Diaphorina citri psyllid: psy10632

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270---

MILILAVIGGFVVAVTVLHVLWKLVNGFRVHVIGQYVDLKQKYGSWAALRVEYQKYGITVQHIAPAFVSTKMNNFSYRVRNKSFFVPDAEQYARSAVSTLGVTDTSTGFWVHGIQSFVVTGCTDGIGRAYAHELARRGINIVLISRTLEKLKKTAKEIESLHGVQTKIIAVDLSGTKAAIEAVKNQLGDHPVHILVNNVGSLSSYPKSLTEDTEKETWDTLSLNVVFTTLMTKLILPRMKDNGRGAIVNVSSISEASPWALFNVYAATKTVRY

cEEEEEHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccEEECccccccccccccccccccHHHHHHHHcccccccccccccccccccEEEEcccccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHcccEEEEEEEcccccHHHHHHHHHHHcccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccEEccccccc

xHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044281 [BP]	small molecule metabolic process	probable	GO:0044710, GO:0008150, GO:0008152
GO:0044255 [BP]	cellular lipid metabolic process	probable	GO:0044238, GO:0044710, GO:0006629, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152
GO:0044249 [BP]	cellular biosynthetic process	probable	GO:0009058, GO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0034754 [BP]	cellular hormone metabolic process	probable	GO:0042445, GO:0009987, GO:0044237, GO:0010817, GO:0008150, GO:0008152, GO:0065007, GO:0065008
GO:0008610 [BP]	lipid biosynthetic process	probable	GO:1901576, GO:0044710, GO:0006629, GO:0044238, GO:0071704, GO:0009058, GO:0008150, GO:0008152
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008202 [BP]	steroid metabolic process	probable	GO:0044238, GO:0044710, GO:0006629, GO:0071704, GO:0008150, GO:0008152, GO:1901360
GO:0044446 [CC]	intracellular organelle part	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0033764 [MF]	steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	probable	GO:0016229, GO:0016614, GO:0016616, GO:0003824, GO:0003674, GO:0016491
GO:0051262 [BP]	protein tetramerization	probable	GO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FN4, chain A
Confidence level:very confident
Coverage over the Query: 109-272
View the alignment between query and template
View the model in PyMOL

Template: 3P19, chain A
Confidence level:confident
Coverage over the Query: 45-74
View the alignment between query and template
View the model in PyMOL

Template: 3ZU3, chain A
Confidence level:confident
Coverage over the Query: 86-272
View the alignment between query and template
View the model in PyMOL