Diaphorina citri psyllid: psy10590

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340----

MCVGEKRKLTIPPALAYGDRGAGNVIPGGATLTFEVELLSIGDQVTTTNVFKEIDSDADKQLSREEVSEYLKKQMVAAEGSEGAEDVKHMLEEHDKLVEEIFQHEDKDKNGFISHDEFSGPKHDELGLPNVFKEIDSDADKQLSREEVSEYLKKQMVAAEGSEVEEIFQHEDKDKNGFISHDEFSGPKHDELHDRDQPFTFTLGVGQVIKGWDQGLTEMCVGEKRKLTIPPALAYGDRGAGNVIPGGATLTFEVELLSIGDQVTTTNVFKEIDSDADKQLSREEVSEYLKKQMVAAEGSEGAEDVKHMLEEHDKLVEEIFQHEDKDKNGFISHDEFSGPKHDEL

cccccEEEEEEccccccccccccccccccccEEEEEEEEEEccccccccccccccccccccccHHHHHHHHEEEEEccccccccccccccHHHHHHHHHHHHHHcccccccCECccccccccccccccccccccccccccccccccccccEEEEEEEEEcccccccccEEEEEEccEEEEEcccccccccccccccccEEEEcccccccHHHHHHHHccccccEEEEEEcccccccccccccccccccEEEEEEEEEEEcccccccccHHHHcccccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccc

***GEKRKLTIPPALAYGDRGAGNVIPGGATLTFEVELLSIGDQVTTTNVFKE*********SREEVSEYLKKQMVAAEGS**AEDVKHMLEEHDKLVEEIFQHEDKDKNGFIS***************NVFKEIDSDADKQLSREEVSEYLKKQMVAAEGSEVEE*FQHEDKDKNGFISHDEFSGPKHDELHDRDQPFTFTLGVGQVIKGWDQGLTEMCVGEKRKLTIPPALAYGDRGAGNVIPGGATLTFEVELLSIGDQVTTTNVFKEIDSD****LSREEVSEYLKKQM*************HMLEEHDKLVEEIFQHEDKDKNGFISHDEFSGP*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
FK506-binding protein 2	PPIases accelerate the folding of proteins by catalyzing the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.	confident	Q54SR7
FK506-binding protein 2	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.	confident	Q4WHX4
FK506-binding protein 2	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.	confident	Q6CUZ8

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0051716 [BP]	cellular response to stimulus	probable	GO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0044425 [CC]	membrane part	probable	GO:0005575, GO:0016020
GO:0016853 [MF]	isomerase activity	probable	GO:0003824, GO:0003674
GO:0016529 [CC]	sarcoplasmic reticulum	probable	GO:0005737, GO:0005783, GO:0043229, GO:0044464, GO:0016528, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0043231
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0048523 [BP]	negative regulation of cellular process	probable	GO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044432 [CC]	endoplasmic reticulum part	probable	GO:0005737, GO:0005575, GO:0005783, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0019220 [BP]	regulation of phosphate metabolic process	probable	GO:0019222, GO:0031323, GO:0050794, GO:0051174, GO:0065007, GO:0008150, GO:0050789
GO:0080090 [BP]	regulation of primary metabolic process	probable	GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0048518 [BP]	positive regulation of biological process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0000413 [BP]	protein peptidyl-prolyl isomerization	probable	GO:0044267, GO:0018208, GO:0044260, GO:0044238, GO:0019538, GO:0044237, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0018193, GO:0008152
GO:0005773 [CC]	vacuole	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005528 [MF]	FK506 binding	probable	GO:0097159, GO:1901363, GO:0008144, GO:0003674, GO:0005488, GO:0005527
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0043167 [MF]	ion binding	probable	GO:0003674, GO:0005488
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3JXV, chain A
Confidence level:very confident
Coverage over the Query: 185-261
View the alignment between query and template
View the model in PyMOL

Template: 1IJ5, chain A
Confidence level:very confident
Coverage over the Query: 36-79,95-186,211-215,263-293,309-340
View the alignment between query and template
View the model in PyMOL

Template: 2BE4, chain A
Confidence level:very confident
Coverage over the Query: 38-215,260-340
View the alignment between query and template
View the model in PyMOL

Template: 1JVW, chain A
Confidence level:very confident
Coverage over the Query: 1-43,57-74
View the alignment between query and template
View the model in PyMOL