanothione reductase; redox-active center, oxid 97.59
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 97.59
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.58
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 97.57
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 97.57
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.55
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 97.54
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.52
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.48
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.47
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.45
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.43
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.37
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 97.36
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.35
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 97.34
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 97.33
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.33
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 97.31
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.3
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 97.26
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.24
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 97.23
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.23
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 97.19
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 97.19
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 97.18
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.18
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.17
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.15
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.1
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 97.09
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 97.09
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.09
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.04
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.02
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.01
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 96.95
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 96.94
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 96.86
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 96.86
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 96.84
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 96.82
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 96.82
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 96.81
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 96.77
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 96.72
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 96.66
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 96.66
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 96.64
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 96.62
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 96.62
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 96.58
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 96.55
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 96.55
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 96.53
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 96.51
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 96.5
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 96.48
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 96.42
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 96.41
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 96.37
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 96.25
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 96.21
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 96.08
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 95.97
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 95.97
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 95.96
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 95.94
4dna_A463 Probable glutathione reductase; structural genomic 95.86
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 95.81
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 95.78
1fec_A490 Trypanothione reductase; redox-active center, oxid 95.46
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 95.4
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 95.3
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 94.65
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 94.62
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 94.42
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 94.38
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 94.29
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 94.05
1lss_A140 TRK system potassium uptake protein TRKA homolog; 94.01
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 93.88
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 93.77
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 93.71
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 93.67
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 93.56
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 93.55
1id1_A153 Putative potassium channel protein; RCK domain, E. 93.26
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 93.02
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 92.91
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 92.44
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 92.21
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 92.17
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 92.12
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 92.05
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 91.84
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 91.82
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 91.8
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 91.72
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 91.66
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 91.58
1ojt_A482 Surface protein; redox-active center, glycolysis, 91.55
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 91.55
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 91.35
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 91.35
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 91.14
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 91.07
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 90.92
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 90.84
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 90.82
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 90.76
2cul_A232 Glucose-inhibited division protein A-related PROT 90.75
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 90.65
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 90.61
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 90.45
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 90.44
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 90.35
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 90.23
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 90.21
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 90.17
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 90.15
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 90.1
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 89.82
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 89.82
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 89.8
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 89.77
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 89.73
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 89.64
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 89.31
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 89.31
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 89.28
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 89.28
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 88.8
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 88.8
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 88.78
4g65_A461 TRK system potassium uptake protein TRKA; structur 88.66
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 88.23
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 88.21
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 88.19
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 88.18
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 88.13
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 87.92
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 87.83
3c85_A183 Putative glutathione-regulated potassium-efflux S 87.73
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 87.7
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 87.66
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 87.63
3r9u_A315 Thioredoxin reductase; structural genomics, center 87.52
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 87.28
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 87.17
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 87.13
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 87.06
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 87.05
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 86.95
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 86.94
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 86.9
1vg0_A650 RAB proteins geranylgeranyltransferase component A 86.87
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 86.83
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 86.82
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 86.79
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 86.77
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 86.68
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 86.64
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 86.57
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 86.55
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 86.42
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 86.41
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 86.4
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 86.37
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 86.34
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 86.25
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 86.21
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 86.16
3qha_A296 Putative oxidoreductase; seattle structural genomi 86.03
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 85.78
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 85.75
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 85.62
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 85.53
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 85.45
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 85.43
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 85.41
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 85.35
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 85.22
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 85.21
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 85.19
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 85.08
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 85.05
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 85.03
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 84.98
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 84.95
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 84.86
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 84.74
4ezb_A317 Uncharacterized conserved protein; structural geno 84.34
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 84.27
3tl2_A315 Malate dehydrogenase; center for structural genomi 84.13
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 84.1
3l6d_A306 Putative oxidoreductase; structural genomics, prot 83.91
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 83.88
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 83.82
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 83.78
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 83.76
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 83.73
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 83.63
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 83.61
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 83.48
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 83.46
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 83.45
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 83.34
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 83.18
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 83.1
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 83.0
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 82.99
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 82.94
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 82.89
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 82.82
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 82.78
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 82.71
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 82.67
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 82.57
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 82.56
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 82.39
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 82.32
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 82.28
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 82.28
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 82.15
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 82.09
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 81.76
3ius_A286 Uncharacterized conserved protein; APC63810, silic 81.72
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 81.59
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 81.58
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 81.58
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 81.55
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 81.37
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 81.21
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 81.2
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 81.16
1vpd_A299 Tartronate semialdehyde reductase; structural geno 81.14
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 81.02
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 80.99
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 80.86
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 80.79
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 80.77
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 80.67
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 80.67
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 80.59
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 80.53
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 80.46
2ywl_A180 Thioredoxin reductase related protein; uncharacter 80.46
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 80.43
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 80.35
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 80.3
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 80.29
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 80.27
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 80.25
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 80.21
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 80.2
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 80.17
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 80.02
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
Probab=100.00  E-value=1.2e-84  Score=672.23  Aligned_cols=483  Identities=29%  Similarity=0.380  Sum_probs=405.1

