Diaphorina citri psyllid: psy10638


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MPKLINEKDKLLSPSSDLKCKKLSPSSCSSSSSKSKRVRTIFTPEQLERLEAEFERQQYMVGPERLYLAHTLNLTEAQVKVWFQNRRIKWRKQHLEFQQQRLAAIKQSQLNQQQENLHQQSSDQHHTSQHQYLFQQGEIA
cccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccc
*****************************************FTPEQLERLEAEFERQQYMVGPERLYLAHTLNLTEAQVKVWFQNRRIKWRKQ***********************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPKLINEKDKLLSPSSDLKCKKLSPSSCSSSSSKSKRVRTIFTPEQLERLEAEFERQQYMVGPERLYLAHTLNLTEAQVKVWFQNRRIKWRKQHLEFQQQRLAAIKQSQLNQQQENLHQQSSDQHHTSQHQYLFQQGEIA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Homeobox protein EMX2 Transcription factor, which in cooperation with EMX2, acts to generate the boundary between the roof and archipallium in the developing brain. May function in combinations with OTX1/2 to specify cell fates in the developing central nervous system.confidentQ04743
Homeobox protein EMX2 Transcription factor, which in cooperation with EMX2, acts to generate the boundary between the roof and archipallium in the developing brain. May function in combinations with OTX1/2 to specify cell fates in the developing central nervous system.confidentQ04744
Homeobox protein EMX2 Transcription factor, which in cooperation with EMX2, acts to generate the boundary between the roof and archipallium in the developing brain. May function in combinations with OTX1/2 to specify cell fates in the developing central nervous system.confidentQ17R00

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0014028 [BP]notochord formationprobableGO:0032502, GO:0048598, GO:0048570, GO:0048562, GO:0044707, GO:0007399, GO:0048568, GO:0032501, GO:0048856, GO:0009887, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0044699, GO:0030903, GO:0048731, GO:0009653, GO:0007275, GO:0048646
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0048863 [BP]stem cell differentiationprobableGO:0032502, GO:0030154, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0031490 [MF]chromatin DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:0003682, GO:1901363
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0050877 [BP]neurological system processprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707, GO:0003008
GO:0007409 [BP]axonogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0008150
GO:0045664 [BP]regulation of neuron differentiationprobableGO:0030154, GO:0007275, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0050789, GO:0008150, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0044763, GO:0051239, GO:0022008, GO:0048699, GO:0007399, GO:0044707, GO:0048856, GO:0051960, GO:2000026, GO:0048731
GO:0009791 [BP]post-embryonic developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0008150, GO:0007275, GO:0044699
GO:0003160 [BP]endocardium morphogenesisprobableGO:0032502, GO:0007507, GO:0032501, GO:0044707, GO:0003157, GO:0072358, GO:0048856, GO:0044767, GO:0072359, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0001764 [BP]neuron migrationprobableGO:0040011, GO:0032502, GO:0048699, GO:0048856, GO:0044707, GO:0007399, GO:0048870, GO:0009987, GO:0048869, GO:0032501, GO:0030154, GO:0006928, GO:0008150, GO:0051674, GO:0044763, GO:0007275, GO:0048731, GO:0022008, GO:0016477, GO:0051179, GO:0044699
GO:0009880 [BP]embryonic pattern specificationprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0009953 [BP]dorsal/ventral pattern formationprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0001947 [BP]heart loopingprobableGO:0032502, GO:0009790, GO:0072359, GO:0072358, GO:0009799, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0007368, GO:0048513, GO:0048729, GO:0060562, GO:0061371, GO:0048598, GO:0009887, GO:0032501, GO:0035239, GO:0007507, GO:0060429, GO:0035050, GO:0009888, GO:0003007, GO:0007389, GO:0008150, GO:0035295, GO:0003143, GO:0044707, GO:0048856, GO:0044767, GO:0009855, GO:0048731
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0030325 [BP]adrenal gland developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0035270, GO:0048513, GO:0008150, GO:0048731, GO:0048732, GO:0007275, GO:0044699
GO:2000223 [BP]regulation of BMP signaling pathway involved in heart joggingprobableGO:0090092, GO:0051239, GO:0022603, GO:0050793, GO:0048583, GO:0050794, GO:0008150, GO:0009966, GO:2000026, GO:2000027, GO:0045995, GO:0023051, GO:0065007, GO:0010646, GO:2000826, GO:0050789, GO:0030510
GO:0060041 [BP]retina development in camera-type eyeprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0048731, GO:0008150, GO:0043010, GO:0007275, GO:0044699
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0021982 [BP]pineal gland developmentprobableGO:0032502, GO:0021536, GO:0032501, GO:0007420, GO:0044707, GO:0048856, GO:0007399, GO:0044767, GO:0035270, GO:0048513, GO:0030900, GO:0008150, GO:0048731, GO:0048732, GO:0007275, GO:0044699, GO:0007417
GO:0021987 [BP]cerebral cortex developmentprobableGO:0021537, GO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0021543, GO:0048513, GO:0030900, GO:0048731, GO:0008150, GO:0007275, GO:0044699, GO:0007417
GO:0003140 [BP]determination of left/right asymmetry in lateral mesodermprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0007498, GO:0007368, GO:0048856, GO:0009888, GO:0008150, GO:0009855, GO:0009799, GO:0007275, GO:0044699, GO:0048368
GO:0001077 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcriptionprobableGO:0003700, GO:0001228, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0007517 [BP]muscle organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0061061, GO:0048731, GO:0007275, GO:0044699
GO:0032835 [BP]glomerulus developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0001822, GO:0007275, GO:0044767, GO:0048513, GO:0008150, GO:0001655, GO:0048731, GO:0072001, GO:0072006, GO:0044699
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000980 [MF]RNA polymerase II distal enhancer sequence-specific DNA bindingprobableGO:0005488, GO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001158, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363, GO:0035326
GO:0045165 [BP]cell fate commitmentprobableGO:0032502, GO:0030154, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A01, chain A
Confidence level:very confident
Coverage over the Query: 31-90
View the alignment between query and template
View the model in PyMOL