Query         psy10647
Match_columns 92
No_of_seqs    21 out of 23
Neff          1.8 
Searched_HMMs 46136
Date          Fri Aug 16 23:52:27 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10647.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10647hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF00339 Arrestin_N:  Arrestin   98.1 4.8E-06 1.1E-10   52.9   3.5   35    8-42      1-35  (149)
  2 KOG3780|consensus               97.9 1.8E-05   4E-10   59.6   4.2   40    4-43      3-42  (427)
  3 PF00339 Arrestin_N:  Arrestin   97.0  0.0008 1.7E-08   42.7   3.2   34   56-89      1-34  (149)
  4 KOG3780|consensus               96.6  0.0021 4.5E-08   48.6   3.1   38   52-89      3-40  (427)
  5 PF01868 UPF0086:  Domain of un  86.1     1.3 2.9E-05   29.1   3.6   52   25-76     30-81  (89)
  6 PRK11556 multidrug efflux syst  75.8     3.5 7.5E-05   32.6   3.3   32    5-36    289-320 (415)
  7 smart00538 POP4 A domain found  73.6     5.9 0.00013   26.4   3.6   52   25-76     29-80  (92)
  8 cd08975 BaFpgNei_N_3 Uncharact  59.6      45 0.00097   22.5   5.7   22   50-71     89-111 (117)
  9 PRK09783 copper/silver efflux   53.4      14 0.00031   29.2   2.9   28    5-32    295-322 (409)
 10 cd08976 BaFpgNei_N_4 Uncharact  51.5      66  0.0014   21.0   6.2   21   48-68     86-106 (117)
 11 KOG3052|consensus               49.5     6.9 0.00015   32.4   0.6   22   67-88    221-247 (311)
 12 PRK15030 multidrug efflux syst  47.4      27 0.00059   27.1   3.5   30    6-35    274-303 (397)
 13 PF12532 DUF3732:  Protein of u  45.9     9.2  0.0002   28.1   0.7   13   10-22    104-116 (193)
 14 PF12790 T6SS-SciN:  Type VI se  45.1      70  0.0015   21.7   4.9   47   13-61     79-125 (142)
 15 PF01835 A2M_N:  MG2 domain;  I  42.4      64  0.0014   19.8   4.0   27    8-36      2-28  (99)
 16 PF03643 Vps26:  Vacuolar prote  42.2      27 0.00059   27.3   2.8   20   16-35     32-51  (275)
 17 PRK09859 multidrug efflux syst  42.1      42 0.00091   25.8   3.8   32    5-36    269-300 (385)
 18 PRK09783 copper/silver efflux   38.8      49  0.0011   26.2   3.8   27   53-79    295-321 (409)
 19 PRK09578 periplasmic multidrug  38.4      40 0.00086   25.9   3.1   31    6-36    273-303 (385)
 20 PF02996 Prefoldin:  Prefoldin   34.1      37  0.0008   21.6   2.1   31   56-86     39-70  (120)
 21 PRK11556 multidrug efflux syst  33.5      43 0.00094   26.5   2.7   32   53-84    289-320 (415)
 22 COG1588 POP4 RNase P/RNase MRP  32.1      60  0.0013   22.8   3.0   51   24-75     32-82  (95)
 23 cd08972 PF_Nei_N N-terminal do  32.1 1.7E+02  0.0038   20.2   6.5   19   50-68    107-125 (137)
 24 TIGR00999 8a0102 Membrane Fusi  32.0      63  0.0014   22.6   3.1   31    6-36    173-203 (265)
 25 TIGR01730 RND_mfp RND family e  31.7      66  0.0014   22.8   3.2   32    5-36    220-251 (322)
 26 cd01723 LSm4 The eukaryotic Sm  30.0      36 0.00077   21.4   1.4   18   74-91     11-28  (76)
 27 cd08974 BaFpgNei_N_2 Uncharact  29.6 1.7E+02  0.0036   19.2   6.0   19   50-68     76-94  (98)
 28 KOG3063|consensus               27.1      96  0.0021   25.8   3.8   23   17-39     40-62  (301)
 29 PF01149 Fapy_DNA_glyco:  Forma  26.2 1.9E+02  0.0041   18.7   5.7   48    7-69     59-107 (116)
 30 PRK03879 ribonuclease P protei  25.7   1E+02  0.0022   20.9   3.1   35   25-60     31-65  (96)
 31 PF01774 UreD:  UreD urease acc  24.9      88  0.0019   22.6   2.9   55   28-86     28-90  (209)
 32 cd06182 CYPOR_like NADPH cytoc  24.6      55  0.0012   24.2   1.8   22    4-25     16-38  (267)
 33 cd08773 FpgNei_N N-terminal do  24.6   2E+02  0.0044   18.5   6.1   19   50-68     88-106 (117)
 34 PRK11578 macrolide transporter  23.8   1E+02  0.0023   23.4   3.2   29    8-36    277-305 (370)
 35 cd06208 CYPOR_like_FNR These f  23.5      58  0.0013   24.0   1.7   19    8-26     29-48  (286)
 36 PF11611 DUF4352:  Domain of un  22.5      98  0.0021   19.1   2.4   28   17-44     85-112 (123)
 37 PF04019 DUF359:  Protein of un  21.8      57  0.0012   22.9   1.4   23   14-38     86-108 (121)
 38 PF12700 HlyD_2:  HlyD family s  21.4 1.2E+02  0.0027   21.5   3.0   29    5-33    243-271 (328)
 39 cd08966 EcFpg-like_N N-termina  21.2 2.4E+02  0.0053   18.2   6.2   24   49-72     88-113 (120)
 40 PRK04163 exosome complex RNA-b  21.1 2.6E+02  0.0057   20.9   4.8   17    9-26      2-18  (235)
 41 cd01721 Sm_D3 The eukaryotic S  21.0      57  0.0012   20.2   1.1   17   75-91     11-27  (70)
 42 cd06221 sulfite_reductase_like  20.7      78  0.0017   22.8   1.9   25    4-28     10-37  (253)
 43 PF13759 2OG-FeII_Oxy_5:  Putat  20.0 2.4E+02  0.0052   17.7   4.0   56   20-75     18-85  (101)

No 1  
>PF00339 Arrestin_N:  Arrestin (or S-antigen), N-terminal domain;  InterPro: IPR011021 G protein-coupled receptors are a large family of signalling molecules that respond to a wide variety of extracellular stimuli. The receptors relay the information encoded by the ligand through the activation of heterotrimeric G proteins and intracellular effector molecules. To ensure the appropriate regulation of the signalling cascade, it is vital to properly inactivate the receptor. This inactivation is achieved, in part, by the binding of a soluble protein, arrestin, which uncouples the receptor from the downstream G protein after the receptors are phosphorylated by G protein-coupled receptor kinases. In addition to the inactivation of G protein-coupled receptors, arrestins have also been implicated in the endocytosis of receptors and cross talk with other signalling pathways. Arrestin (retinal S-antigen) is a major protein of the retinal rod outer segments. It interacts with photo-activated phosphorylated rhodopsin, inhibiting or 'arresting' its ability to interact with transducin []. The protein binds calcium, and shows similarity in its C terminus to alpha-transducin and other purine nucleotide-binding proteins. In mammals, arrestin is associated with autoimmune uveitis. Arrestins comprise a family of closely-related proteins that includes beta-arrestin-1 and -2, which regulate the function of beta-adrenergic receptors by binding to their phosphorylated forms, impairing their capacity to activate G(S) proteins; Cone photoreceptors C-arrestin (arrestin-X) [], which could bind to phosphorylated red/green opsins; and Drosophila phosrestins I and II, which undergo light-induced phosphorylation, and probably play a role in photoreceptor transduction [, , ].  The crystal structure of bovine retinal arrestin comprises two domains of antiparallel beta-sheets connected through a hinge region and one short alpha-helix on the back of the amino-terminal fold []. The binding region for phosphorylated light-activated rhodopsin is located at the N-terminal domain, as indicated by the docking of the photoreceptor to the three-dimensional structure of arrestin.  The N-terminal domain consists of an immunoglobulin-like beta-sandwich structure. This entry represents proteins with immunoglobulin-like domains that are similar to those found in arrestin.; PDB: 1SUJ_A 3UGX_A 1CF1_B 1AYR_A 3UGU_A 3P2D_B 1ZSH_A 2WTR_B 3GC3_A 1G4R_A ....
Probab=98.06  E-value=4.8e-06  Score=52.89  Aligned_cols=35  Identities=40%  Similarity=0.719  Sum_probs=28.1