Q ss_pred             cccEEEECCChhHHHHHHHHhCCCCCeEEEEcCcCCC--CCCCccCCccccccC-CccccceecccccCcccCCCCceee
Q psy1058          10 CFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDT--PIHSRIPGMSSVLSL-SEFDHAYLAEPSQFAGLGVRNARIK   86 (512)
Q Consensus        10 ~~DviVVGsG~aG~~~A~~La~~~g~~VlvlE~g~~~--~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~   86 (512)
                      +|||||||+|.+||++|.+|++.++.+|||||+|+..  .....+|..+..... +.++|.|.+.|++    .+.++.+.
T Consensus         2 ~yD~IIVG~G~aG~v~A~rLse~~~~~VlllEaG~~~~~~~~~~~p~~~~~~~~~~~~~w~~~t~pq~----~~~~r~~~   77 (566)
T 3fim_B            2 DFDYVVVGAGNAGNVVAARLTEDPDVSVLVLEAGVSDENVLGAEAPLLAPGLVPNSIFDWNYTTTAQA----GYNGRSIA   77 (566)
T ss_dssp             CEEEEESCCSTTHHHHHHHHTTSTTCCEEEECSSBCCTTCGGGTSGGGSGGGSSSSTTBCCCBCCCCG----GGTTCCCB
T ss_pred             CcCEEEECCcHHHHHHHHHHHhCcCCcEEEEecCCcccCCCceeCcchHHHhcCCCccccccccccCC----CCCCceEe
Confidence            6999999999999999999999669999999999875  233445665555553 6799999999987    47889999


Q ss_pred             eecCcccchhhhhcCceeecCChhhHHHHHHc-CCCCCChhhHHHHHHHhccCcCCCc------CCCCCCCCCCCceeec
Q psy1058          87 ITAGKGLGGSSAVQNILYQRGTSYDYENFAKL-GYNGWGYDETLKYFVKSEDYRSVIY------NESKAVHGTQGYLPVG  159 (512)
Q Consensus        87 ~~~g~~lGG~s~~~~~~~~r~~~~~~~~~~~~-g~~~w~~~~l~~~~~~~e~~~~~~~------~~~~~~~~~~g~~~~~  159 (512)
                      |.+|++|||+|.+|+++|.|+++.||+.|++. |+++|+|+++.|||+++|++..+..      ..+...|+..|++.+.
T Consensus        78 ~~rGk~lGGsS~iN~m~~~Rg~~~d~d~W~~~~G~~gWs~~~~~pyf~k~E~~~~~~~~~~~~~~~~~~~hG~~Gp~~v~  157 (566)
T 3fim_B           78 YPRGRMLGGSSSVHYMVMMRGSTEDFDRYAAVTGDEGWNWDNIQQFVRKNEMVVPPADNHNTSGEFIPAVHGTNGSVSIS  157 (566)
T ss_dssp             CCCBCBTTGGGGTSCCBCCCCCHHHHHHHHHHHTCTTSSHHHHHHHHHHHEEECCCTTCCCCTTTSCGGGSCBSSSEEEB
T ss_pred             ccCCcEEcCcccccceEEecCCHHHHHHHHhcCCCCCcCHHHHHHHHHHHhccCCccccccccccCCccccCCCCCeeee
Confidence            99999999999999999999999999999988 9999999999999999999874421      1134678999999999


