BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy10627
         (92 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3FB2|A Chain A, Crystal Structure Of The Human Brain Alpha Spectrin
           Repeats 15 And 16. Northeast Structural Genomics
           Consortium Target Hr5563a.
 pdb|3FB2|B Chain B, Crystal Structure Of The Human Brain Alpha Spectrin
           Repeats 15 And 16. Northeast Structural Genomics
           Consortium Target Hr5563a
          Length = 218

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 7/80 (8%)

Query: 15  EIDGRQETFKSLKEFGLKV-------SPPREPELTKLDELRRQLASSWEEQRTRLDHAHQ 67
           EID R  TF++ ++FG ++       SP  + +L  LD+ R  L  +W ++R  LD   +
Sbjct: 61  EIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRXXLDQCLE 120

Query: 68  AQMFKEAADQAENWLVTKEA 87
            Q+F    +QAENW   +EA
Sbjct: 121 LQLFHRDCEQAENWXAAREA 140


>pdb|1S35|A Chain A, Crystal Structure Of Repeats 8 And 9 Of Human Erythroid
           Spectrin
          Length = 214

 Score = 32.0 bits (71), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 39/82 (47%), Gaps = 8/82 (9%)

Query: 15  EIDGRQETFKSLKEFGLKVSPPR-EPE-------LTKLDELRRQLASSWEEQRTRLDHAH 66
           EIDG Q++++ +KE G KV   + +PE       L  LD     L   WE +   L    
Sbjct: 48  EIDGHQDSYQRVKESGEKVIQGQTDPEYLLLGQRLEGLDTGWDALGRMWESRSHTLAQCL 107

Query: 67  QAQMFKEAADQAENWLVTKEAT 88
             Q F++ A QAE  L  +E T
Sbjct: 108 GFQEFQKDAKQAEAILSNQEYT 129


>pdb|3LBX|B Chain B, Crystal Structure Of The Erythrocyte Spectrin
           Tetramerization Domain Complex
          Length = 185

 Score = 26.9 bits (58), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 7/80 (8%)

Query: 14  AEIDGRQETFKSLKEFG-------LKVSPPREPELTKLDELRRQLASSWEEQRTRLDHAH 66
           AEI+ R + F +  E G        + S     +L ++   R+++   WE +  RL    
Sbjct: 51  AEIETRSKNFSACLELGESLLQRQHQASEEIREKLQQVMSRRKEMNEKWEARWERLRMLL 110

Query: 67  QAQMFKEAADQAENWLVTKE 86
           +   F   A  AE WL+ +E
Sbjct: 111 EVCQFSRDASVAEAWLIAQE 130


>pdb|3EDV|A Chain A, Crystal Structure Of Repeats 14-16 Of Beta2-Spectrin
 pdb|3EDV|B Chain B, Crystal Structure Of Repeats 14-16 Of Beta2-Spectrin
          Length = 323

 Score = 26.6 bits (57), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 7/53 (13%)

Query: 13  QAEIDGRQETFKSLKEFGLKV-------SPPREPELTKLDELRRQLASSWEEQ 58
           +AEID R ++F +  E G  +       S   + +L +L E R+++   WE++
Sbjct: 265 KAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDR 317


>pdb|2UV9|A Chain A, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Alpha Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UV9|B Chain B, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Alpha Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UV9|C Chain C, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Alpha Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UV9|D Chain D, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Alpha Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UV9|E Chain E, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Alpha Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UV9|F Chain F, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Alpha Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UVB|A Chain A, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Alpha Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
 pdb|2UVB|B Chain B, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Alpha Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
 pdb|2UVB|C Chain C, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Alpha Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
 pdb|2UVB|D Chain D, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Alpha Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
 pdb|2UVB|E Chain E, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Alpha Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
 pdb|2UVB|F Chain F, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Alpha Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
          Length = 1878

 Score = 26.2 bits (56), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 3/32 (9%)

Query: 27  KEFGLKVSPPREPELTKLDELRRQLASSWEEQ 58
           KEFG   S P +PE T LDEL   + ++++ Q
Sbjct: 192 KEFG---STPEKPEDTPLDELGASMQATFDGQ 220


>pdb|2PBR|A Chain A, Crystal Structure Of Thymidylate Kinase (Aq_969) From
          Aquifex Aeolicus Vf5
 pdb|2PBR|B Chain B, Crystal Structure Of Thymidylate Kinase (Aq_969) From
          Aquifex Aeolicus Vf5
          Length = 195

 Score = 25.4 bits (54), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 7/54 (12%)

Query: 16 IDGRQET------FKSLKEFGLKVSPPREPELTKLDELRRQLASSWE-EQRTRL 62
          IDG  +T      ++ LK+ G  VS  REP  TK+ E+ R++  + E ++RT L
Sbjct: 8  IDGSGKTTQAKKLYEYLKQKGYFVSLYREPGGTKVGEVLREILLTEELDERTEL 61


>pdb|2UVA|G Chain G, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Beta Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UVA|H Chain H, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Beta Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UVA|I Chain I, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Beta Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UVA|J Chain J, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Beta Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UVA|K Chain K, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Beta Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UVA|L Chain L, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Beta Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UVC|G Chain G, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Beta Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
 pdb|2UVC|H Chain H, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Beta Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
 pdb|2UVC|I Chain I, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Beta Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
 pdb|2UVC|J Chain J, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Beta Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
 pdb|2UVC|K Chain K, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Beta Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
 pdb|2UVC|L Chain L, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Beta Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
          Length = 2060

 Score = 25.0 bits (53), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 4/53 (7%)

Query: 4   KVYSILFSSQAEIDGRQETFKSLKEFGLKVSPPREPELTKLDELRRQLASSWE 56
           K+YSI F  Q  I   +E F  L+E         E  +T + EL + LA  W+
Sbjct: 150 KIYSI-FGGQGNI---EEYFDELREIYTTYPSFVEDLITSIAELLQSLAREWD 198


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.313    0.127    0.358 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,526,663
Number of Sequences: 62578
Number of extensions: 78730
Number of successful extensions: 218
Number of sequences better than 100.0: 14
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 209
Number of HSP's gapped (non-prelim): 15
length of query: 92
length of database: 14,973,337
effective HSP length: 59
effective length of query: 33
effective length of database: 11,281,235
effective search space: 372280755
effective search space used: 372280755
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 45 (21.9 bits)