Q ss_pred             EEEEeeCCceeEecCcccceeEEEEecCCcceeee
Q psy10647          8 FVILFDNTNLVYFPGQYLSGRVLIELKDDTPALGF   42 (92)
Q Consensus         8 f~IiFDn~~llYFPGQ~lSGRVLle~qe~t~~lgl   42 (92)
                      |.|.||++.-.|+||+.++|+|.|++.+++.+-++
T Consensus         1 ~~I~ld~~~~~y~~Ge~I~G~V~l~~~~~~~i~~i   35 (149)
T PF00339_consen    1 FEIELDNPKPVYFPGEVISGKVVLELSKPIKIKSI   35 (149)
T ss_dssp             EEEEES-SEEEEESS--EEEEEEECTTT-TTTSEE
T ss_pred             CEEEECCCCCEECCCCEEEEEEEEEECCccceeEE
Confidence            68999999999999999999999999998876554


No 2  
>KOG3780|consensus
Probab=97.87  E-value=1.8e-05  Score=59.62  Aligned_cols=40  Identities=30%  Similarity=0.620  Sum_probs=36.0

Q ss_pred             cceEEEEEeeCCceeEecCcccceeEEEEecCCcceeeee
Q psy10647          4 KLIKFVILFDNTNLVYFPGQYLSGRVLIELKDDTPALGFH   43 (92)
Q Consensus         4 kl~kf~IiFDn~~llYFPGQ~lSGRVLle~qe~t~~lglh   43 (92)
                      +...|.|.||++..+|+|||.+||+|++++.+...+-++.
T Consensus         3 ~~~~~~i~~d~~~~iy~~G~~vsG~v~l~~~~~~~~~~i~   42 (427)
T KOG3780|consen    3 TMSSFEIVLDNPEAIYFPGEPVSGSVVLSTKEPIKVRAIK   42 (427)
T ss_pred             CcceEEEEeCCCccccCCCCeEEEEEEEEeCCccceeEEE
Confidence            4568999999999999999999999999999999887654


No 3  
>PF00339 Arrestin_N:  Arrestin (or S-antigen), N-terminal domain;  InterPro: IPR011021 G protein-coupled receptors are a large family of signalling molecules that respond to a wide variety of extracellular stimuli. The receptors relay the information encoded by the ligand through the activation of heterotrimeric G proteins and intracellular effector molecules. To ensure the appropriate regulation of the signalling cascade, it is vital to properly inactivate the receptor. This inactivation is achieved, in part, by the binding of a soluble protein, arrestin, which uncouples the receptor from the downstream G protein after the receptors are phosphorylated by G protein-coupled receptor kinases. In addition to the inactivation of G protein-coupled receptors, arrestins have also been implicated in the endocytosis of receptors and cross talk with other signalling pathways. Arrestin (retinal S-antigen) is a major protein of the retinal rod outer segments. It interacts with photo-activated phosphorylated rhodopsin, inhibiting or 'arresting' its ability to interact with transducin []. The protein binds calcium, and shows similarity in its C terminus to alpha-transducin and other purine nucleotide-binding proteins. In mammals, arrestin is associated with autoimmune uveitis. Arrestins comprise a family of closely-related proteins that includes beta-arrestin-1 and -2, which regulate the function of beta-adrenergic receptors by binding to their phosphorylated forms, impairing their capacity to activate G(S) proteins; Cone photoreceptors C-arrestin (arrestin-X) [], which could bind to phosphorylated red/green opsins; and Drosophila phosrestins I and II, which undergo light-induced phosphorylation, and probably play a role in photoreceptor transduction [, , ].  The crystal structure of bovine retinal arrestin comprises two domains of antiparallel beta-sheets connected through a hinge region and one short alpha-helix on the back of the amino-terminal fold []. The binding region for phosphorylated light-activated rhodopsin is located at the N-terminal domain, as indicated by the docking of the photoreceptor to the three-dimensional structure of arrestin.  The N-terminal domain consists of an immunoglobulin-like beta-sandwich structure. This entry represents proteins with immunoglobulin-like domains that are similar to those found in arrestin.; PDB: 1SUJ_A 3UGX_A 1CF1_B 1AYR_A 3UGU_A 3P2D_B 1ZSH_A 2WTR_B 3GC3_A 1G4R_A ....
Probab=97.01  E-value=0.0008  Score=42.70  Aligned_cols=34  Identities=41%  Similarity=0.737  Sum_probs=26.6

Q ss_pred             EEEEEeCCeeeEecCcccceeEEEEecCCccccc
Q psy10647         56 FVILFDNTNLVYFPGQYLSGRVLIELKDDTPALA   89 (92)
Q Consensus        56 f~ilfdnt~llyfpgq~lsgrvl~el~~~t~~lg   89 (92)
                      |-|.||+..-.|+||+.++|+|.+++.++..+-+
T Consensus         1 ~~I~ld~~~~~y~~Ge~I~G~V~l~~~~~~~i~~   34 (149)
T PF00339_consen    1 FEIELDNPKPVYFPGEVISGKVVLELSKPIKIKS   34 (149)
T ss_dssp             EEEEES-SEEEEESS--EEEEEEECTTT-TTTSE
T ss_pred             CEEEECCCCCEECCCCEEEEEEEEEECCccceeE
Confidence            6799999999999999999999999988876644


No 4  
>KOG3780|consensus
Probab=96.58  E-value=0.0021  Score=48.62  Aligned_cols=38  Identities=34%  Similarity=0.656  Sum_probs=32.6

Q ss_pred             hheeEEEEEeCCeeeEecCcccceeEEEEecCCccccc
Q psy10647         52 KLIKFVILFDNTNLVYFPGQYLSGRVLIELKDDTPALA   89 (92)
Q Consensus        52 kl~kf~ilfdnt~llyfpgq~lsgrvl~el~~~t~~lg   89 (92)
                      +...|-|+||+.+-+|+|||.+||+|++++.+...+-+
T Consensus         3 ~~~~~~i~~d~~~~iy~~G~~vsG~v~l~~~~~~~~~~   40 (427)
T KOG3780|consen    3 TMSSFEIVLDNPEAIYFPGEPVSGSVVLSTKEPIKVRA   40 (427)
T ss_pred             CcceEEEEeCCCccccCCCCeEEEEEEEEeCCccceeE
Confidence            34678999999999999999999999999887766543


No 5  
>PF01868 UPF0086:  Domain of unknown function UPF0086;  InterPro: IPR002730 The p29 subunit (also known as Rpp29 or Pop4) of the related ribonucleoproteins ribonuclease (RNase) P and RNase MRP can be found in both eukaryotes and arachea []. The structure of the RNase P subunit, Rpp29, from Methanobacterium thermoautotrophicum has been determined. Mth Rpp29 is a member of the oligonucleotide/oligosaccharide binding fold family. It contains a structured beta-barrel core and unstructured N- and C-terminal extensions bearing several highly conserved amino acid residues that could be involved in RNA contacts in the protein-RNA complex []. Rpp29 (3.1.26.5 from EC) catalyses the endonucleolytic cleavage of RNA, removing 5'-extranucleotides from tRNA precursor. It interacts with the Rpp25 and Pop5 subunits. RNase P is a ubiquitous ribonucleoprotein enzyme primarily responsible for cleaving the 5' leader sequence during maturation of tRNAs in all three domains of life. In eubacteria, this enzyme is made up of two subunits: a large RNA (approximately 120 kDa) responsible for mediating catalysis, and a small protein cofactor (approximately 15 kDa) that modulates substrate recognition and is required for efficient in vivo catalysis. In contrast, multiple proteins are associated with eukaryotic and archaeal RNase P, and these proteins exhibit no recognizable homology to the conserved bacterial protein subunit. In reconstitution experiments with recombinantly expressed and purified protein subunits Mth Rpp29, a homologue of the Rpp29 protein subunit from eukaryotic RNase P, is an essential protein component of the archaeal holoenzyme []. In Saccharomyces cerevisiae (Baker's yeast), RNase P consists of 9 protein subunits (Pop1, Pop3-8, Rpr2 and Rpp1), while in humans there are 10 subunits (Rpp14, 20, 21, 25, 29, 30, 38, 40, hPop1, 5). RNase MRP (mitochondrial RNA processing) is an rRNA processing enzyme that cleaves a specific site within precursor rRNA to generate the mature 5'-end of 5.8S rRNA []. RNase MRP also cleaves primers for mitochondrial DNA replication and CLB2 mRNA. In yeast, RNase MRP possesses one putatively catalytic RNA and at least 9 protein subunits and is highly related to RNase P (Pop1, Pop3-Pop8, Rpp1, Snm1 and Rmp1).; GO: 0003723 RNA binding, 0004540 ribonuclease activity, 0006364 rRNA processing, 0006379 mRNA cleavage, 0008033 tRNA processing, 0000172 ribonuclease MRP complex, 0030677 ribonuclease P complex; PDB: 1V76_B 2ZAE_C 1OQK_A 2KI7_A 1TSF_A 1TS9_A 1PC0_A.
Probab=86.12  E-value=1.3  Score=29.07  Aligned_cols=52  Identities=19%  Similarity=0.167  Sum_probs=38.1