Q ss_pred             cCCCCCcchHHHHHHHHHHHc--CCCCCCCCCCCCcccceeecccccCCCeecchhhhhhhcccCCCCCEEEEcCcEEEE
Q psy1058         160 LFKNKENNIIREIFETSAQEL--GYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTK  237 (512)
Q Consensus       160 ~~~~~~~~~~~~~~~~~~~~~--G~~~~~~~~~~~~~~g~~~~~~~~~~~~r~~~~~~~l~~~~~~~~g~~v~~~~~V~~  237 (512)
                      ...+.  .+....+.++++++  |++...++++.. ..|++.++.++.++.|.++..+||.++. +++|++|++++.|++
T Consensus       158 ~~~~~--~~~~~~~~~a~~~~~~G~~~~~d~n~~~-~~G~~~~~~~~~~g~R~sa~~ayL~p~~-~r~NL~Vlt~a~V~r  233 (566)
T 3fim_B          158 LPGFP--TPLDDRVLATTQEQSEEFFFNPDMGTGH-PLGISWSIASVGNGQRSSSSTAYLRPAQ-SRPNLSVLINAQVTK  233 (566)
T ss_dssp             SCSSC--CTHHHHHHHHHHHTHHHHCBCSCGGGSC-CCEEEECCBSEETTEECCHHHHTHHHHT-TCTTEEEESSCEEEE
T ss_pred             cCCCC--CHHHHHHHHHHHHHhcCCCccCCCCCCC-cceEEeeeeecCCCEEcCHHHHHhhhhc-cCCCeEEECCCEEEE
Confidence            88777  78999999999999  999887888877 8899888888889999999999999988 899999999999999


Q ss_pred             EEec---CC-CeEEEEEEEecCC-eEEEEecCcEEEEcCCchhcHHHHHHcCCCChhhhccCCCCcccccc-cccccccc
Q psy1058         238 VIIN---DQ-NVATGVEYVNSKG-ETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLR-VGENLKLN  311 (512)
Q Consensus       238 i~~~---~~-~~v~GV~~~~~~g-~~~~v~A~k~VVlaaGa~~t~~lL~~Sgig~~~~l~~~gi~~~~~~~-vG~~l~dh  311 (512)
                      |+++   ++ ++++||++.+.+| +.++++|+|+||||||+|+||+||++|||||+++|+++||+++.++| ||+||+||
T Consensus       234 Il~~~~~~g~~rA~GVe~~~~~g~~~~~v~A~kEVILsAGai~SPqlL~lSGIGp~~~L~~~gI~vv~dlPgVG~NLqDH  313 (566)
T 3fim_B          234 LVNSGTTNGLPAFRCVEYAEQEGAPTTTVCAKKEVVLSAGSVGTPILLQLSGIGDENDLSSVGIDTIVNNPSVGRNLSDH  313 (566)
T ss_dssp             EECCEEETTEEECCEEEEESSTTSCCEEEEEEEEEEECCHHHHHHHHHHHTTEECHHHHHHTTCCCSEECTTTTCSBBCC
T ss_pred             EEeecCCCCCCEEEEEEEEECCCceEEEEEeeeEEEEecCCcCChHHHHhcCCCChHHHhhcCCCceecCcchhhhhhcC
Confidence            9997   23 6999999997445 77889998899999999999999999999999999999999999999 99999999


