BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy10627
(92 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3FB2|A Chain A, Crystal Structure Of The Human Brain Alpha Spectrin
Repeats 15 And 16. Northeast Structural Genomics
Consortium Target Hr5563a.
pdb|3FB2|B Chain B, Crystal Structure Of The Human Brain Alpha Spectrin
Repeats 15 And 16. Northeast Structural Genomics
Consortium Target Hr5563a
Length = 218
Score = 50.4 bits (119), Expect = 2e-07, Method: Compositional matrix adjust.
Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 7/80 (8%)
Query: 15 EIDGRQETFKSLKEFGLKV-------SPPREPELTKLDELRRQLASSWEEQRTRLDHAHQ 67
EID R TF++ ++FG ++ SP + +L LD+ R L +W ++R LD +
Sbjct: 61 EIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRXXLDQCLE 120
Query: 68 AQMFKEAADQAENWLVTKEA 87
Q+F +QAENW +EA
Sbjct: 121 LQLFHRDCEQAENWXAAREA 140
>pdb|1S35|A Chain A, Crystal Structure Of Repeats 8 And 9 Of Human Erythroid
Spectrin
Length = 214
Score = 32.0 bits (71), Expect = 0.088, Method: Compositional matrix adjust.
Identities = 28/82 (34%), Positives = 39/82 (47%), Gaps = 8/82 (9%)
Query: 15 EIDGRQETFKSLKEFGLKVSPPR-EPE-------LTKLDELRRQLASSWEEQRTRLDHAH 66
EIDG Q++++ +KE G KV + +PE L LD L WE + L
Sbjct: 48 EIDGHQDSYQRVKESGEKVIQGQTDPEYLLLGQRLEGLDTGWDALGRMWESRSHTLAQCL 107
Query: 67 QAQMFKEAADQAENWLVTKEAT 88
Q F++ A QAE L +E T
Sbjct: 108 GFQEFQKDAKQAEAILSNQEYT 129
>pdb|3LBX|B Chain B, Crystal Structure Of The Erythrocyte Spectrin
Tetramerization Domain Complex
Length = 185
Score = 26.9 bits (58), Expect = 2.7, Method: Compositional matrix adjust.
Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 7/80 (8%)
Query: 14 AEIDGRQETFKSLKEFG-------LKVSPPREPELTKLDELRRQLASSWEEQRTRLDHAH 66
AEI+ R + F + E G + S +L ++ R+++ WE + RL
Sbjct: 51 AEIETRSKNFSACLELGESLLQRQHQASEEIREKLQQVMSRRKEMNEKWEARWERLRMLL 110
Query: 67 QAQMFKEAADQAENWLVTKE 86
+ F A AE WL+ +E
Sbjct: 111 EVCQFSRDASVAEAWLIAQE 130
>pdb|3EDV|A Chain A, Crystal Structure Of Repeats 14-16 Of Beta2-Spectrin
pdb|3EDV|B Chain B, Crystal Structure Of Repeats 14-16 Of Beta2-Spectrin
Length = 323
Score = 26.6 bits (57), Expect = 4.1, Method: Compositional matrix adjust.
Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 7/53 (13%)
Query: 13 QAEIDGRQETFKSLKEFGLKV-------SPPREPELTKLDELRRQLASSWEEQ 58
+AEID R ++F + E G + S + +L +L E R+++ WE++
Sbjct: 265 KAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDR 317
>pdb|2UV9|A Chain A, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Alpha Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UV9|B Chain B, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Alpha Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UV9|C Chain C, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Alpha Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UV9|D Chain D, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Alpha Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UV9|E Chain E, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Alpha Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UV9|F Chain F, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Alpha Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UVB|A Chain A, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Alpha Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
pdb|2UVB|B Chain B, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Alpha Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
pdb|2UVB|C Chain C, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Alpha Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
pdb|2UVB|D Chain D, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Alpha Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
pdb|2UVB|E Chain E, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Alpha Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
pdb|2UVB|F Chain F, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Alpha Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
Length = 1878
Score = 26.2 bits (56), Expect = 4.7, Method: Compositional matrix adjust.
Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 3/32 (9%)
Query: 27 KEFGLKVSPPREPELTKLDELRRQLASSWEEQ 58
KEFG S P +PE T LDEL + ++++ Q
Sbjct: 192 KEFG---STPEKPEDTPLDELGASMQATFDGQ 220
>pdb|2PBR|A Chain A, Crystal Structure Of Thymidylate Kinase (Aq_969) From
Aquifex Aeolicus Vf5
pdb|2PBR|B Chain B, Crystal Structure Of Thymidylate Kinase (Aq_969) From
Aquifex Aeolicus Vf5
Length = 195
Score = 25.4 bits (54), Expect = 8.7, Method: Compositional matrix adjust.
Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 7/54 (12%)
Query: 16 IDGRQET------FKSLKEFGLKVSPPREPELTKLDELRRQLASSWE-EQRTRL 62
IDG +T ++ LK+ G VS REP TK+ E+ R++ + E ++RT L
Sbjct: 8 IDGSGKTTQAKKLYEYLKQKGYFVSLYREPGGTKVGEVLREILLTEELDERTEL 61
>pdb|2UVA|G Chain G, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UVA|H Chain H, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UVA|I Chain I, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UVA|J Chain J, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UVA|K Chain K, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UVA|L Chain L, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UVC|G Chain G, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
pdb|2UVC|H Chain H, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
pdb|2UVC|I Chain I, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
pdb|2UVC|J Chain J, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
pdb|2UVC|K Chain K, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
pdb|2UVC|L Chain L, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
Length = 2060
Score = 25.0 bits (53), Expect = 9.9, Method: Compositional matrix adjust.
Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 4/53 (7%)
Query: 4 KVYSILFSSQAEIDGRQETFKSLKEFGLKVSPPREPELTKLDELRRQLASSWE 56
K+YSI F Q I +E F L+E E +T + EL + LA W+
Sbjct: 150 KIYSI-FGGQGNI---EEYFDELREIYTTYPSFVEDLITSIAELLQSLAREWD 198
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.313 0.127 0.358
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,526,663
Number of Sequences: 62578
Number of extensions: 78730
Number of successful extensions: 218
Number of sequences better than 100.0: 14
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 209
Number of HSP's gapped (non-prelim): 15
length of query: 92
length of database: 14,973,337
effective HSP length: 59
effective length of query: 33
effective length of database: 11,281,235
effective search space: 372280755
effective search space used: 372280755
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 45 (21.9 bits)