Q ss_pred             cceeEEEEecCCcceeeeeecccchhhhheeEEEEEeCCeeeEecCccccee
Q psy10647         25 LSGRVLIELKDDTPALGFHRSKNNMTRKLIKFVILFDNTNLVYFPGQYLSGR   76 (92)
Q Consensus        25 lSGRVLle~qe~t~~lglh~~~~~m~rkl~kf~ilfdnt~llyfpgq~lsgr   76 (92)
                      ++|.|+.||+.--.+..--..---.+++-.-|.+-+|+...+..-|.-|.+|
T Consensus        30 ~~GiVV~ETknt~~I~t~~~~~~~IpK~~~vF~~~~~~~~~~~i~G~~l~~r   81 (89)
T PF01868_consen   30 IEGIVVDETKNTFVIVTEDGKVKTIPKAGSVFEFELPGGSKVTIYGSRLVGR   81 (89)
T ss_dssp             EEEEEEEEETTEEEEEETTEEEEEEESTTEEEEEEETTTEEEEEEGGGCSS-
T ss_pred             CEEEEEEcccceEEEEecCCcEEEEecCCEEEEEEeCCCcEEEEEChhhccC
Confidence            8999999999876665322222246788888999999999777778777766


No 6  
>PRK11556 multidrug efflux system subunit MdtA; Provisional
Probab=75.84  E-value=3.5  Score=32.55  Aligned_cols=32  Identities=28%  Similarity=0.587  Sum_probs=26.7

Q ss_pred             ceEEEEEeeCCceeEecCcccceeEEEEecCC
Q psy10647          5 LIKFVILFDNTNLVYFPGQYLSGRVLIELKDD   36 (92)
Q Consensus         5 l~kf~IiFDn~~llYFPGQ~lSGRVLle~qe~   36 (92)
                      -.++.+.|||++--.+|||++..++.++..++
T Consensus       289 t~~v~a~~~n~~~~L~pG~~v~v~i~~~~~~~  320 (415)
T PRK11556        289 TIKLKARFNNQDDALFPNQFVNARMLVDTLQN  320 (415)
T ss_pred             EEEEEEEeCCCCCccCCCCEEEEEEEecCcCc
Confidence            35678999999888899999999988876655


No 7  
>smart00538 POP4 A domain found in a protein subunit of human RNase MRP and RNase P ribonucleoprotein complexes and archaeal proteins.
Probab=73.58  E-value=5.9  Score=26.41  Aligned_cols=52  Identities=17%  Similarity=0.208  Sum_probs=35.6

Q ss_pred             cceeEEEEecCCcceeeeeecccchhhhheeEEEEEeCCeeeEecCccccee
Q psy10647         25 LSGRVLIELKDDTPALGFHRSKNNMTRKLIKFVILFDNTNLVYFPGQYLSGR   76 (92)
Q Consensus        25 lSGRVLle~qe~t~~lglh~~~~~m~rkl~kf~ilfdnt~llyfpgq~lsgr   76 (92)
                      ++|+|+-||+..-.+..--....-.|++-.-|.+-+++.......|.-+.+|
T Consensus        29 i~GiVv~ET~nt~~I~t~~~~~~~IpK~~~vF~f~l~~~~~~~i~G~~l~~r   80 (92)
T smart00538       29 IEGIVVDETRNTLKIETKEGRVKTVPKDGAVFEFELPGGEIVRIDGDRLVGR   80 (92)
T ss_pred             cEEEEEEeeeeEEEEEeCCCcEEEEECCCeEEEEEECCCeEEEEECceeeeC
Confidence            7999999998765554321111235778888888888876666777766655


No 8  
>cd08975 BaFpgNei_N_3 Uncharacterized bacterial subgroup of the N-terminal domain of Fpg (formamidopyrimidine-DNA glycosylase, MutM)_Nei  (endonuclease VIII) base-excision repair DNA glycosylases. This family is an uncharacterized bacterial subgroup of the FpgNei_N domain superfamily. DNA glycosylases maintain genome integrity by recognizing base lesions created by ionizing radiation, alkylating or oxidizing agents, and endogenous reactive oxygen species. They initiate the base-excision repair process, which is completed with the help of enzymes such as phosphodiesterases, AP endonucleases, DNA polymerases and DNA ligases. DNA glycosylases cleave the N-glycosyl bond between the sugar and the damaged base, creating an AP (apurinic/apyrimidinic) site. Most FpgNei DNA glycosylases use their N-terminal proline residue as the key catalytic nucleophile, and the reaction proceeds via a Schiff base intermediate. One exception is mouse Nei-like glycosylase 3 (Neil3) which forms a Schiff base int
Probab=59.59  E-value=45  Score=22.50  Aligned_cols=22  Identities=27%  Similarity=0.428  Sum_probs=15.0

Q ss_pred             hhhheeEEEEEeCCe-eeEecCc
Q psy10647         50 TRKLIKFVILFDNTN-LVYFPGQ   71 (92)
Q Consensus        50 ~rkl~kf~ilfdnt~-llyfpgq   71 (92)
                      +.|-.++.+.|||.+ |.|-|-.
T Consensus        89 ~~kh~~l~l~~~dg~~L~f~~~~  111 (117)
T cd08975          89 IPKKYQLLIEFDDDSFLVFTVAM  111 (117)
T ss_pred             CCCeEEEEEEECCCCEEEEEEEE
Confidence            346677888888765 7776643


No 9  
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional
Probab=53.44  E-value=14  Score=29.16  Aligned_cols=28  Identities=14%  Similarity=0.133  Sum_probs=23.3

Q ss_pred             ceEEEEEeeCCceeEecCcccceeEEEE
Q psy10647          5 LIKFVILFDNTNLVYFPGQYLSGRVLIE   32 (92)
Q Consensus         5 l~kf~IiFDn~~llYFPGQ~lSGRVLle   32 (92)
                      -.+.++.|||++....||++.+.++..+
T Consensus       295 t~~vrv~l~N~~~~L~pGm~v~v~i~~~  322 (409)
T PRK09783        295 TLQLRLEVDNADEALKPGMNAWLQLNTA  322 (409)
T ss_pred             EEEEEEEEeCCCCccCCCCEEEEEEecC
Confidence            3578899999999999999998887543


No 10 
>cd08976 BaFpgNei_N_4 Uncharacterized bacterial subgroup of the N-terminal domain of Fpg (formamidopyrimidine-DNA glycosylase, MutM)_Nei  (endonuclease VIII) base-excision repair DNA glycosylases. This family is an uncharacterized bacterial subgroup of the FpgNei_N domain superfamily. DNA glycosylases maintain genome integrity by recognizing base lesions created by ionizing radiation, alkylating or oxidizing agents, and endogenous reactive oxygen species. They initiate the base-excision repair process, which is completed with the help of enzymes such as phosphodiesterases, AP endonucleases, DNA polymerases and DNA ligases. DNA glycosylases cleave the N-glycosyl bond between the sugar and the damaged base, creating an AP (apurinic/apyrimidinic) site. Most FpgNei DNA glycosylases use their N-terminal proline residue as the key catalytic nucleophile, and the reaction proceeds via a Schiff base intermediate. This N-terminal proline is conserved in this family. Escherichia coli Fpg prefers 8
Probab=51.46  E-value=66  Score=20.98  Aligned_cols=21  Identities=14%  Similarity=0.273  Sum_probs=14.1

Q ss_pred             chhhhheeEEEEEeCCeeeEe
Q psy10647         48 NMTRKLIKFVILFDNTNLVYF   68 (92)
Q Consensus        48 ~m~rkl~kf~ilfdnt~llyf   68 (92)
                      ..+.|-.++.+.|||.+-|.|
T Consensus        86 ~~~~kh~~~~l~l~~g~~l~~  106 (117)
T cd08976          86 EDPPKHARLLLHFEDGFRLAF  106 (117)
T ss_pred             CCCCCEEEEEEEECCCCEEEE
Confidence            345677888888887664444