Q ss_pred             cCCCcceEEecCCccc-----cc-ccHHHHHHHhhcCCCCCCCcccceEEEEEecCC-------------CCCCCCeEEE
Q psy1058         312 AQFTGPVMAFSAPLKR-----TV-YSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQ-------------NTARPDLEIH  372 (512)
Q Consensus       312 ~~~~~~~~~~~~~~~~-----~~-~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~-------------~~~~p~~~~~  372 (512)
                      +.+. +.+..+.....     .. .......+|...+.||++..+ ....+|++...             ....|++++.
T Consensus       314 ~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~l~~~~-~~~~~f~~~~~~~~~~~~~~~~~~~~~~pd~~~~  391 (566)
T 3fim_B          314 LLLP-AAFFVNSNQTFDNIFRDSSEFNVDLDQWTNTRTGPLTALI-ANHLAWLRLPSNSSIFQTFPDPAAGPNSAHWETI  391 (566)
T ss_dssp             EEEC-CEEEESCSCSSGGGGTCHHHHHHHHHHHHHHSCSGGGCCS-CSEEEEECCCTTCGGGGTSCCCSSSTTSCSEEEE
T ss_pred             ccce-EEEEeCCCcccchhhcChHHHHHHHHHHHhcCCCCcccCh-hhheeeeccccchhhhhhhccccccCCCCCEEEE
Confidence            9985 88877654211     11 123456789999999997653 45677876542             1245777665


Q ss_pred             Eecc-------------------------cc-------------chhhHHH------HHHHHHHHHHHHHHhcchhHHHh
Q psy1058         373 LLYF-------------------------QQ-------------NDIRNMY------LATLIRGTDYITRLEQTEAIRLA  408 (512)
Q Consensus       373 ~~~~-------------------------~~-------------~~~~~~y------~~~~~~~~~~~~~~~~~~~~~~~  408 (512)
                      +.+.                         ++             +.++.+|      ++.++++++.+++++++++++.+
T Consensus       392 ~~~~~~~~~~~~~~~~~~~~~~~~l~~P~SrG~V~L~s~dp~~~P~i~~~yl~~~~D~~~~~~~~~~~~~i~~~~~~~~~  471 (566)
T 3fim_B          392 FSNQWFHPAIPRPDTGSFMSVTNALISPVARGDIKLATSNPFDKPLINPQYLSTEFDIFTMIQAVKSNLRFLSGQAWADF  471 (566)
T ss_dssp             EESSCCCTTSCCCSSCCEEEEEEEESSCSCCBEEECSSSCTTSCCEEECCTTCSHHHHHHHHHHHHHHHHHHTSGGGTTT
T ss_pred             ecccchhhcccCCCCCCEEEEEEeecCCccceEEEecCCCCCCCceeccccCCCccHHHHHHHHHHHHHHHHhCcccCCc
Confidence            4310                         00             1122223      88999999999999998888877


Q ss_pred             cccccccCCccCCCCCCCCHHHHHHHHHhhcCCCccccccccccCCCCCCCccCCCCeEeccCCcEEEeeccCCCCCCCC
Q psy1058         409 GGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAIITQ  488 (512)
Q Consensus       409 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~H~~Gt~~Mg~~~~~~~VvD~~~rv~g~~nl~V~D~Sv~P~~~~~n  488 (512)
                      ...+..   |++  ....+|++|++|+|....+.+|++|||+||++++.++|||+++||||++||||||+||||+++++|
T Consensus       472 ~~~~~~---P~~--~~~~sd~~~~~~ir~~~~t~~H~~GTc~Mg~~~~~~~VVD~~lrV~Gv~~LrVvDaSv~P~~~~~n  546 (566)
T 3fim_B          472 VIRPFD---PRL--RDPTDDAAIESYIRDNANTIFHPVGTASMSPRGASWGVVDPDLKVKGVDGLRIVDGSILPFAPNAH  546 (566)
T ss_dssp             EEEESS---GGG--SCTTCHHHHHHHHHHHCEECSCCBCTTCBCCTTCSSCSBCTTCBBTTCBSEEECSGGGCCSCCSSC
T ss_pred             cccccC---CCc--ccccchHHHHHHHhhcccccccccCccccCCcccCCccCCCCCeEccCCCcEEcccccCCCCCCcC
Confidence            644432   221  346789999999999999999999999999988655999999999999999999999999999999


