Diaphorina citri psyllid: psy10647


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90--
MTRKLIKFVILFDNTNLVYFPGQYLSGRVLIELKDDTPALGFHRSKNNMTRKLIKFVILFDNTNLVYFPGQYLSGRVLIELKDDTPALALLQ
cccccEEEEEEECccCEEECccccccCEEEEEEcccccEEEEECccccHHHHHEEEEEEECccCEEECccccccCEEEEEEccccccccccc
****LIKFVILFDNTNLVYFPGQYLSGRVLIELKDDTPALGFHRSKNNMTRKLIKFVILFDNTNLVYFPGQYLSGRVLIELKDDTPALALLQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTRKLIKFVILFDNTNLVYFPGQYLSGRVLIELKDDTPALGFHRSKNNMTRKLIKFVILFDNTNLVYFPGQYLSGRVLIELKDDTPALALLQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0010629 [BP]negative regulation of gene expressionprobableGO:0009892, GO:0019222, GO:0060255, GO:0050789, GO:0008150, GO:0065007, GO:0048519, GO:0010605, GO:0010468

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R51, chain A
Confidence level:probable
Coverage over the Query: 17-43
View the alignment between query and template
View the model in PyMOL