No 11 
>KOG3052|consensus
Probab=49.49  E-value=6.9  Score=32.41  Aligned_cols=22  Identities=50%  Similarity=0.972  Sum_probs=17.7

Q ss_pred             EecCcccc-eeEE----EEecCCcccc
Q psy10647         67 YFPGQYLS-GRVL----IELKDDTPAL   88 (92)
Q Consensus        67 yfpgq~ls-grvl----~el~~~t~~l   88 (92)
                      ||||+.++ +|||    ||.+|.||+-
T Consensus       221 yFpGgaIaMa~~l~de~vEyeDgtPAT  247 (311)
T KOG3052|consen  221 YFPGGAIAMAKVLFDEVVEYEDGTPAT  247 (311)
T ss_pred             CCCCcccccchhhcccceeecCCCchh
Confidence            89998776 5665    8999999973


No 12 
>PRK15030 multidrug efflux system transporter AcrA; Provisional
Probab=47.36  E-value=27  Score=27.13  Aligned_cols=30  Identities=23%  Similarity=0.482  Sum_probs=23.6

Q ss_pred             eEEEEEeeCCceeEecCcccceeEEEEecC
Q psy10647          6 IKFVILFDNTNLVYFPGQYLSGRVLIELKD   35 (92)
Q Consensus         6 ~kf~IiFDn~~llYFPGQ~lSGRVLle~qe   35 (92)
                      ....+.|||++....||++...++.....+
T Consensus       274 ~~V~~~~~n~~~~L~pGm~~~v~i~~~~~~  303 (397)
T PRK15030        274 ITLRAIFPNPDHTLLPGMFVRARLEEGLNP  303 (397)
T ss_pred             EEEEEEEeCCCCcccCCCEEEEEEeecCcC
Confidence            467788999998889999988777665433


No 13 
>PF12532 DUF3732:  Protein of unknown function (DUF3732);  InterPro: IPR022205  This domain family is found in bacteria and eukaryotes, and is typically between 180 and 198 amino acids in length. There is a conserved DQP sequence motif. 
Probab=45.87  E-value=9.2  Score=28.13  Aligned_cols=13  Identities=38%  Similarity=0.968  Sum_probs=12.0

Q ss_pred             EEeeCCceeEecC
Q psy10647         10 ILFDNTNLVYFPG   22 (92)
Q Consensus        10 IiFDn~~llYFPG   22 (92)
                      ++||+|+=+|||=
T Consensus       104 L~lDQPSQvYfp~  116 (193)
T PF12532_consen  104 LFLDQPSQVYFPS  116 (193)
T ss_pred             eeecCCCcCcCCC
Confidence            5789999999998


No 14 
>PF12790 T6SS-SciN:  Type VI secretion lipoprotein;  InterPro: IPR017734 This entry represents a family of lipoproteins associated with IAHP-related loci, thought to be type VI secretion system protein []. ; PDB: 3RX9_A.
Probab=45.14  E-value=70  Score=21.70  Aligned_cols=47  Identities=15%  Similarity=0.175  Sum_probs=25.4

Q ss_pred             eCCceeEecCcccceeEEEEecCCcceeeeeecccchhhhheeEEEEEe
Q psy10647         13 DNTNLVYFPGQYLSGRVLIELKDDTPALGFHRSKNNMTRKLIKFVILFD   61 (92)
Q Consensus        13 Dn~~llYFPGQ~lSGRVLle~qe~t~~lglh~~~~~m~rkl~kf~ilfd   61 (92)
                      +....+..|||..+  +-++..+++..+|+----.++...-.|.++=.+
T Consensus        79 ~~~e~~l~Pg~~~~--~~~~~~~~aryigvvA~fr~~~~~~wr~~~~~~  125 (142)
T PF12790_consen   79 SVDEFVLQPGESRT--LTLDRDPDARYIGVVAGFRDPDGAQWRRVIPVP  125 (142)
T ss_dssp             EEEEEEE-TT-EEE--EEEE--TT--EEEEEE--SS--TT-SEEEEEGG
T ss_pred             cceEEEECCCCcEe--eeEccCCCCcEEEEEEEEeCCCCCceEEEEECC
Confidence            44567789999887  669999999999987666666655555544443


No 15 
>PF01835 A2M_N:  MG2 domain;  InterPro: IPR002890 The proteinase-binding alpha-macroglobulins (A2M) [] are large glycoproteins found in the plasma of vertebrates, in the hemolymph of some invertebrates and in reptilian and avian egg white. A2M-like proteins are able to inhibit all four classes of proteinases by a 'trapping' mechanism. They have a peptide stretch, called the 'bait region', which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein, thus trapping the proteinase. The entrapped enzyme remains active against low molecular weight substrates, whilst its activity toward larger substrates is greatly reduced, due to steric hindrance. Following cleavage in the bait region, a thiol ester bond, formed between the side chains of a cysteine and a glutamine, is cleaved and mediates the covalent binding of the A2M-like protein to the proteinase. This family includes the N-terminal region of the alpha-2-macroglobulin family. The inhibitor domains belong to MEROPS inhibitor family I39.; GO: 0004866 endopeptidase inhibitor activity; PDB: 2B39_B 3KLS_B 3PRX_C 3KM9_B 3PVM_C 3CU7_A 4E0S_A 4A5W_A 4ACQ_C 2P9R_B ....
Probab=42.35  E-value=64  Score=19.78  Aligned_cols=27  Identities=26%  Similarity=0.450  Sum_probs=20.8

Q ss_pred             EEEEeeCCceeEecCcccceeEEEEecCC
Q psy10647          8 FVILFDNTNLVYFPGQYLSGRVLIELKDD   36 (92)
Q Consensus         8 f~IiFDn~~llYFPGQ~lSGRVLle~qe~   36 (92)
                      .-|.-|++  +|-|||-+.-|+++-..++
T Consensus         2 ~~i~TDr~--iYrPGetV~~~~~~~~~~~   28 (99)
T PF01835_consen    2 IFIQTDRP--IYRPGETVHFRAIVRDLDN   28 (99)
T ss_dssp             EEEEESSS--EE-TTSEEEEEEEEEEECT
T ss_pred             EEEECCcc--CcCCCCEEEEEEEEecccc
Confidence            34566666  7999999999999888873


No 16 
>PF03643 Vps26:  Vacuolar protein sorting-associated protein 26 ;  InterPro: IPR005377  The movement of lipid and protein components between intracellular organelles requires the regulated interactions of many molecules. Vacuolar protein sorting-associated protein (Vps)5 is a yeast protein that is a subunit of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from endosomes to the trans-Golgi network. Sorting nexin (SNX) 1 and SNX2 are its mammalian orthologs []. To carry out its biological functions, Vps5 forms the retromer complex with at least four other proteins: Vps17, Vps26, Vps29, and Vps35 []. This family of Vps26-proteins also contains Down syndrome critical region 3/A.; GO: 0007034 vacuolar transport, 0030904 retromer complex; PDB: 3LHA_A 3LH9_A 2R51_A 3LH8_B 2FAU_A.
Probab=42.19  E-value=27  Score=27.28  Aligned_cols=20  Identities=40%  Similarity=0.635  Sum_probs=16.7

Q ss_pred             ceeEecCcccceeEEEEecC
Q psy10647         16 NLVYFPGQYLSGRVLIELKD   35 (92)
Q Consensus        16 ~llYFPGQ~lSGRVLle~qe   35 (92)
                      +-+|.+|..++|.|.+..++
T Consensus        32 ~~iY~~gE~V~G~V~I~~~~   51 (275)
T PF03643_consen   32 NPIYSDGETVSGKVVITSKP   51 (275)
T ss_dssp             EEEEETC--EEEEEEEEESS
T ss_pred             eceEcCCCEEEEEEEEEECC
Confidence            36999999999999999999


No 17 
>PRK09859 multidrug efflux system protein MdtE; Provisional
Probab=42.05  E-value=42  Score=25.82  Aligned_cols=32  Identities=22%  Similarity=0.355  Sum_probs=24.5