Q ss_pred             chHHHHHHHHHHHHHHHhh
Q psy1058         489 SDAISYMIGEKCADLVKTS  507 (512)
Q Consensus       489 p~lTi~ala~r~a~~i~~~  507 (512)
                      |++|+||+|+|+||.|+++
T Consensus       547 ~~~~~~~iaekaAd~I~~~  565 (566)
T 3fim_B          547 TQGPIYLVGKQGADLIKAD  565 (566)
T ss_dssp             THHHHHHHHHHHHHHHHHT
T ss_pred             cHHHHHHHHHHHHHHHhhc
Confidence            9999999999999999986



>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 512
d1gpea1391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 2e-53
d1gpea1391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 2e-08
d1cf3a1385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 7e-53
d1cf3a1385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 8e-11
d1ju2a1351 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase { 2e-38
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 7e-36
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 4e-08
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 6e-35
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 1e-07
d3coxa1370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 5e-31
d1n4wa1367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 5e-29
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 4e-06
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 7e-06
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 8e-05
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 2e-04
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 3e-04
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 7e-04
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 7e-04
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 0.001
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 0.001
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 0.001
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 0.001
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 0.002
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 0.002
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 0.002
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 0.002
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 0.003
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 0.004
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 0.004
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Glucose oxidase
species: Penicillium amagasakiense [TaxId: 63559]
 Score =  183 bits (464), Expect = 2e-53
 Identities = 86/323 (26%), Positives = 136/323 (42%), Gaps = 24/323 (7%)

Query: 3   PYVKSGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGG---DTPIHSRIPGMSSVL 59
           P   +G  +D II G    G  +A +L+E   +KVL+IE G    +       P     +
Sbjct: 17  PSKVAGKTYDYIIAGGGLTGLTVAAKLTENPKIKVLVIEKGFYESNDGAIIEDPNAYGQI 76

Query: 60  SLSEFDHAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAK-L 118
             +  D  YL  P       + N    I AGKGLGGS+ +    + R      +++ K  
Sbjct: 77  FGTTVDQNYLTVP------LINNRTNNIKAGKGLGGSTLINGDSWTRPDKVQIDSWEKVF 130

Query: 119 GYNGWGYDETLKYFVKSEDYRSV-------IYNESKAVHGTQGYLPVGLFKN-KENNIIR 170
           G  GW +D   +Y  K+E  R+         ++ +   HGT G +  G   N +  + I 
Sbjct: 131 GMEGWNWDNMFEYMKKAEAARTPTAAQLAAGHSFNATCHGTNGTVQSGARDNGQPWSPIM 190

Query: 171 EIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVL 230
           +    +   LG P  +D    +       +  +    +R  AA A+L P   +R+NL +L
Sbjct: 191 KALMNTVSALGVPVQQDFLCGHPRGVSMIMNNLDENQVRVDAARAWLLPN-YQRSNLEIL 249

Query: 231 KRSKVTKVIINDQ---NVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGP 287
               V KV+         A GV +  +K     V A  EV+L AG+  +  +L  SGIG 
Sbjct: 250 TGQMVGKVLFKQTASGPQAVGVNFGTNKAVNFDVFAKHEVLLAAGSAISPLILEYSGIGL 309

Query: 288 KAHLDEVKIPVKQDLR--VGENL 308
           K+ LD+  +    DL   +   +
Sbjct: 310 KSVLDQANVTQLLDLPVGICSMM 332


>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 351 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query512
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 100.0
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 100.0
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 100.0
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 100.0
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 100.0
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 100.0
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 100.0
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.76
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.71
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.7
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.64
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.58
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.57
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.56
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.56
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.51
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.5
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.45
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.43
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 99.38
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.38
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.34
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.17
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 99.12
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.87
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.8
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.71
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.61
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.61
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.55
d1kdga2181 Flavoprotein domain of flavocytochrome cellobiose 98.55
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.55
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.53
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.53
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.51
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.49
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.43
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.42
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.41
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.39
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.38
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.38
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.38
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.34
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.34
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.3
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.28
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.25
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.23
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.22
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.2
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.16
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 98.16
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 98.15
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.13
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.13
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.12
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.12
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.12
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.11
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.09
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 98.08
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.05
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.02
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.02
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.01
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 97.97
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.9
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.87
d1gpea2196 Glucose oxidase {Penicillium amagasakiense [TaxId: 97.82
d1cf3a2196 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 97.76
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 97.75
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.75
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.71
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.69
d1ju2a2170 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 97.63
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 97.59
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.52
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.41
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.33
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 97.32
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 97.3
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 97.27
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.22
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.19
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 97.02
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 96.88
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 96.82
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 96.8
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.77
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.62
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 96.54
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 96.37
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.36
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.25
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 96.12
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.94
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.91
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.86
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.79
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 95.29
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.2
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.72
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 94.59
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 94.08
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 93.83
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 93.79
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 93.57
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 93.01
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 92.93
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 92.79
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 92.57
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 92.5
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 92.31
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 92.22
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 92.14
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 91.63
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 90.3
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 90.14
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 90.11
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 89.99
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 89.87
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 89.67
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 89.63
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 89.29
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 89.14
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 89.12
d1id1a_153 Rck domain from putative potassium channel Kch {Es 88.97
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 88.05
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 87.93
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 87.9
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 87.88
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 87.86
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 87.7
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 87.57
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 87.55
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 87.29
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 87.29
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 87.12
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 86.92
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 86.79
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 86.63
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 85.99
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 85.75
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 85.75
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 85.41
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 85.28
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 85.12
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 84.85
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 84.68
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 84.4
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 84.21
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 84.06
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 83.89
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 83.87
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 83.37
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 83.34
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 83.3
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 82.76
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 82.71
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 82.62
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 82.56
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 82.52
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 82.23
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 82.05
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 81.68
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 81.06
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 80.89
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 80.55
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 80.41
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 80.04
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 80.02
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Glucose oxidase
species: Aspergillus niger [TaxId: 5061]
Probab=100.00  E-value=5.9e-57  Score=447.44  Aligned_cols=352  Identities=30%  Similarity=0.415  Sum_probs=286.0

Q ss_pred             CCCcccEEEECCChhHHHHHHHHhCCCCCeEEEEcCcCCCCC---CCccCCccccccCCccccceecccccCcccCCCCc
Q psy1058           7 SGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPI---HSRIPGMSSVLSLSEFDHAYLAEPSQFAGLGVRNA   83 (512)
Q Consensus         7 ~~~~~DviVVGsG~aG~~~A~~La~~~g~~VlvlE~g~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   83 (512)
                      .+++|||||||||.+||++|.+|+|+++.+|||||+|+....   ....+..+..+..+.++|.|.+.++.     ..++
T Consensus        14 ~~~tyD~IIVGsG~aG~vlA~rLse~~~~~VLvLEaG~~~~~~~~~~~~~~~~~~~~~~~~dw~~~t~~~~-----~~~r   88 (385)
T d1cf3a1          14 SGRTVDYIIAGGGLTGLTTAARLTENPNISVLVIESGSYESDRGPIIEDLNAYGDIFGSSVDHAYETVELA-----TNNQ   88 (385)
T ss_dssp             TTCEEEEEEECCSHHHHHHHHHHTTSTTCCEEEEESSCCCTTSCHHHHBGGGTTTTTTSTTBCCEECCCCT-----TTSC
T ss_pred             cCCeEEEEEECcCHHHHHHHHHHHHCCCCeEEEECCCCCCCCCCccccCHhHHhhhcCCCCCcCccccCcC-----CCCc
Confidence            456799999999999999999999985689999999986432   12334455556667789999877653     6788