Q ss_pred             ceEEEEEeeCCceeEecCcccceeEEEEecCC
Q psy10647          5 LIKFVILFDNTNLVYFPGQYLSGRVLIELKDD   36 (92)
Q Consensus         5 l~kf~IiFDn~~llYFPGQ~lSGRVLle~qe~   36 (92)
                      .....+.+||++-...||++.+.++-....++
T Consensus       269 t~~v~~~~~n~~~~l~pGm~v~v~i~~~~~~~  300 (385)
T PRK09859        269 SVTLRAIFPNPNGDLLPGMYVTALVDEGSRQN  300 (385)
T ss_pred             eEEEEEEEECCCCeECCCCEEEEEEeccccCC
Confidence            34677889999989999999887776654443


No 18 
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional
Probab=38.82  E-value=49  Score=26.20  Aligned_cols=27  Identities=15%  Similarity=0.138  Sum_probs=22.0

Q ss_pred             heeEEEEEeCCeeeEecCcccceeEEE
Q psy10647         53 LIKFVILFDNTNLVYFPGQYLSGRVLI   79 (92)
Q Consensus        53 l~kf~ilfdnt~llyfpgq~lsgrvl~   79 (92)
                      -.+.-+.+||.+....||+|...++-.
T Consensus       295 t~~vrv~l~N~~~~L~pGm~v~v~i~~  321 (409)
T PRK09783        295 TLQLRLEVDNADEALKPGMNAWLQLNT  321 (409)
T ss_pred             EEEEEEEEeCCCCccCCCCEEEEEEec
Confidence            356788899999889999998877644


No 19 
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed
Probab=38.44  E-value=40  Score=25.87  Aligned_cols=31  Identities=19%  Similarity=0.322  Sum_probs=23.6

Q ss_pred             eEEEEEeeCCceeEecCcccceeEEEEecCC
Q psy10647          6 IKFVILFDNTNLVYFPGQYLSGRVLIELKDD   36 (92)
Q Consensus         6 ~kf~IiFDn~~llYFPGQ~lSGRVLle~qe~   36 (92)
                      ....+.|||++--..||++.+.++..+.+++
T Consensus       273 ~~V~~~~~n~~~~L~pGm~~~v~i~~~~~~~  303 (385)
T PRK09578        273 VAMRALFPNPERELLPGAYVRIALDRAVNPR  303 (385)
T ss_pred             EEEEEEEeCCCCcCCCCCEEEEEEEccCcCc
Confidence            4567889999888899999887776654444


No 20 
>PF02996 Prefoldin:  Prefoldin subunit;  InterPro: IPR004127 This entry comprises of several prefoldin subunits. Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea. Eukaryotic PFD is a multi-subunit complex containing six polypeptides in the molecular mass range of 14-23 kDa. In archaea, on the other hand, PFD is composed of two types of subunits, two alpha and four beta. The six subunits associate to form two back-to-back up-and-down eight-stranded barrels, from which hang six coiled coils. Each subunit contributes one (beta subunits) or two (alpha subunits) beta hairpin turns to the barrels. The coiled coils are formed by the N and C termini of an individual subunit. Overall, this unique arrangement resembles a jellyfish. The eukaryotic PFD hexamer is composed of six different subunits; however, these can be grouped into two alpha-like (PFD3 and -5) and four beta-like (PFD1, -2, -4, and -6) subunits based on amino acid sequence similarity with their archaeal counterparts. Eukaryotic PFD has a six-legged structure similar to that seen in the archaeal homologue [, ]. This family contains the archaeal alpha subunit, eukaryotic prefoldin subunits 3 and 5 and the UXT (ubiquitously expressed transcript) family.   Eukaryotic PFD has been shown to bind both actin and tubulin co-translationally. The chaperone then delivers the target protein to CCT, interacting with the chaperonin through the tips of the coiled coils. No authentic target proteins of any archaeal PFD have been identified, to date.; GO: 0051082 unfolded protein binding, 0006457 protein folding, 0016272 prefoldin complex; PDB: 1FXK_C 2ZDI_C.
Probab=34.12  E-value=37  Score=21.65  Aligned_cols=31  Identities=26%  Similarity=0.325  Sum_probs=24.5

Q ss_pred             EEEEEeCCeeeEecCcc-cceeEEEEecCCcc
Q psy10647         56 FVILFDNTNLVYFPGQY-LSGRVLIELKDDTP   86 (92)
Q Consensus        56 f~ilfdnt~llyfpgq~-lsgrvl~el~~~t~   86 (92)
                      .-++++-++-+|.||.+ -+.+|+|.+-.+..
T Consensus        39 ~~~lvplg~~~~v~g~i~~~~~vlV~lG~~~~   70 (120)
T PF02996_consen   39 HEILVPLGSGVFVPGKIPDTDKVLVSLGAGYY   70 (120)
T ss_dssp             -EEEEEECTTEEEEEE-SSTTEEEEEEETTEE
T ss_pred             ceeeecCCCCeEEEEEeCCCCEEEEEeeCCeE
Confidence            46788889999999988 78899999877643


No 21 
>PRK11556 multidrug efflux system subunit MdtA; Provisional
Probab=33.55  E-value=43  Score=26.48  Aligned_cols=32  Identities=28%  Similarity=0.587  Sum_probs=25.2

Q ss_pred             heeEEEEEeCCeeeEecCcccceeEEEEecCC
Q psy10647         53 LIKFVILFDNTNLVYFPGQYLSGRVLIELKDD   84 (92)
Q Consensus        53 l~kf~ilfdnt~llyfpgq~lsgrvl~el~~~   84 (92)
                      -.++.+-|||..-..+||+|...++.++...+
T Consensus       289 t~~v~a~~~n~~~~L~pG~~v~v~i~~~~~~~  320 (415)
T PRK11556        289 TIKLKARFNNQDDALFPNQFVNARMLVDTLQN  320 (415)
T ss_pred             EEEEEEEeCCCCCccCCCCEEEEEEEecCcCc
Confidence            46778889998777899999988887765444


No 22 
>COG1588 POP4 RNase P/RNase MRP subunit p29 [Translation, ribosomal structure and biogenesis]
Probab=32.15  E-value=60  Score=22.82  Aligned_cols=51  Identities=20%  Similarity=0.115  Sum_probs=29.2

Q ss_pred             ccceeEEEEecCCcceeeeeecccchhhhheeEEEEEeCCeeeEecCcccce
Q psy10647         24 YLSGRVLIELKDDTPALGFHRSKNNMTRKLIKFVILFDNTNLVYFPGQYLSG   75 (92)
Q Consensus        24 ~lSGRVLle~qe~t~~lglh~~~~~m~rkl~kf~ilfdnt~llyfpgq~lsg   75 (92)
                      =++|||+-||+.---...-- ..--.|+....|-+=.......=.+|..|-|
T Consensus        32 GI~G~VVdETkNtLvi~t~~-~~~~VpK~~~vfef~~~~G~~vkVdG~lL~~   82 (95)
T COG1588          32 GIEGRVVDETKNTLVIDTGS-REKVVPKDGAVFEFEGPDGEKVKVDGRLLLG   82 (95)
T ss_pred             ceeEEEEeeeccEEEEECCC-ceEEEecCcEEEEEEcCCCcEEEEcchhhhc
Confidence            48999999998654444333 3334566666666544444443344444433


No 23 
>cd08972 PF_Nei_N N-terminal domain of the plant and fungal Nei and related proteins. This family contains the N-terminal domain of plant and Fungi Nei and related proteins. It belongs to the FpgNei_N, [N-terminal domain of Fpg (formamidopyrimidine-DNA glycosylase, MutM)_Nei (endonuclease VIII)] domain superfamily. DNA glycosylases maintain genome integrity by recognizing base lesions created by ionizing radiation, alkylating or oxidizing agents, and endogenous reactive oxygen species. They initiate the base-excision repair process, which is completed with the help of enzymes such as phosphodiesterases, AP endonucleases, DNA polymerases and DNA ligases. DNA glycosylases cleave the N-glycosyl bond between the sugar and the damaged base, creating an AP (apurinic/apyrimidinic) site. Most FpgNei DNA glycosylases use their N-terminal proline residue as the key catalytic nucleophile, and the reaction proceeds via a Schiff base intermediate. The plant and fungal FpgNei glycosylases prefer the 
Probab=32.10  E-value=1.7e+02  Score=20.21  Aligned_cols=19  Identities=21%  Similarity=0.499  Sum_probs=14.1

Q ss_pred             hhhheeEEEEEeCCeeeEe
Q psy10647         50 TRKLIKFVILFDNTNLVYF   68 (92)
Q Consensus        50 ~rkl~kf~ilfdnt~llyf   68 (92)
                      +.|-.++.+.|||..-|.|
T Consensus       107 ~~kh~~~~l~l~~g~~L~f  125 (137)
T cd08972         107 PPRFYKFVLTLEDGTELAF  125 (137)
T ss_pred             CCceEEEEEEeCCCCEEEE
Confidence            4678888999988765555


No 24 
>TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters).
Probab=32.01  E-value=63  Score=22.59  Aligned_cols=31  Identities=29%  Similarity=0.467  Sum_probs=22.8

Q ss_pred             eEEEEEeeCCceeEecCcccceeEEEEecCC
Q psy10647          6 IKFVILFDNTNLVYFPGQYLSGRVLIELKDD   36 (92)
Q Consensus         6 ~kf~IiFDn~~llYFPGQ~lSGRVLle~qe~   36 (92)
                      ..+.+.|++++--..||+.++.++.....++
T Consensus       173 ~~v~~~~~~~~~~l~~G~~v~v~i~~~~~~~  203 (265)
T TIGR00999       173 AKVRVLIKNENLTLKPGLFVQVRVETKIGEP  203 (265)
T ss_pred             EEEEEEEeCCCCccCCCCEEEEEEecCCCCc
Confidence            4567788888767789999887776655444


No 25 
>TIGR01730 RND_mfp RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane.
Probab=31.70  E-value=66  Score=22.82  Aligned_cols=32  Identities=13%  Similarity=0.306  Sum_probs=25.0

Q ss_pred             ceEEEEEeeCCceeEecCcccceeEEEEecCC
Q psy10647          5 LIKFVILFDNTNLVYFPGQYLSGRVLIELKDD   36 (92)
Q Consensus         5 l~kf~IiFDn~~llYFPGQ~lSGRVLle~qe~   36 (92)
                      ..++.+.||+++.-+.||++++-++...-.++
T Consensus       220 ~~~v~~~~~~~~~~l~~G~~v~v~i~~~~~~~  251 (322)
T TIGR01730       220 TVRVRATFPNPDGRLLPGMFGRVTISLKVRSS  251 (322)
T ss_pred             eEEEEEEEcCCCCcCCCCCEEEEEEecCccCC
Confidence            46778889998888899999887777765544


No 26 
>cd01723 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. LSm4 is one of at least seven subunits that assemble onto U6 snRNA to form a seven-membered ring structure.  Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=29.99  E-value=36  Score=21.37  Aligned_cols=18  Identities=28%  Similarity=0.331  Sum_probs=15.0

Q ss_pred             ceeEEEEecCCccccccc
Q psy10647         74 SGRVLIELKDDTPALALL   91 (92)
Q Consensus        74 sgrvl~el~~~t~~lgl~   91 (92)
                      .=+|.||+++++.+-|.|
T Consensus        11 g~~V~VeLkng~~~~G~L   28 (76)
T cd01723          11 NHPMLVELKNGETYNGHL   28 (76)
T ss_pred             CCEEEEEECCCCEEEEEE
Confidence            348999999999988865


No 27 
>cd08974 BaFpgNei_N_2 Uncharacterized bacterial subgroup of the N-terminal domain of Fpg (formamidopyrimidine-DNA glycosylase, MutM)_Nei  (endonuclease VIII) base-excision repair DNA glycosylases. This family is an uncharacterized bacterial subgroup of the FpgNei_N domain superfamily. DNA glycosylases maintain genome integrity by recognizing base lesions created by ionizing radiation, alkylating or oxidizing agents, and endogenous reactive oxygen species. They initiate the base-excision repair process, which is completed with the help of enzymes such as phosphodiesterases, AP endonucleases, DNA polymerases and DNA ligases. DNA glycosylases cleave the N-glycosyl bond between the sugar and the damaged base, creating an AP (apurinic/apyrimidinic) site. Most FpgNei DNA glycosylases use their N-terminal proline residue as the key catalytic nucleophile, and the reaction proceeds via a Schiff base intermediate. This N-terminal proline is conserved in this family. Escherichia coli Fpg prefers 8
Probab=29.59  E-value=1.7e+02  Score=19.16  Aligned_cols=19  Identities=21%  Similarity=0.420  Sum_probs=14.1

Q ss_pred             hhhheeEEEEEeCCeeeEe
Q psy10647         50 TRKLIKFVILFDNTNLVYF   68 (92)
Q Consensus        50 ~rkl~kf~ilfdnt~llyf   68 (92)
                      +.|-..+.+.|||.++++|
T Consensus        76 ~~~~~~~~l~~~~g~~~~~   94 (98)
T cd08974          76 KDAPPRLSLGFDNGELNFY   94 (98)
T ss_pred             CCCcEEEEEEeCCCcEEEE
Confidence            4567777888888877766


No 28 
>KOG3063|consensus
Probab=27.08  E-value=96  Score=25.79  Aligned_cols=23  Identities=30%  Similarity=0.618  Sum_probs=20.3

Q ss_pred             eeEecCcccceeEEEEecCCcce
Q psy10647         17 LVYFPGQYLSGRVLIELKDDTPA   39 (92)
Q Consensus        17 llYFPGQ~lSGRVLle~qe~t~~   39 (92)
                      .+|.-|.-+||+|-++++++-++
T Consensus        40 ~lf~dgEtv~G~V~l~lk~gkkl   62 (301)
T KOG3063|consen   40 PLFYDGETVSGKVNLRLKDGKKL   62 (301)
T ss_pred             eeEecCCeeeeEEEEEEcCCccc
Confidence            58999999999999999986554


No 29 
>PF01149 Fapy_DNA_glyco:  Formamidopyrimidine-DNA glycosylase N-terminal domain;  InterPro: IPR012319 This entry represents the catalytic domain of DNA glycosylase/AP lyase enzymes, which are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Most damage to bases in DNA is repaired by the base excision repair pathway []. These enzymes are primarily from bacteria, and have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC). Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei).  Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines [, ]. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above (3.2.2 from EC, 4.2.99.18 from EC), but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine []. These protein contains three structural domains: an N-terminal catalytic core domain, a central helix-two turn-helix (H2TH) module and a C-terminal zinc finger []. The N-terminal catalytic domain and the C-terminal zinc finger straddle the DNA with the long axis of the protein oriented roughly orthogonal to the helical axis of the DNA. Residues that contact DNA are located in the catalytic domain and in a beta-hairpin loop formed by the zinc finger [].; GO: 0003684 damaged DNA binding, 0003906 DNA-(apurinic or apyrimidinic site) lyase activity, 0008270 zinc ion binding, 0016799 hydrolase activity, hydrolyzing N-glycosyl compounds, 0006284 base-excision repair; PDB: 1K82_C 3GQ3_A 3JR5_A 3SAT_A 3GPX_A 2F5Q_A 3SBJ_A 3U6S_A 3SAU_A 3SAR_A ....
Probab=26.16  E-value=1.9e+02  Score=18.67  Aligned_cols=48  Identities=15%  Similarity=0.313  Sum_probs=30.3

Q ss_pred             EEEEEeeCCceeE-ecCcccceeEEEEecCCcceeeeeecccchhhhheeEEEEEeCCeeeEec
Q psy10647          7 KFVILFDNTNLVY-FPGQYLSGRVLIELKDDTPALGFHRSKNNMTRKLIKFVILFDNTNLVYFP   69 (92)
Q Consensus         7 kf~IiFDn~~llY-FPGQ~lSGRVLle~qe~t~~lglh~~~~~m~rkl~kf~ilfdnt~llyfp   69 (92)
                      .+.+.||++..+. =.|  +||++.+             ....-+.|-.++.+-||+..-|.|=
T Consensus        59 ~L~~~l~~~~~l~~Hlg--MtG~~~~-------------~~~~~~~~~~~~~l~~~~g~~L~f~  107 (116)
T PF01149_consen   59 YLFFHLDGGLVLVVHLG--MTGRLRL-------------DPPDWPPKHTRLRLRFEDGSRLRFV  107 (116)
T ss_dssp             EEEEEETTTEEEEEE-T--TTEEEEE-------------STTCG-STTEEEEEEETSSEEEEEE
T ss_pred             EEEEEeCCCCEEEEeeC--CcEEEEe-------------cCCCCCCCeEEEEEEECCCCEEEEE
Confidence            4566776644333 344  6787777             3334567888999999888766663


No 30 
>PRK03879 ribonuclease P protein component 1; Validated
Probab=25.65  E-value=1e+02  Score=20.85  Aligned_cols=35  Identities=14%  Similarity=0.119  Sum_probs=23.7

Q ss_pred             cceeEEEEecCCcceeeeeecccchhhhheeEEEEE
Q psy10647         25 LSGRVLIELKDDTPALGFHRSKNNMTRKLIKFVILF   60 (92)
Q Consensus        25 lSGRVLle~qe~t~~lglh~~~~~m~rkl~kf~ilf   60 (92)
                      ++|+|+-||+.--.+..=.+ ..-.|++-.-|.+-+
T Consensus        31 i~GiVv~ETknt~~I~~~~~-~~~VPK~~~iF~f~~   65 (96)
T PRK03879         31 IKGRVVDETRNTLVIETDGK-EWMVPKDGATFEFEL   65 (96)
T ss_pred             ceEEEEEeceeEEEEEcCCc-EEEEeCCCeEEEEEE
Confidence            79999999997666651101 112567778888877


No 31 
>PF01774 UreD:  UreD urease accessory protein;  InterPro: IPR002669 UreD is a urease accessory protein. Urease IPR005848 from INTERPRO hydrolyses urea into ammonia and carbamic acid []. UreD is involved in activation of the urease enzyme via the UreD-UreF-UreG-urease complex [] and is required for urease nickel metallocentre assembly []. See also UreF IPR002639 from INTERPRO, UreG IPR004400 from INTERPRO.; GO: 0016151 nickel ion binding, 0006807 nitrogen compound metabolic process; PDB: 3SF5_D.
Probab=24.88  E-value=88  Score=22.61  Aligned_cols=55  Identities=20%  Similarity=0.379  Sum_probs=22.7

Q ss_pred             eEEEEecCCcceeeeeecccch-hhhheeEEEEEeCCeeeEecCcc-------cceeEEEEecCCcc
Q psy10647         28 RVLIELKDDTPALGFHRSKNNM-TRKLIKFVILFDNTNLVYFPGQY-------LSGRVLIELKDDTP   86 (92)
Q Consensus        28 RVLle~qe~t~~lglh~~~~~m-~rkl~kf~ilfdnt~llyfpgq~-------lsgrvl~el~~~t~   86 (92)
                      +++|.+|..|++   |++.++= ++.-.. +-+=+|..|-|+|.+.       ..-+.-+++.++.-
T Consensus        28 ~~~ltTqaatkv---y~~~~~~~a~q~~~-~~v~~ga~Le~lP~p~I~f~~A~~~q~~~v~l~~~A~   90 (209)
T PF01774_consen   28 RLLLTTQAATKV---YRMRGGRPARQRIR-ITVEEGAYLEYLPDPTIPFAGARFRQRTRVDLAPGAS   90 (209)
T ss_dssp             EEEEE----EEE------TTS--EEEEEE-EEE-TT-EEEE----EEE-TT-EEEEEEEEEE-TT-E
T ss_pred             EEEEechhhhhh---cCCCCCCcEEEEEE-EEECCCCEEEEcCCCCEeeCCCEEEEEEEEEECCCCE
Confidence            677778877775   6776554 443333 3345677777777654       34556666655543


No 32 
>cd06182 CYPOR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. CYPOR has a C-terminal ferredoxin reducatase (FNR)- like FAD and NAD binding module, an FMN-binding domain, and an additional conecting domain (inserted within the FAD binding region) that orients the FNR and FMN binding domains. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria and participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-t
Probab=24.62  E-value=55  Score=24.18  Aligned_cols=22  Identities=23%  Similarity=0.315  Sum_probs=14.1

Q ss_pred             cceEEEEEeeC-CceeEecCccc
Q psy10647          4 KLIKFVILFDN-TNLVYFPGQYL   25 (92)
Q Consensus         4 kl~kf~IiFDn-~~llYFPGQ~l   25 (92)
                      ...-|.+..++ ...-|-|||++
T Consensus        16 ~v~~l~l~~~~~~~~~~~pGQ~v   38 (267)
T cd06182          16 STRHLEFDLSGNSVLKYQPGDHL   38 (267)
T ss_pred             ceEEEEEecCCCCcCccCCCCEE
Confidence            34445555554 45669999997


No 33 
>cd08773 FpgNei_N N-terminal domain of Fpg (formamidopyrimidine-DNA glycosylase, MutM)_Nei (endonuclease VIII) base-excision repair DNA glycosylases. DNA glycosylases maintain genome integrity by recognizing base lesions created by ionizing radiation, alkylating or oxidizing agents, and endogenous reactive oxygen species. These enzymes initiate the base-excision repair process, which is completed with the help of enzymes such as phosphodiesterases, AP endonucleases, DNA polymerases and DNA ligases. DNA glycolsylases cleave the N-glycosyl bond between the sugar and the damaged base, creating an AP (apurinic/apyrimidinic) site. The FpgNei DNA glycosylases represent one of the two structural superfamilies of DNA glycosylases that recognize oxidized bases (the other is the HTH-GPD superfamily exemplified by Escherichia coli Nth). Most FpgNei DNA glycosylases use their N-terminal proline residue as the key catalytic nucleophile, and the reaction proceeds via a Schiff base intermediate. One e
Probab=24.59  E-value=2e+02  Score=18.48  Aligned_cols=19  Identities=21%  Similarity=0.284  Sum_probs=12.0

Q ss_pred             hhhheeEEEEEeCCeeeEe
Q psy10647         50 TRKLIKFVILFDNTNLVYF   68 (92)
Q Consensus        50 ~rkl~kf~ilfdnt~llyf   68 (92)
                      +.|-.+..+.|||..-|.|
T Consensus        88 ~~~~~~~~~~~~~~~~l~f  106 (117)
T cd08773          88 PPKHDRLVLRLANGSQLRF  106 (117)
T ss_pred             CCCeEEEEEEECCCCEEEE
Confidence            3466677777777654444


No 34 
>PRK11578 macrolide transporter subunit MacA; Provisional
Probab=23.85  E-value=1e+02  Score=23.41  Aligned_cols=29  Identities=7%  Similarity=-0.140  Sum_probs=21.7

Q ss_pred             EEEEeeCCceeEecCcccceeEEEEecCC
Q psy10647          8 FVILFDNTNLVYFPGQYLSGRVLIELKDD   36 (92)
Q Consensus         8 f~IiFDn~~llYFPGQ~lSGRVLle~qe~   36 (92)
                      ..+..+|++....||++...++.++..++
T Consensus       277 v~~~~~~~~~~l~~Gm~v~v~i~~~~~~~  305 (370)
T PRK11578        277 ARFEVPNPNGLLRLDMTAQVHIQLTDVKN  305 (370)
T ss_pred             EEEEecCCcCcCCCCCEEEEEEEEcccCC
Confidence            34456888888899999888887765554


No 35 
>cd06208 CYPOR_like_FNR These ferredoxin reductases are related to the NADPH cytochrome p450 reductases (CYPOR), but lack the FAD-binding region connecting sub-domain. Ferredoxin-NADP+ reductase (FNR) is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins, such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap between the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2, which then
Probab=23.46  E-value=58  Score=24.01  Aligned_cols=19  Identities=32%  Similarity=0.557  Sum_probs=12.6

Q ss_pred             EEEEeeCC-ceeEecCcccc
Q psy10647          8 FVILFDNT-NLVYFPGQYLS   26 (92)
Q Consensus         8 f~IiFDn~-~llYFPGQ~lS   26 (92)
                      +.+.|+-+ .+=|.|||+++
T Consensus        29 ~~~~l~~~~~~~~~pGQ~v~   48 (286)
T cd06208          29 CHIVIDHGGKLPYLEGQSIG   48 (286)
T ss_pred             EEEEEeCCCcccccCCceEE
Confidence            45556554 44589999964


No 36 
>PF11611 DUF4352:  Domain of unknown function (DUF4352);  InterPro: IPR021652 This entry is represented by Bacteriophage A118, Gp32. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry represents a group of putative lipoproteins of unknown function.; PDB: 3CFU_A.
Probab=22.53  E-value=98  Score=19.14  Aligned_cols=28  Identities=18%  Similarity=0.401  Sum_probs=18.4

Q ss_pred             eeEecCcccceeEEEEecCCcceeeeee
Q psy10647         17 LVYFPGQYLSGRVLIELKDDTPALGFHR   44 (92)
Q Consensus        17 llYFPGQ~lSGRVLle~qe~t~~lglh~   44 (92)
                      --.=||+-.+|.++.|..++.+-.-|.-
T Consensus        85 ~~i~pG~~~~g~l~F~vp~~~~~~~l~~  112 (123)
T PF11611_consen   85 ETIKPGESVTGKLVFEVPKDDKPYTLEY  112 (123)
T ss_dssp             EEE-TT-EEEEEEEEEESTT-GG-EEEE
T ss_pred             cEECCCCEEEEEEEEEECCCCccEEEEE
Confidence            3456999999999999999887544443


No 37 
>PF04019 DUF359:  Protein of unknown function (DUF359);  InterPro: IPR007164 This is family of archaebacterial proteins, which are about 170 amino acids in length. They have no known function. The most conserved portion of the protein contains the sequence GEEDL that may be important for its function.
Probab=21.84  E-value=57  Score=22.87  Aligned_cols=23  Identities=26%  Similarity=0.533  Sum_probs=17.7

Q ss_pred             CCceeEecCcccceeEEEEecCCcc
Q psy10647         14 NTNLVYFPGQYLSGRVLIELKDDTP   38 (92)
Q Consensus        14 n~~llYFPGQ~lSGRVLle~qe~t~   38 (92)
                      ++..+|  ||+=.|-|+++..++++
T Consensus        86 gs~V~Y--GQP~eGvV~v~v~~~~k  108 (121)
T PF04019_consen   86 GSVVLY--GQPGEGVVLVKVTEEAK  108 (121)
T ss_pred             CCEEEE--CCCCCeEEEEEeCHHHH
Confidence            344455  99999999999987654


No 38 
>PF12700 HlyD_2:  HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C ....
Probab=21.44  E-value=1.2e+02  Score=21.51  Aligned_cols=29  Identities=21%  Similarity=0.337  Sum_probs=20.5

Q ss_pred             ceEEEEEeeCCceeEecCcccceeEEEEe
Q psy10647          5 LIKFVILFDNTNLVYFPGQYLSGRVLIEL   33 (92)
Q Consensus         5 l~kf~IiFDn~~llYFPGQ~lSGRVLle~   33 (92)
                      ...+.+.+||++--+.||+++...+.+..
T Consensus       243 ~~~v~~~~~~~~~~l~~g~~v~v~i~~~~  271 (328)
T PF12700_consen  243 TFKVRVSLDNPNGNLRPGMFVEVSIILGS  271 (328)
T ss_dssp             EEEEEEEEE-SSS-S-TT-EEEEEEESEE
T ss_pred             eeEEEEEeccccchhhhcccccceecccc
Confidence            34788999999999999999998877665


No 39 
>cd08966 EcFpg-like_N N-terminal domain of Escherichia coli Fpg1/MutM and related bacterial DNA glycosylases. This family contains the N-terminal domain of Escherichia coli Fpg1/MutM and related bacterial DNA glycosylases. It belongs to the FpgNei_N, [N-terminal domain of Fpg (formamidopyrimidine-DNA glycosylase, MutM)_Nei (endonuclease VIII)] domain superfamily. DNA glycosylases maintain genome integrity by recognizing base lesions created by ionizing radiation, alkylating or oxidizing agents, and endogenous reactive oxygen species. They initiate the base-excision repair process, which is completed with the help of enzymes such as phosphodiesterases, AP endonucleases, DNA polymerases and DNA ligases. DNA glycosylases cleave the N-glycosyl bond between the sugar and the damaged base, creating an AP (apurinic/apyrimidinic) site. Most FpgNei DNA glycosylases use their N-terminal proline residue as the key catalytic nucleophile, and the reaction proceeds via a Schiff base intermediate.  Es
Probab=21.17  E-value=2.4e+02  Score=18.18  Aligned_cols=24  Identities=17%  Similarity=0.319  Sum_probs=15.6

Q ss_pred             hhhhheeEEEEEeCCe-eeEe-cCcc
Q psy10647         49 MTRKLIKFVILFDNTN-LVYF-PGQY   72 (92)
Q Consensus        49 m~rkl~kf~ilfdnt~-llyf-pgq~   72 (92)
                      .+.|-.++.+.|||.. |.|- |..|
T Consensus        88 ~~~~~~~l~l~~~~g~~l~f~D~R~f  113 (120)
T cd08966          88 PPEKHDHVIFELDDGRELRFNDPRRF  113 (120)
T ss_pred             CCCCcEEEEEEeCCCCEEEEEcCCCC
Confidence            3456788888888854 5554 5544


No 40 
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional
Probab=21.12  E-value=2.6e+02  Score=20.86  Aligned_cols=17  Identities=24%  Similarity=0.626  Sum_probs=12.5

Q ss_pred             EEEeeCCceeEecCcccc
Q psy10647          9 VILFDNTNLVYFPGQYLS   26 (92)
Q Consensus         9 ~IiFDn~~llYFPGQ~lS   26 (92)
                      +|.+++.++ .+||+.++
T Consensus         2 ~~~~~~~~~-V~PGd~l~   18 (235)
T PRK04163          2 KIFVEDRKI-VVPGDLLA   18 (235)
T ss_pred             eeeeeCCcE-ECCCCCcC
Confidence            466777654 79999983


No 41 
>cd01721 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Sm subunit D3 heterodimerizes with subunit B and three such heterodimers form a hexameric ring structure with alternating B and D3 subunits. The D3 - B heterodimer also assembles into a heptameric ring containing D1, D2, E, F, and G subunits. Sm-like proteins exist in archaea as well as prokaryotes which form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=21.00  E-value=57  Score=20.19  Aligned_cols=17  Identities=29%  Similarity=0.167  Sum_probs=14.0

Q ss_pred             eeEEEEecCCccccccc
Q psy10647         75 GRVLIELKDDTPALALL   91 (92)
Q Consensus        75 grvl~el~~~t~~lgl~   91 (92)
                      =+|.|||++++-+-|-|
T Consensus        11 ~~V~VeLk~g~~~~G~L   27 (70)
T cd01721          11 HIVTVELKTGEVYRGKL   27 (70)
T ss_pred             CEEEEEECCCcEEEEEE
Confidence            47899999998887765


No 42 
>cd06221 sulfite_reductase_like Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases. Clostridium pasteurianum inducible dissimilatory type sulfite reductase is linked to ferredoxin and reduces NH2OH and SeO3 at a lesser rate than it's normal substate SO3(2-). Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+.
Probab=20.65  E-value=78  Score=22.83  Aligned_cols=25  Identities=16%  Similarity=0.460  Sum_probs=18.1

Q ss_pred             cceEEEEEeeCC---ceeEecCccccee
Q psy10647          4 KLIKFVILFDNT---NLVYFPGQYLSGR   28 (92)
Q Consensus         4 kl~kf~IiFDn~---~llYFPGQ~lSGR   28 (92)
                      ....|.+.++.+   ..-|-|||++.=+
T Consensus        10 ~v~~~~l~~~~~~~~~~~~~pGQ~i~l~   37 (253)
T cd06221          10 DIKTFTLRLEDDDEELFTFKPGQFVMLS   37 (253)
T ss_pred             CceEEEEEeCCCccccCCcCCCCEEEEE
Confidence            345677788776   3779999997643


No 43 
>PF13759 2OG-FeII_Oxy_5:  Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A.
Probab=20.01  E-value=2.4e+02  Score=17.65  Aligned_cols=56  Identities=21%  Similarity=0.467  Sum_probs=31.3

Q ss_pred             ecCcccceeEEEEecCCcceeeeeecccc--hhhh----------heeEEEEEeCCeeeEecCcccce
Q psy10647         20 FPGQYLSGRVLIELKDDTPALGFHRSKNN--MTRK----------LIKFVILFDNTNLVYFPGQYLSG   75 (92)
Q Consensus        20 FPGQ~lSGRVLle~qe~t~~lglh~~~~~--m~rk----------l~kf~ilfdnt~llyfpgq~lsg   75 (92)
                      =||-.+||-.-+.+.++...+-++....+  |...          -..+.+--....|+.||+...-+
T Consensus        18 H~~s~~SgVyYv~~p~~~~~l~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~G~lvlFPs~l~H~   85 (101)
T PF13759_consen   18 HPNSWLSGVYYVQVPEGSGPLRFHDPRGSFSFGAPFDNYDQNDLNSPYYIVEPEEGDLVLFPSWLWHG   85 (101)
T ss_dssp             -TT-SEEEEEECE--TTS-SEEEE-TTCCCGTTS----TTTTCCC-SEEEE---TTEEEEEETTSEEE
T ss_pred             CCCcCEEEEEEEECCCCCCceeeeCCCccceecccccccccCcccCceEEeCCCCCEEEEeCCCCEEe
Confidence            37788999999999998877777765332  2211          12445555678899999876543


Done!