Q ss_pred             eeeeecCcccchhhhhcCceeecCChhhHHHHHHc-CCCCCChhhHHHHHHHhccCcCCCcC-------CCCCCCCCCCc
Q psy1058          84 RIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKL-GYNGWGYDETLKYFVKSEDYRSVIYN-------ESKAVHGTQGY  155 (512)
Q Consensus        84 ~~~~~~g~~lGG~s~~~~~~~~r~~~~~~~~~~~~-g~~~w~~~~l~~~~~~~e~~~~~~~~-------~~~~~~~~~g~  155 (512)
                      .+.+.+|+++||+|.+|++.+.|+.+.||+.|... +..+|+|+++.|||+++|++......       .+...++..++
T Consensus        89 ~~~~~~G~~lGGsS~in~~~~~R~~~~d~d~w~~~~~~~gw~~~~l~Pyf~k~E~~~~~~~~~~~~~~~~~~~~~g~~~~  168 (385)
T d1cf3a1          89 TALIRSGNGLGGSTLVNGGTWTRPHKAQVDSWETVFGNEGWNWDNVAAYSLQAERARAPNAKQIAAGHYFNASCHGVNGT  168 (385)
T ss_dssp             CCEECCBCSTTGGGGTSCCBCCCCCHHHHHHHHHTTCCTTCSHHHHHHHHHHHEEECCCCHHHHHHTCCCCGGGSCSSSS
T ss_pred             eeeecccccccccceeeeeeeeccChhhhcccccccCCCcCchhhhHHHHHHHHhhcCCCcccccccccccccccCCccc
Confidence            89999999999999999999999999999999986 67899999999999999998754321       13455677777


Q ss_pred             eeeccCCCC-CcchHHHHHHHHHHHcCCCCCCCCCCCCcccceeecccccC-CCeecchhhhhhhcccCCCCCEEEEcCc
Q psy1058         156 LPVGLFKNK-ENNIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTR-YGLRFSAADAYLTPIAGKRTNLYVLKRS  233 (512)
Q Consensus       156 ~~~~~~~~~-~~~~~~~~~~~~~~~~G~~~~~~~~~~~~~~g~~~~~~~~~-~~~r~~~~~~~l~~~~~~~~g~~v~~~~  233 (512)
                      +.+...... ...+..+.+.++++++|++...+.++.. ..+++.+...+. ...+..+...++.++. +++|++|++++
T Consensus       169 ~~~~~~~~~~~~~p~~~~~~~a~~~~G~~~~~d~n~~~-~~~~~~~~~~~~~~~~~~~s~~~~~~p~~-~~~nl~i~t~~  246 (385)
T d1cf3a1         169 VHAGPRDTGDDYSPIVKALMSAVEDRGVPTKKDFGCGD-PHGVSMFPNTLHEDQVRSDAAREWLLPNY-QRPNLQVLTGQ  246 (385)
T ss_dssp             EEEBCCCCSSCBCTHHHHHHHHHHTTTCCBCCCTTSSC-CCEEECCCBSBCTTCBBCCHHHHHTGGGT-TCTTEEEEESC
T ss_pred             ccccccccccccCHHHHHHHHHHHHcCCCCcCCccccc-ccccccccccccccccchhhhhhhcCchh-cCCcccccCCc
Confidence            776543221 1257888999999999999887888777 666555544433 3344455667888888 89999999999


Q ss_pred             EEEEEEecCC---CeEEEEEEEecCCeEEEEecCcEEEEcCCchhcHHHHHHcCCCChhhhccCCCCccccccccccccc
Q psy1058         234 KVTKVIINDQ---NVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLRVGENLKL  310 (512)
Q Consensus       234 ~V~~i~~~~~---~~v~GV~~~~~~g~~~~v~A~k~VVlaaGa~~t~~lL~~Sgig~~~~l~~~gi~~~~~~~vG~~l~d  310 (512)
                      .|++|+++++   .|++||++.+.+|+.++++|+|+||||||+++||+||++|||||+++|+++||+++.++|       
T Consensus       247 ~V~rI~~~~~~~~~ra~GV~~~~~~g~~~~v~A~keVILsAGAi~SP~LLl~SGIGp~~~L~~~gI~~~~dlP-------  319 (385)
T d1cf3a1         247 YVGKVLLSQNGTTPRAVGVEFGTHKGNTHNVYAKHEVLLAAGSAVSPTILEYSGIGMKSILEPLGIDTVVDLP-------  319 (385)
T ss_dssp             EEEEEEEECSSSSCEEEEEEEEEETTEEEEEEEEEEEEECSCTTTHHHHHHHTTBSCHHHHGGGTCCCSBCCC-------
T ss_pred             eEEEEEEcCCCceeEEEEEEEEcCCCCEEEEEeCCEEEEcCchhhCHHHHHhcCCCcHHHHHHCCCCeEEECC-------
Confidence            9999999821   289999998768999999999889999999999999999999999999888876655433       


Q ss_pred             ccCCCcceEEecCCcccccccHHHHHHHhhcCCCCCCCcccceEEEEEecCCCCCCCCeEEEEeccccchhhHHHHHHHH
Q psy1058         311 NAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQNTARPDLEIHLLYFQQNDIRNMYLATLI  390 (512)
Q Consensus       311 h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~y~~~~~  390 (512)
                                                                                                      
T Consensus       320 --------------------------------------------------------------------------------  319 (385)
T d1cf3a1         320 --------------------------------------------------------------------------------  319 (385)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             HHHHHHHHHhcchhHHHhcccccccCCccCCCCCCCCHHHHHHHHHhhcCCCccccccccccCCCCCCCccCCCCeEecc
Q psy1058         391 RGTDYITRLEQTEAIRLAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGI  470 (512)
Q Consensus       391 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~H~~Gt~~Mg~~~~~~~VvD~~~rv~g~  470 (512)
                                                                             .|+|.|..++ .++|||+..+|+|+
T Consensus       320 -------------------------------------------------------~g~~~~~~~~-~~~vv~~~~~v~g~  343 (385)
T d1cf3a1         320 -------------------------------------------------------VGLCSMMPKE-MGGVVDNAARVYGV  343 (385)
T ss_dssp             -------------------------------------------------------TTCTCBSCGG-GTCSBCTTSBBTTC
T ss_pred             -------------------------------------------------------cchhccCCCC-cccccccccccccc
Confidence                                                                   2344444332 34899999999999


Q ss_pred             CCcEEEeeccCCCCCCCCchHHHHHHHHHHHHHHHhhc
Q psy1058         471 KGLRVADISVLPNAIITQSDAISYMIGEKCADLVKTSY  508 (512)
Q Consensus       471 ~nl~V~D~Sv~P~~~~~np~lTi~ala~r~a~~i~~~~  508 (512)
                      +||+|+|+|++|..++.|++.|++|+|+++||.|+++|
T Consensus       344 ~~lr~v~~s~~p~~~~~~~~~~~~~~a~~~~d~i~~~~  381 (385)
T d1cf3a1         344 QGLRVIDGSIPPTQMSSHVMTVFYAMALKISDAILEDY  381 (385)
T ss_dssp             BSEEECSTTCCSSCCSSCSHHHHHHHHHHHHHHHHHHH
T ss_pred             cCeEeecCcCCcccccCchhHHHHHHhhhhHHHHHHHH
Confidence            99999999999999999999999999999999999987



>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kdga2 d.16.1.1 (A:513-693) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), substrate-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gpea2 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1cf3a2 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ju2a2 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure