Query         psy10674
Match_columns 138
No_of_seqs    206 out of 1342
Neff          9.3 
Searched_HMMs 46136
Date          Fri Aug 16 15:46:44 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10674.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10674hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1701|consensus               99.9 1.2E-26 2.6E-31  172.7   3.9  131    2-134   291-457 (468)
  2 KOG1701|consensus               99.9 4.6E-27   1E-31  174.9  -2.3  111   15-133   276-386 (468)
  3 KOG2272|consensus               99.9 2.8E-26   6E-31  160.9  -2.9  128    2-133    88-246 (332)
  4 KOG4577|consensus               99.9 1.2E-24 2.5E-29  155.3  -3.7  114   12-133    32-147 (383)
  5 KOG2272|consensus               99.9 9.9E-24 2.1E-28  148.1   0.0  130    2-134   152-307 (332)
  6 KOG1044|consensus               99.9 1.9E-22 4.1E-27  155.0   4.7  127    2-132    80-243 (670)
  7 KOG1703|consensus               99.8 1.1E-21 2.5E-26  152.9   3.9  132    1-134   318-476 (479)
  8 KOG1044|consensus               99.7 1.1E-18 2.4E-23  134.5   4.9  131    2-134    31-185 (670)
  9 KOG1703|consensus               99.7 1.5E-18 3.2E-23  135.5   3.7  112   14-134   304-415 (479)
 10 PF00412 LIM:  LIM domain;  Int  99.6 7.2E-15 1.6E-19   83.4   5.4   58   16-78      1-58  (58)
 11 PF00412 LIM:  LIM domain;  Int  99.5 1.4E-14 3.1E-19   82.2   3.1   51   83-134     1-52  (58)
 12 KOG1700|consensus               99.3 2.3E-13   5E-18   95.2  -1.0  115   14-135     8-162 (200)
 13 smart00132 LIM Zinc-binding do  99.0 1.8E-10 3.9E-15   59.7   2.9   37   82-118     1-38  (39)
 14 KOG4577|consensus               99.0 5.7E-11 1.2E-15   85.6  -1.3   77    2-78     49-154 (383)
 15 smart00132 LIM Zinc-binding do  98.6 3.2E-08 6.9E-13   51.0   3.1   38   15-57      1-38  (39)
 16 KOG1700|consensus               97.8 3.5E-06 7.7E-11   59.1   0.0   54   81-135     8-61  (200)
 17 KOG0490|consensus               97.7 2.7E-06 5.9E-11   60.6  -2.8   92   39-133    16-113 (235)
 18 KOG1702|consensus               97.2 1.7E-05 3.6E-10   55.2  -3.5   57   15-77      6-62  (264)
 19 KOG1702|consensus               97.2   4E-05 8.6E-10   53.4  -1.9   53   81-134     5-57  (264)
 20 PF08394 Arc_trans_TRASH:  Arch  95.2  0.0074 1.6E-07   30.7   0.5   32   83-117     1-33  (37)
 21 PF14446 Prok-RING_1:  Prokaryo  94.2   0.036 7.8E-07   30.6   1.7   36   81-116     6-50  (54)
 22 PF10367 Vps39_2:  Vacuolar sor  90.8    0.19 4.1E-06   31.2   2.0   28   81-108    79-107 (109)
 23 PF10083 DUF2321:  Uncharacteri  90.4    0.17 3.7E-06   34.0   1.6   50   66-118    27-79  (158)
 24 COG4357 Zinc finger domain con  89.4   0.045 9.8E-07   33.7  -1.6   53   82-135    37-89  (105)
 25 PF13240 zinc_ribbon_2:  zinc-r  88.8    0.26 5.7E-06   22.2   1.1    9   83-91      2-10  (23)
 26 PF09943 DUF2175:  Uncharacteri  88.0    0.18 3.8E-06   31.5   0.3   30   82-111     4-34  (101)
 27 PRK14890 putative Zn-ribbon RN  87.7    0.67 1.4E-05   26.0   2.4   50   13-88      7-56  (59)
 28 KOG0490|consensus               86.7    0.13 2.9E-06   36.4  -1.0   47   86-134     2-50  (235)
 29 PF10235 Cript:  Microtubule-as  85.6    0.49 1.1E-05   29.0   1.3   44   41-93     39-82  (90)
 30 COG2888 Predicted Zn-ribbon RN  84.4     1.8 3.9E-05   24.3   3.1   20   10-29      6-25  (61)
 31 PF13248 zf-ribbon_3:  zinc-rib  84.4    0.59 1.3E-05   21.6   1.0    9   82-90      4-12  (26)
 32 PF07191 zinc-ribbons_6:  zinc-  84.3    0.32 6.9E-06   28.3   0.1   59   48-118     3-61  (70)
 33 smart00504 Ubox Modified RING   84.2       2 4.4E-05   23.7   3.4   49   47-96      2-51  (63)
 34 PF11781 RRN7:  RNA polymerase   83.9    0.44 9.6E-06   24.0   0.5   24  109-137    10-33  (36)
 35 PF14835 zf-RING_6:  zf-RING of  83.4     0.9   2E-05   26.0   1.7   49   47-96      8-56  (65)
 36 PF10886 DUF2685:  Protein of u  81.3     1.4   3E-05   24.2   1.8   26   81-106     2-27  (54)
 37 PF02069 Metallothio_Pro:  Prok  81.2    0.93   2E-05   24.8   1.1   24  110-134    10-33  (52)
 38 PF14569 zf-UDP:  Zinc-binding   80.2     2.1 4.6E-05   25.4   2.5   43   48-90     11-61  (80)
 39 PF10367 Vps39_2:  Vacuolar sor  79.0     1.3 2.8E-05   27.3   1.5   13   49-61     81-93  (109)
 40 PF13920 zf-C3HC4_3:  Zinc fing  78.6     3.8 8.3E-05   21.7   3.1   43   48-91      4-48  (50)
 41 PF00645 zf-PARP:  Poly(ADP-rib  78.4    0.67 1.4E-05   27.6  -0.0   35   14-48      8-47  (82)
 42 PF14471 DUF4428:  Domain of un  78.1     2.2 4.9E-05   23.1   2.0   29   48-77      1-30  (51)
 43 PF07754 DUF1610:  Domain of un  77.5     1.7 3.6E-05   19.8   1.2   11   16-26      1-11  (24)
 44 COG1645 Uncharacterized Zn-fin  74.9     1.6 3.5E-05   28.6   1.1   22   48-74     30-51  (131)
 45 PF06677 Auto_anti-p27:  Sjogre  74.6     1.6 3.5E-05   22.6   0.8   22   48-73     19-40  (41)
 46 PF01258 zf-dskA_traR:  Prokary  72.9    0.83 1.8E-05   22.8  -0.5   28   49-76      6-33  (36)
 47 COG4847 Uncharacterized protei  72.9     1.4   3E-05   27.2   0.3   32   81-112     7-39  (103)
 48 PLN03208 E3 ubiquitin-protein   72.9     6.6 0.00014   27.5   3.8   51   46-97     18-85  (193)
 49 KOG0320|consensus               71.3     2.7 5.9E-05   29.0   1.5   53   43-95    128-182 (187)
 50 PF12674 Zn_ribbon_2:  Putative  70.7     1.9 4.2E-05   25.8   0.6   29   48-76      2-35  (81)
 51 PF06906 DUF1272:  Protein of u  70.4     8.3 0.00018   21.4   3.0   45   48-93      7-54  (57)
 52 PRK00807 50S ribosomal protein  67.7     2.6 5.5E-05   23.0   0.7   33   81-116     2-37  (52)
 53 PF12773 DZR:  Double zinc ribb  67.3     4.8  0.0001   21.3   1.7   11   81-91     13-23  (50)
 54 PRK14559 putative protein seri  66.7     3.9 8.5E-05   34.0   1.8   10   15-24      3-12  (645)
 55 cd02336 ZZ_RSC8 Zinc finger, Z  65.4     7.6 0.00016   20.5   2.2   29   48-76      2-32  (45)
 56 COG4306 Uncharacterized protei  64.5     6.4 0.00014   25.7   2.1   49   67-118    28-79  (160)
 57 cd00162 RING RING-finger (Real  62.7     8.3 0.00018   19.0   2.1   25   65-89     18-44  (45)
 58 smart00291 ZnF_ZZ Zinc-binding  62.3     9.2  0.0002   19.8   2.2   29   48-76      6-36  (44)
 59 PRK00420 hypothetical protein;  60.0     4.1 8.9E-05   26.0   0.7   23   47-73     24-46  (112)
 60 KOG1813|consensus               59.6       6 0.00013   29.6   1.5   45   47-92    242-287 (313)
 61 PF04570 DUF581:  Protein of un  59.4     6.4 0.00014   22.0   1.3    9  110-118    19-27  (58)
 62 TIGR03826 YvyF flagellar opero  58.6     6.4 0.00014   26.1   1.4   22   48-75      5-26  (137)
 63 smart00704 ZnF_CDGSH CDGSH-typ  57.3     6.3 0.00014   20.0   1.0    7  128-134    24-30  (38)
 64 COG2191 Formylmethanofuran deh  57.3     3.7   8E-05   29.0   0.1   31   47-77    173-203 (206)
 65 KOG3002|consensus               56.4      11 0.00024   28.3   2.5   44   46-91     48-91  (299)
 66 PF13923 zf-C3HC4_2:  Zinc fing  56.2      23 0.00049   17.5   3.0   30   49-78      1-30  (39)
 67 PF11571 Med27:  Mediator compl  55.5     6.5 0.00014   23.9   1.0   16   74-90     49-64  (90)
 68 PF14634 zf-RING_5:  zinc-RING   55.4      16 0.00035   18.7   2.4   40   49-88      2-44  (44)
 69 smart00249 PHD PHD zinc finger  55.3      11 0.00024   18.8   1.8   26   83-108     2-29  (47)
 70 PF04564 U-box:  U-box domain;   54.3      30 0.00066   19.9   3.7   51   45-96      3-55  (73)
 71 PF00569 ZZ:  Zinc finger, ZZ t  53.5      19 0.00041   18.8   2.5   11   66-76     27-37  (46)
 72 PF06827 zf-FPG_IleRS:  Zinc fi  53.3     3.4 7.4E-05   19.5  -0.4   11   81-91      2-12  (30)
 73 PF12855 Ecl1:  Life-span regul  53.2       7 0.00015   20.5   0.7   20  110-134     9-28  (43)
 74 PF00628 PHD:  PHD-finger;  Int  52.6      14 0.00031   19.3   2.0   26   83-108     2-29  (51)
 75 COG5152 Uncharacterized conser  51.2     5.8 0.00012   28.0   0.3   46   47-93    197-243 (259)
 76 PLN02638 cellulose synthase A   50.5      13 0.00028   32.7   2.3   25   66-90     43-69  (1079)
 77 cd02335 ZZ_ADA2 Zinc finger, Z  47.6      22 0.00048   18.8   2.2    9   68-76     25-33  (49)
 78 PF14570 zf-RING_4:  RING/Ubox   47.1      26 0.00057   18.8   2.4   24   66-89     21-46  (48)
 79 PF04641 Rtf2:  Rtf2 RING-finge  46.1      52  0.0011   24.1   4.6   56   43-98    110-168 (260)
 80 KOG3476|consensus               46.0     2.9 6.4E-05   25.3  -1.5   38   47-93     55-92  (100)
 81 PLN02195 cellulose synthase A   44.9      19 0.00041   31.5   2.4   25   67-91     33-59  (977)
 82 KOG3579|consensus               44.8      12 0.00026   28.0   1.1   48   81-134   269-316 (352)
 83 PF00096 zf-C2H2:  Zinc finger,  44.4       7 0.00015   16.7  -0.1   12  108-119     1-12  (23)
 84 KOG0978|consensus               44.2     6.6 0.00014   32.9  -0.3   49   47-96    644-694 (698)
 85 PF07649 C1_3:  C1-like domain;  42.9      14 0.00031   17.3   0.9   11   82-92      2-12  (30)
 86 PF13834 DUF4193:  Domain of un  42.8     8.3 0.00018   24.0   0.1   29  106-134    69-97  (99)
 87 PLN02400 cellulose synthase     42.2      17 0.00038   32.0   1.8   44   47-90     37-88  (1085)
 88 PF08209 Sgf11:  Sgf11 (transcr  41.7     5.4 0.00012   19.6  -0.7   17  108-124     5-21  (33)
 89 PF01286 XPA_N:  XPA protein N-  41.4     7.1 0.00015   19.4  -0.3   11   14-24      4-14  (34)
 90 cd02249 ZZ Zinc finger, ZZ typ  40.6      17 0.00036   19.0   1.0   10   82-91      2-11  (46)
 91 KOG2893|consensus               40.5     7.3 0.00016   28.3  -0.5   11  107-117    34-44  (341)
 92 KOG3579|consensus               40.3      14  0.0003   27.6   0.9   48   13-71    268-315 (352)
 93 KOG3896|consensus               39.1      13 0.00028   28.5   0.5   37   80-118    45-81  (449)
 94 PHA02610 uvsY.-2 hypothetical   38.9      27 0.00058   19.0   1.6   25   81-105     2-26  (53)
 95 PF12156 ATPase-cat_bd:  Putati  38.7      12 0.00027   22.6   0.4   33   82-117     2-36  (88)
 96 PF10571 UPF0547:  Uncharacteri  38.6      21 0.00046   16.4   1.1    9   82-90      2-10  (26)
 97 cd02342 ZZ_UBA_plant Zinc fing  37.9      35 0.00076   17.8   1.9   29   48-76      2-33  (43)
 98 PLN02436 cellulose synthase A   37.6      26 0.00055   31.1   2.1   44   47-90     37-88  (1094)
 99 PF05502 Dynactin_p62:  Dynacti  37.5      20 0.00043   28.9   1.4   36   82-118    28-63  (483)
100 KOG2462|consensus               37.5      12 0.00026   27.7   0.2   33   81-119   188-227 (279)
101 PF10080 DUF2318:  Predicted me  37.0      23  0.0005   22.2   1.4   32   41-76     30-61  (102)
102 PLN02189 cellulose synthase     36.8      27 0.00059   30.8   2.2   45   47-91     35-87  (1040)
103 PHA02929 N1R/p28-like protein;  36.5      21 0.00045   26.0   1.3   38   81-118   175-227 (238)
104 PF00130 C1_1:  Phorbol esters/  36.4      34 0.00074   18.0   1.9   10   81-90     12-21  (53)
105 PF13894 zf-C2H2_4:  C2H2-type   36.0      14 0.00031   15.4   0.3   11  108-118     1-11  (24)
106 PF13639 zf-RING_2:  Ring finge  35.7     7.7 0.00017   19.8  -0.8   27   82-108     2-30  (44)
107 PF12171 zf-C2H2_jaz:  Zinc-fin  35.1      24 0.00053   15.9   1.0   13  108-120     2-14  (27)
108 PLN02915 cellulose synthase A   34.7      31 0.00066   30.5   2.2   24   67-90     42-67  (1044)
109 COG0266 Nei Formamidopyrimidin  34.5      23 0.00049   26.4   1.2   11   81-91    246-256 (273)
110 cd02341 ZZ_ZZZ3 Zinc finger, Z  34.5      23 0.00049   18.9   0.9   10   82-91      2-12  (48)
111 KOG4443|consensus               34.3      23  0.0005   29.5   1.3   22   98-119   106-127 (694)
112 PF12874 zf-met:  Zinc-finger o  33.3      14 0.00031   16.1   0.0   12  108-119     1-12  (25)
113 PF14149 YhfH:  YhfH-like prote  32.7      14  0.0003   18.7  -0.1   19   74-92      7-25  (37)
114 PLN03123 poly [ADP-ribose] pol  32.1      34 0.00074   30.1   2.1   30   80-109    17-57  (981)
115 TIGR00595 priA primosomal prot  31.4      29 0.00064   28.0   1.5   39   48-89    224-262 (505)
116 COG1996 RPC10 DNA-directed RNA  31.0      22 0.00047   19.2   0.5   10   81-90      7-16  (49)
117 PF01927 Mut7-C:  Mut7-C RNAse   31.0      26 0.00056   23.2   1.0   14   43-56    121-134 (147)
118 PRK11595 DNA utilization prote  31.0      50  0.0011   23.5   2.5   37   48-90      7-44  (227)
119 PF09723 Zn-ribbon_8:  Zinc rib  30.9     9.7 0.00021   19.6  -0.9   10   47-56      6-15  (42)
120 PHA02768 hypothetical protein;  30.5      10 0.00022   21.0  -0.8   12  107-118    31-42  (55)
121 PF14255 Cys_rich_CPXG:  Cystei  30.4      16 0.00036   19.9  -0.0   28   82-110     2-30  (52)
122 KOG2186|consensus               30.1      11 0.00024   27.6  -1.0   42   14-62      4-45  (276)
123 PRK01343 zinc-binding protein;  29.9      36 0.00079   19.0   1.3   10   81-90     10-19  (57)
124 PRK14873 primosome assembly pr  29.8      28 0.00061   29.2   1.2   39   47-89    393-431 (665)
125 PRK14891 50S ribosomal protein  29.7      38 0.00082   22.2   1.5   33   81-116     5-40  (131)
126 PF03107 C1_2:  C1 domain;  Int  29.6      41 0.00089   15.7   1.3   11  109-119     2-12  (30)
127 COG2075 RPL24A Ribosomal prote  29.3      45 0.00098   19.1   1.6    9   48-56      5-13  (66)
128 PF04810 zf-Sec23_Sec24:  Sec23  29.2      48   0.001   16.7   1.6   30   81-115     3-32  (40)
129 cd00472 Ribosomal_L24e_L24 Rib  29.0      39 0.00084   18.6   1.3   24   81-104     4-30  (54)
130 COG0068 HypF Hydrogenase matur  29.0      22 0.00048   30.0   0.5   85   10-117    98-183 (750)
131 smart00834 CxxC_CXXC_SSSS Puta  29.0      11 0.00025   18.7  -0.8   10   47-56      6-15  (41)
132 PF07503 zf-HYPF:  HypF finger;  28.9      27 0.00058   17.3   0.6   18   39-56     14-31  (35)
133 smart00531 TFIIE Transcription  28.8      13 0.00028   24.7  -0.8   35   81-118   100-134 (147)
134 PF13912 zf-C2H2_6:  C2H2-type   28.7      19 0.00041   16.0   0.0   12  108-119     2-13  (27)
135 cd02344 ZZ_HERC2 Zinc finger,   28.4      54  0.0012   17.2   1.7   10   67-76     24-33  (45)
136 PF06750 DiS_P_DiS:  Bacterial   27.8      17 0.00038   22.2  -0.3   37   47-92     34-70  (92)
137 COG3813 Uncharacterized protei  27.8      92   0.002   18.3   2.7   45   48-93      7-54  (84)
138 PF10764 Gin:  Inhibitor of sig  27.7      82  0.0018   16.6   2.4    7   50-56      3-9   (46)
139 PF08790 zf-LYAR:  LYAR-type C2  26.9      11 0.00024   17.8  -1.0   16  108-123     1-16  (28)
140 cd02340 ZZ_NBR1_like Zinc fing  26.9      39 0.00085   17.4   1.0   20   82-114     2-21  (43)
141 TIGR00570 cdk7 CDK-activating   26.8      80  0.0017   24.0   3.0   29   66-94     27-57  (309)
142 PF09360 zf-CDGSH:  Iron-bindin  26.6      31 0.00068   17.4   0.6    7  128-134    29-35  (38)
143 cd02338 ZZ_PCMF_like Zinc fing  26.5      54  0.0012   17.4   1.6    9   68-76     25-33  (49)
144 PF02591 DUF164:  Putative zinc  26.4     8.4 0.00018   21.1  -1.7   11   82-92     24-34  (56)
145 KOG2114|consensus               25.8      29 0.00064   29.9   0.6   36   81-117   841-882 (933)
146 PRK06266 transcription initiat  25.7      16 0.00035   25.2  -0.7   32   12-57    116-147 (178)
147 PF13901 DUF4206:  Domain of un  25.6      49  0.0011   23.3   1.6   29   81-109   153-188 (202)
148 COG4068 Uncharacterized protei  24.8      32 0.00069   19.3   0.5   16   81-96      9-24  (64)
149 PRK00398 rpoP DNA-directed RNA  24.5      29 0.00063   18.0   0.3   29   81-118     4-32  (46)
150 COG1997 RPL43A Ribosomal prote  24.5      77  0.0017   19.3   2.1   37   80-125    35-71  (89)
151 cd02334 ZZ_dystrophin Zinc fin  24.0      74  0.0016   17.0   1.8   10   67-76     24-33  (49)
152 KOG1244|consensus               23.9      66  0.0014   24.1   2.0   10   65-74    294-303 (336)
153 COG1198 PriA Primosomal protei  23.9      45 0.00097   28.4   1.3   40   47-89    445-484 (730)
154 PF09889 DUF2116:  Uncharacteri  23.6      41 0.00089   18.9   0.8   13   81-93      4-16  (59)
155 smart00659 RPOLCX RNA polymera  23.6      30 0.00064   18.1   0.2   10   47-56      3-12  (44)
156 PRK12495 hypothetical protein;  23.1      33 0.00072   24.6   0.4   11   47-57     43-53  (226)
157 KOG1734|consensus               23.1      21 0.00046   26.5  -0.6   14   43-56    221-234 (328)
158 PRK14714 DNA polymerase II lar  23.0      68  0.0015   29.2   2.3   54   47-119   668-721 (1337)
159 smart00355 ZnF_C2H2 zinc finge  23.0      43 0.00094   13.9   0.7   12  108-119     1-12  (26)
160 PF01246 Ribosomal_L24e:  Ribos  22.9      39 0.00084   19.7   0.6   24   81-104     4-30  (71)
161 COG3369 Zinc finger domain con  22.9      41 0.00088   19.9   0.7    7  128-134    41-47  (78)
162 TIGR00270 conserved hypothetic  22.7   1E+02  0.0022   20.8   2.7   26   49-74      3-31  (154)
163 PF07975 C1_4:  TFIIH C1-like d  22.6      34 0.00074   18.6   0.3    8   83-90      2-9   (51)
164 PF13465 zf-H2C2_2:  Zinc-finge  22.1      29 0.00063   15.6  -0.0   10  108-117    15-24  (26)
165 KOG4739|consensus               22.0      60  0.0013   23.6   1.5   34   58-92     15-49  (233)
166 PF09862 DUF2089:  Protein of u  21.8      38 0.00082   21.7   0.4    9  110-118    15-23  (113)
167 cd02345 ZZ_dah Zinc finger, ZZ  21.7      73  0.0016   16.9   1.5    9   68-76     25-33  (49)
168 PF00320 GATA:  GATA zinc finge  21.6 1.2E+02  0.0026   14.8   2.6   13   64-76     16-29  (36)
169 PF08189 Meleagrin:  Meleagrin/  21.5      39 0.00084   17.0   0.4    7  131-137    11-17  (39)
170 PRK05580 primosome assembly pr  21.3      60  0.0013   27.3   1.6   39   48-89    392-430 (679)
171 PF13926 DUF4211:  Domain of un  21.1      72  0.0016   21.2   1.7   23  109-131   118-140 (153)
172 TIGR02605 CxxC_CxxC_SSSS putat  20.8      54  0.0012   17.2   0.9   10   81-90      6-15  (52)
173 PF05864 Chordopox_RPO7:  Chord  20.8      20 0.00043   20.0  -0.9   16  109-124     6-21  (63)
174 PF08792 A2L_zn_ribbon:  A2L zi  20.8      75  0.0016   15.4   1.3   10   63-72     17-26  (33)
175 PF04981 NMD3:  NMD3 family ;    20.7   1E+02  0.0022   22.2   2.5   24   49-78      1-24  (236)
176 PHA03082 DNA-dependent RNA pol  20.3      20 0.00043   20.0  -0.9   15  109-123     6-20  (63)
177 KOG3039|consensus               20.2 1.8E+02   0.004   21.5   3.7   84   14-97    184-276 (303)

No 1  
>KOG1701|consensus
Probab=99.93  E-value=1.2e-26  Score=172.71  Aligned_cols=131  Identities=25%  Similarity=0.573  Sum_probs=113.5

Q ss_pred             eeecCCCcCcCCcccccccccccCCCeEEEecc-------------------------ccCCCCCCcccCcccccCCccc
Q psy10674          2 TLAENKTFHVKHFCCYECDKKVQFENYTGKITQ-------------------------SQESEVLWHPQCFVCSTCDELL   56 (138)
Q Consensus         2 ~~a~g~~~h~~~~~C~~C~~~i~~~~~~~~~~~-------------------------~~~~~~~~H~~Cf~C~~C~~~l   56 (138)
                      ++||++.||.+||+|..|++.|....|+...++                         +-++|+.||+.||+|.+|.+.|
T Consensus       291 c~Am~~~fHv~CFtC~~C~r~L~Gq~FY~v~~k~~CE~cyq~tlekC~~Cg~~I~d~iLrA~GkayHp~CF~Cv~C~r~l  370 (468)
T KOG1701|consen  291 VEAMDQLFHVQCFTCRTCRRQLAGQSFYQVDGKPYCEGCYQDTLEKCNKCGEPIMDRILRALGKAYHPGCFTCVVCARCL  370 (468)
T ss_pred             HHHhhhhhcccceehHhhhhhhccccccccCCcccchHHHHHHHHHHhhhhhHHHHHHHHhcccccCCCceEEEEecccc
Confidence            479999999999999999999997777665443                         1278899999999999999999


Q ss_pred             cCCceee-eCCeeecHHHHHhhcCCCcccccCcccccCc------EEEeCCCccccCCccccccccccC----CCCeeec
Q psy10674         57 VDLMYFH-YKGNVYCLRDYATMLDIPRCHACDELIFVNE------YTLAENKTFHVKHFCCYECDKELC----NQSYIPV  125 (138)
Q Consensus        57 ~~~~~~~-~~~~~yC~~c~~~~~~~~~C~~C~~~I~~~~------~~~~~~~~~H~~CF~C~~C~~~l~----~~~f~~~  125 (138)
                      .+..|.+ .++++||-.||.+.| +++|+.|+++|++.+      .|+++++.||.+|++|..|+..|+    ++..|..
T Consensus       371 dgipFtvd~~n~v~Cv~dfh~kf-APrCs~C~~PI~P~~G~~etvRvvamdr~fHv~CY~CEDCg~~LS~e~e~qgCyPl  449 (468)
T KOG1701|consen  371 DGIPFTVDSQNNVYCVPDFHKKF-APRCSVCGNPILPRDGKDETVRVVAMDRDFHVNCYKCEDCGLLLSSEEEGQGCYPL  449 (468)
T ss_pred             CCccccccCCCceeeehhhhhhc-CcchhhccCCccCCCCCcceEEEEEccccccccceehhhcCccccccCCCCcceec
Confidence            9988866 789999999999999 799999999999642      344999999999999999999998    5667878


Q ss_pred             CCCCCccCC
Q psy10674        126 TESRPGQDS  134 (138)
Q Consensus       126 ~~~~~y~~~  134 (138)
                      | |.+.|..
T Consensus       450 d-~HllCk~  457 (468)
T KOG1701|consen  450 D-GHLLCKT  457 (468)
T ss_pred             c-Cceeech
Confidence            8 8887765


No 2  
>KOG1701|consensus
Probab=99.92  E-value=4.6e-27  Score=174.91  Aligned_cols=111  Identities=26%  Similarity=0.518  Sum_probs=101.4

Q ss_pred             ccccccccccCCCeEEEeccccCCCCCCcccCcccccCCccccCCceeeeCCeeecHHHHHhhcCCCcccccCcccccCc
Q psy10674         15 CCYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNE   94 (138)
Q Consensus        15 ~C~~C~~~i~~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~~~~C~~C~~~I~~~~   94 (138)
                      +|.+|++.|..+..-+     .|+++.||..||+|..|++.|.++.||..++++||+.||.+.+  ++|..|+++|++. 
T Consensus       276 iC~~C~K~V~g~~~ac-----~Am~~~fHv~CFtC~~C~r~L~Gq~FY~v~~k~~CE~cyq~tl--ekC~~Cg~~I~d~-  347 (468)
T KOG1701|consen  276 ICAFCHKTVSGQGLAV-----EAMDQLFHVQCFTCRTCRRQLAGQSFYQVDGKPYCEGCYQDTL--EKCNKCGEPIMDR-  347 (468)
T ss_pred             hhhhcCCcccCcchHH-----HHhhhhhcccceehHhhhhhhccccccccCCcccchHHHHHHH--HHHhhhhhHHHHH-
Confidence            7999999999655443     2378899999999999999999999999999999999999986  7999999999764 


Q ss_pred             EEEeCCCccccCCccccccccccCCCCeeecCCCCCccC
Q psy10674         95 YTLAENKTFHVKHFCCYECDKELCNQSYIPVTESRPGQD  133 (138)
Q Consensus        95 ~~~~~~~~~H~~CF~C~~C~~~l~~~~f~~~~~~~~y~~  133 (138)
                      |+.|.|+.||+.||+|..|++.|+|..|++..++++||.
T Consensus       348 iLrA~GkayHp~CF~Cv~C~r~ldgipFtvd~~n~v~Cv  386 (468)
T KOG1701|consen  348 ILRALGKAYHPGCFTCVVCARCLDGIPFTVDSQNNVYCV  386 (468)
T ss_pred             HHHhcccccCCCceEEEEeccccCCccccccCCCceeee
Confidence            667999999999999999999999999999999999995


No 3  
>KOG2272|consensus
Probab=99.90  E-value=2.8e-26  Score=160.94  Aligned_cols=128  Identities=28%  Similarity=0.475  Sum_probs=107.9

Q ss_pred             eeecCCCcCcCCcccccccccccCCCeEEEecc-------------------------------ccCCCCCCcccCcccc
Q psy10674          2 TLAENKTFHVKHFCCYECDKKVQFENYTGKITQ-------------------------------SQESEVLWHPQCFVCS   50 (138)
Q Consensus         2 ~~a~g~~~h~~~~~C~~C~~~i~~~~~~~~~~~-------------------------------~~~~~~~~H~~Cf~C~   50 (138)
                      |.||+.+|||.||.|..|++.|.+..++-..++                               ...++.+||+.+|+|.
T Consensus        88 ikamnnSwHp~CF~Cd~Cn~~Lad~gf~rnqgr~LC~~Cn~k~Ka~~~g~YvC~KCh~~iD~~~l~fr~d~yH~yHFkCt  167 (332)
T KOG2272|consen   88 IKAMNNSWHPACFRCDLCNKHLADQGFYRNQGRALCRECNQKEKAKGRGRYVCQKCHAHIDEQPLTFRGDPYHPYHFKCT  167 (332)
T ss_pred             HHhhccccCcccchhHHHHHHHhhhhhHhhcchHHhhhhhhhhcccccceeehhhhhhhcccccccccCCCCCccceecc
Confidence            579999999999999999999986444322111                               2356779999999999


Q ss_pred             cCCccccCCceeeeCCeeecHHHHHhhcCCCcccccCcccccCcEEEeCCCccccCCccccccccccCCCCeeecCCCCC
Q psy10674         51 TCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELCNQSYIPVTESRP  130 (138)
Q Consensus        51 ~C~~~l~~~~~~~~~~~~yC~~c~~~~~~~~~C~~C~~~I~~~~~~~~~~~~~H~~CF~C~~C~~~l~~~~f~~~~~~~~  130 (138)
                      .|++.|.. ...+..+.+||.+|+.++- .|.|..|.+||.+ .+|.++|+.||.++|+|+.|.+|+-|-+.|+++ |.+
T Consensus       168 ~C~keL~s-daRevk~eLyClrChD~mg-ipiCgaC~rpIee-rvi~amgKhWHveHFvCa~CekPFlGHrHYEkk-Gla  243 (332)
T KOG2272|consen  168 TCGKELTS-DAREVKGELYCLRCHDKMG-IPICGACRRPIEE-RVIFAMGKHWHVEHFVCAKCEKPFLGHRHYEKK-GLA  243 (332)
T ss_pred             cccccccc-hhhhhccceeccccccccC-CcccccccCchHH-HHHHHhccccchhheeehhcCCcccchhhhhhc-Cch
Confidence            99999954 3556788999999998764 8999999999964 455599999999999999999999999999999 999


Q ss_pred             ccC
Q psy10674        131 GQD  133 (138)
Q Consensus       131 y~~  133 (138)
                      ||.
T Consensus       244 YCe  246 (332)
T KOG2272|consen  244 YCE  246 (332)
T ss_pred             hHH
Confidence            985


No 4  
>KOG4577|consensus
Probab=99.87  E-value=1.2e-24  Score=155.27  Aligned_cols=114  Identities=26%  Similarity=0.661  Sum_probs=102.1

Q ss_pred             CCcccccccccccCCCeEEEeccccCCCCCCcccCcccccCCccccCCceeeeCCeeecHHHHHhhcCCCcccccCcccc
Q psy10674         12 KHFCCYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIF   91 (138)
Q Consensus        12 ~~~~C~~C~~~i~~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~~~~C~~C~~~I~   91 (138)
                      +-++|+.|.+.|. ++++..+     +++.||..|++|+.|..+|.+ ..|.+++.+||+.+|.++|| .+|..|...|.
T Consensus        32 eip~CagC~q~Il-DrFilKv-----l~R~wHs~CLkCs~C~~qL~d-rCFsR~~s~yCkedFfKrfG-TKCsaC~~GIp  103 (383)
T KOG4577|consen   32 EIPICAGCDQHIL-DRFILKV-----LDRHWHSSCLKCSDCHDQLAD-RCFSREGSVYCKEDFFKRFG-TKCSACQEGIP  103 (383)
T ss_pred             ccccccchHHHHH-HHHHHHH-----HhhhhhhhhcchhhhhhHHHH-HHhhcCCceeehHHHHHHhC-CcchhhcCCCC
Confidence            5688999999998 6676654     466999999999999999966 58999999999999999998 69999999999


Q ss_pred             cCcEEE-eCCCccccCCccccccccccC-CCCeeecCCCCCccC
Q psy10674         92 VNEYTL-AENKTFHVKHFCCYECDKELC-NQSYIPVTESRPGQD  133 (138)
Q Consensus        92 ~~~~~~-~~~~~~H~~CF~C~~C~~~l~-~~~f~~~~~~~~y~~  133 (138)
                      +..+|. |.+.+||.+||.|..|++.|. |+.||+.+|++.-|.
T Consensus       104 PtqVVRkAqd~VYHl~CF~C~iC~R~L~TGdEFYLmeD~rLvCK  147 (383)
T KOG4577|consen  104 PTQVVRKAQDFVYHLHCFACFICKRQLATGDEFYLMEDARLVCK  147 (383)
T ss_pred             hHHHHHHhhcceeehhhhhhHhhhcccccCCeeEEeccceeehh
Confidence            877766 999999999999999999998 999999998888764


No 5  
>KOG2272|consensus
Probab=99.87  E-value=9.9e-24  Score=148.15  Aligned_cols=130  Identities=25%  Similarity=0.525  Sum_probs=109.9

Q ss_pred             eeecCCCcCcCCcccccccccccCCCeEEEe------------------------cc-ccCCCCCCcccCcccccCCccc
Q psy10674          2 TLAENKTFHVKHFCCYECDKKVQFENYTGKI------------------------TQ-SQESEVLWHPQCFVCSTCDELL   56 (138)
Q Consensus         2 ~~a~g~~~h~~~~~C~~C~~~i~~~~~~~~~------------------------~~-~~~~~~~~H~~Cf~C~~C~~~l   56 (138)
                      |...|..|||-+|+|..|++.|..+...+..                        ++ +.++|..||.++|+|+.|.+|+
T Consensus       152 l~fr~d~yH~yHFkCt~C~keL~sdaRevk~eLyClrChD~mgipiCgaC~rpIeervi~amgKhWHveHFvCa~CekPF  231 (332)
T KOG2272|consen  152 LTFRGDPYHPYHFKCTTCGKELTSDAREVKGELYCLRCHDKMGIPICGACRRPIEERVIFAMGKHWHVEHFVCAKCEKPF  231 (332)
T ss_pred             ccccCCCCCccceecccccccccchhhhhccceeccccccccCCcccccccCchHHHHHHHhccccchhheeehhcCCcc
Confidence            3456889999999999999998753222111                        11 3478899999999999999999


Q ss_pred             cCCceeeeCCeeecHHHHHhhcCCCcccccCcccccCcEEEeCCCccccCCccccccccccC-CCCeeecCCCCCccCC
Q psy10674         57 VDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELC-NQSYIPVTESRPGQDS  134 (138)
Q Consensus        57 ~~~~~~~~~~~~yC~~c~~~~~~~~~C~~C~~~I~~~~~~~~~~~~~H~~CF~C~~C~~~l~-~~~f~~~~~~~~y~~~  134 (138)
                      -+-..|++.|.+||+++|.+++| ..|..|+.+| +++++.|.++.|-++||.|+.|++.|. ...|++.| -+|-|..
T Consensus       232 lGHrHYEkkGlaYCe~h~~qLfG-~~CF~C~~~i-~G~vv~al~KawCv~cf~Cs~Cdkkl~~K~Kf~E~D-mkP~CKk  307 (332)
T KOG2272|consen  232 LGHRHYEKKGLAYCETHYHQLFG-NLCFICNRVI-GGDVVSALNKAWCVECFSCSTCDKKLTQKNKFYEFD-MKPVCKK  307 (332)
T ss_pred             cchhhhhhcCchhHHHHHHHHhh-hhheecCCcc-CccHHHHhhhhhccccccccccccccccccceeeec-cchHHHH
Confidence            88889999999999999999998 7999999999 566777999999999999999999998 67788888 8887753


No 6  
>KOG1044|consensus
Probab=99.86  E-value=1.9e-22  Score=155.02  Aligned_cols=127  Identities=24%  Similarity=0.484  Sum_probs=109.8

Q ss_pred             eeecCCCcCcCCcccccccccccCCCeEEEecc------------------------------------ccCCCCCCccc
Q psy10674          2 TLAENKTFHVKHFCCYECDKKVQFENYTGKITQ------------------------------------SQESEVLWHPQ   45 (138)
Q Consensus         2 ~~a~g~~~h~~~~~C~~C~~~i~~~~~~~~~~~------------------------------------~~~~~~~~H~~   45 (138)
                      +.|+|++||+.||+|..|..+...+..+...++                                    +++++..||..
T Consensus        80 vsa~gktyh~~cf~cs~ck~pf~~g~~vt~~gk~~~c~~c~~~~~~~p~~~~~ps~cagc~~~lk~gq~llald~qwhv~  159 (670)
T KOG1044|consen   80 VSTLGKTYHPKCFSCSTCKSPFKSGDKVTFSGKECLCQTCSQPMPVSPAESYGPSTCAGCGEELKNGQALLALDKQWHVS  159 (670)
T ss_pred             EecccceeccccceecccCCCCCCCCeeeecchhhhhhhhcCcccCCcccccCCccccchhhhhhccceeeeeccceeee
Confidence            579999999999999999999987766543211                                    34788899999


Q ss_pred             CcccccCCccccCCceeeeCCeeecHHHHHhhcCCCcccccCcccccCcEEEeCCCccccCCccccccccccC-CCCeee
Q psy10674         46 CFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELC-NQSYIP  124 (138)
Q Consensus        46 Cf~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~~~~C~~C~~~I~~~~~~~~~~~~~H~~CF~C~~C~~~l~-~~~f~~  124 (138)
                      ||+|..|+..|.+ .|...+|.+||+.+|.+.|| -+|..|.+.|.+. ++.|.|++|||.|-+|++|+.+++ |+..|+
T Consensus       160 cfkc~~c~~vL~g-ey~skdg~pyce~dy~~~fg-vkc~~c~~fisgk-vLqag~kh~HPtCARCsRCgqmF~eGEEMYl  236 (670)
T KOG1044|consen  160 CFKCKSCSAVLNG-EYMSKDGVPYCEKDYQAKFG-VKCEECEKFISGK-VLQAGDKHFHPTCARCSRCGQMFGEGEEMYL  236 (670)
T ss_pred             eeehhhhcccccc-eeeccCCCcchhhhhhhhcC-eehHHhhhhhhhh-hhhccCcccCcchhhhhhhccccccchheee
Confidence            9999999999966 59999999999999999998 5999999999665 566999999999999999999998 888888


Q ss_pred             cCCCCCcc
Q psy10674        125 VTESRPGQ  132 (138)
Q Consensus       125 ~~~~~~y~  132 (138)
                      +. ..++.
T Consensus       237 QG-s~iWH  243 (670)
T KOG1044|consen  237 QG-SEIWH  243 (670)
T ss_pred             cc-ccccC
Confidence            86 55554


No 7  
>KOG1703|consensus
Probab=99.84  E-value=1.1e-21  Score=152.94  Aligned_cols=132  Identities=25%  Similarity=0.559  Sum_probs=114.7

Q ss_pred             CeeecCCCcCcCCcccccccccccCCCeEEEecc--------------------------ccCCCCCCcccCcccccCCc
Q psy10674          1 YTLAENKTFHVKHFCCYECDKKVQFENYTGKITQ--------------------------SQESEVLWHPQCFVCSTCDE   54 (138)
Q Consensus         1 ~~~a~g~~~h~~~~~C~~C~~~i~~~~~~~~~~~--------------------------~~~~~~~~H~~Cf~C~~C~~   54 (138)
                      .+.|+++.||+.++.|..|...|..+.+....++                          +.+++..||++||.|..|++
T Consensus       318 ~i~~~~~~~h~~~~~c~~~~~~~~~~~~~~~~g~~~c~~~~~~~~~p~C~~C~~~i~~~~v~a~~~~wH~~cf~C~~C~~  397 (479)
T KOG1703|consen  318 VIVALGKEWHPEHFSCEVCAIVILDGGPRELDGKILCHECFHAPFRPNCKRCLLPILEEGVCALGRLWHPECFVCADCGK  397 (479)
T ss_pred             eEeeccccccccceeeccccccccCCCccccCCCccHHHHHHHhhCccccccCCchHHhHhhhccCeechhceeeecccC
Confidence            3689999999999999999999886655332111                          23568899999999999999


Q ss_pred             cccCCceeeeCCeeecHHHHHhhcCCCcccccCcccccC-cEEEeCCCccccCCccccccccccCCCCeeecCCCCCccC
Q psy10674         55 LLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVN-EYTLAENKTFHVKHFCCYECDKELCNQSYIPVTESRPGQD  133 (138)
Q Consensus        55 ~l~~~~~~~~~~~~yC~~c~~~~~~~~~C~~C~~~I~~~-~~~~~~~~~~H~~CF~C~~C~~~l~~~~f~~~~~~~~y~~  133 (138)
                      +|....|+..++.+||+.||.++++ .+|..|.++|... ..+.+++..||..||+|..|.+.|.++.|+... ++|+|-
T Consensus       398 ~~~~~~~~~~~~~pyce~~~~~~~~-~~~~~~~~p~~~~~~~ie~~~~~~h~~~F~c~~c~~~l~~~~~~~~~-~~p~c~  475 (479)
T KOG1703|consen  398 PLKNSSFFESDGEPYCEDHYKKLFT-TKCDYCKKPVEFGSRQIEADGSPFHGDCFRCANCMKKLTKKTFFETL-DKPLCQ  475 (479)
T ss_pred             CCCCCcccccCCccchhhhHhhhcc-ccchhccchhHhhhhHhhccCccccccceehhhhhccccCCceeecC-Cccccc
Confidence            9999999999999999999999995 6999999998633 356699999999999999999999999999999 999997


Q ss_pred             C
Q psy10674        134 S  134 (138)
Q Consensus       134 ~  134 (138)
                      +
T Consensus       476 ~  476 (479)
T KOG1703|consen  476 K  476 (479)
T ss_pred             c
Confidence            6


No 8  
>KOG1044|consensus
Probab=99.75  E-value=1.1e-18  Score=134.52  Aligned_cols=131  Identities=23%  Similarity=0.445  Sum_probs=105.5

Q ss_pred             eeecCCCcCcCCcccccccccccCCCeEEEec----------------cccCCCCCCcccCcccccCCccccCC-ceeee
Q psy10674          2 TLAENKTFHVKHFCCYECDKKVQFENYTGKIT----------------QSQESEVLWHPQCFVCSTCDELLVDL-MYFHY   64 (138)
Q Consensus         2 ~~a~g~~~h~~~~~C~~C~~~i~~~~~~~~~~----------------~~~~~~~~~H~~Cf~C~~C~~~l~~~-~~~~~   64 (138)
                      +.+.++.+|..||+|..|+..|..+.+....+                -+.++++.||+.||.|..|+.++... ..-..
T Consensus        31 lrv~d~~fhi~cf~c~~cg~~la~~gff~k~~~~~ygt~~c~~~~~gevvsa~gktyh~~cf~cs~ck~pf~~g~~vt~~  110 (670)
T KOG1044|consen   31 LRVNDNHFHINCFQCKKCGRNLAEGGFFTKPENRLYGTDDCRAFVEGEVVSTLGKTYHPKCFSCSTCKSPFKSGDKVTFS  110 (670)
T ss_pred             eEeeccccceeeeeccccCCCcccccceecccceeecccchhhhccceeEecccceeccccceecccCCCCCCCCeeeec
Confidence            46778999999999999999998776654321                13468899999999999999999443 33445


Q ss_pred             CCeeecHHHHHhh-------cCCCcccccCcccccCcEEEeCCCccccCCccccccccccCCCCeeecCCCCCccCC
Q psy10674         65 KGNVYCLRDYATM-------LDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELCNQSYIPVTESRPGQDS  134 (138)
Q Consensus        65 ~~~~yC~~c~~~~-------~~~~~C~~C~~~I~~~~~~~~~~~~~H~~CF~C~~C~~~l~~~~f~~~~~~~~y~~~  134 (138)
                      .....|+.|-.-.       .+...|++|++.|..+..+.|+++.||..||+|..|..+|.++ |+.++ |.|||-+
T Consensus       111 gk~~~c~~c~~~~~~~p~~~~~ps~cagc~~~lk~gq~llald~qwhv~cfkc~~c~~vL~ge-y~skd-g~pyce~  185 (670)
T KOG1044|consen  111 GKECLCQTCSQPMPVSPAESYGPSTCAGCGEELKNGQALLALDKQWHVSCFKCKSCSAVLNGE-YMSKD-GVPYCEK  185 (670)
T ss_pred             chhhhhhhhcCcccCCcccccCCccccchhhhhhccceeeeeccceeeeeeehhhhcccccce-eeccC-CCcchhh
Confidence            5567788776322       2235899999999988888899999999999999999999875 88888 9999965


No 9  
>KOG1703|consensus
Probab=99.73  E-value=1.5e-18  Score=135.53  Aligned_cols=112  Identities=23%  Similarity=0.492  Sum_probs=99.4

Q ss_pred             cccccccccccCCCeEEEeccccCCCCCCcccCcccccCCccccCCceeeeCCeeecHHHHHhhcCCCcccccCcccccC
Q psy10674         14 FCCYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVN   93 (138)
Q Consensus        14 ~~C~~C~~~i~~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~~~~C~~C~~~I~~~   93 (138)
                      +.|..|++.|....++..      ++..||+++|.|..|+..+....+...+|.+||..|+.+.+ ++.|.+|+++|.++
T Consensus       304 p~c~~c~~~i~~~~~i~~------~~~~~h~~~~~c~~~~~~~~~~~~~~~~g~~~c~~~~~~~~-~p~C~~C~~~i~~~  376 (479)
T KOG1703|consen  304 PLCLSCNQKIRSVKVIVA------LGKEWHPEHFSCEVCAIVILDGGPRELDGKILCHECFHAPF-RPNCKRCLLPILEE  376 (479)
T ss_pred             ccccccccCcccceeEee------ccccccccceeeccccccccCCCccccCCCccHHHHHHHhh-CccccccCCchHHh
Confidence            678999999984355554      46699999999999999998877888999999999999998 79999999999764


Q ss_pred             cEEEeCCCccccCCccccccccccCCCCeeecCCCCCccCC
Q psy10674         94 EYTLAENKTFHVKHFCCYECDKELCNQSYIPVTESRPGQDS  134 (138)
Q Consensus        94 ~~~~~~~~~~H~~CF~C~~C~~~l~~~~f~~~~~~~~y~~~  134 (138)
                       +|.|.++.||++||.|..|+++|.+..|++.+ |.|||..
T Consensus       377 -~v~a~~~~wH~~cf~C~~C~~~~~~~~~~~~~-~~pyce~  415 (479)
T KOG1703|consen  377 -GVCALGRLWHPECFVCADCGKPLKNSSFFESD-GEPYCED  415 (479)
T ss_pred             -HhhhccCeechhceeeecccCCCCCCcccccC-Cccchhh
Confidence             56688999999999999999999999999999 9999975


No 10 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.56  E-value=7.2e-15  Score=83.39  Aligned_cols=58  Identities=31%  Similarity=0.702  Sum_probs=50.6

Q ss_pred             cccccccccCCCeEEEeccccCCCCCCcccCcccccCCccccCCceeeeCCeeecHHHHHhhc
Q psy10674         16 CYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATML   78 (138)
Q Consensus        16 C~~C~~~i~~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~   78 (138)
                      |..|+++|.+++.++..     .+..||++||+|..|+++|.+..++..++++||+.||.++|
T Consensus         1 C~~C~~~I~~~~~~~~~-----~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~f   58 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKA-----MGKFWHPECFKCSKCGKPLNDGDFYEKDGKPYCKDCYQKRF   58 (58)
T ss_dssp             BTTTSSBESSSSEEEEE-----TTEEEETTTSBETTTTCBTTTSSEEEETTEEEEHHHHHHHT
T ss_pred             CCCCCCCccCcEEEEEe-----CCcEEEccccccCCCCCccCCCeeEeECCEEECHHHHhhhC
Confidence            78999999977776433     46699999999999999998888999999999999998864


No 11 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.50  E-value=1.4e-14  Score=82.17  Aligned_cols=51  Identities=25%  Similarity=0.510  Sum_probs=46.4

Q ss_pred             ccccCcccccCcEE-EeCCCccccCCccccccccccCCCCeeecCCCCCccCC
Q psy10674         83 CHACDELIFVNEYT-LAENKTFHVKHFCCYECDKELCNQSYIPVTESRPGQDS  134 (138)
Q Consensus        83 C~~C~~~I~~~~~~-~~~~~~~H~~CF~C~~C~~~l~~~~f~~~~~~~~y~~~  134 (138)
                      |++|+++|.+++++ .+.|+.||++||+|..|+++|.+..|++.+ |+|||.+
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~-~~~~C~~   52 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHPECFKCSKCGKPLNDGDFYEKD-GKPYCKD   52 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEETTTSBETTTTCBTTTSSEEEET-TEEEEHH
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEccccccCCCCCccCCCeeEeEC-CEEECHH
Confidence            78999999988776 499999999999999999999988899999 9999964


No 12 
>KOG1700|consensus
Probab=99.30  E-value=2.3e-13  Score=95.25  Aligned_cols=115  Identities=24%  Similarity=0.468  Sum_probs=94.5

Q ss_pred             cccccccccccCCCeEEEeccccCCCCCCcccCcccccCCccccCCceeeeCCeeecHHHHHhhcC--------------
Q psy10674         14 FCCYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLD--------------   79 (138)
Q Consensus        14 ~~C~~C~~~i~~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~--------------   79 (138)
                      ..|..|++.+...+.+..      .+..||+.||+|..|.+.|....+...++.+||+.++...++              
T Consensus         8 ~kc~~c~k~vy~~e~~~~------~g~~~hk~c~~c~~~~k~l~~~~~~~~e~~~yc~~~~~~~~~~~~~~~~~~~~~~~   81 (200)
T KOG1700|consen    8 DKCNACGKTVYFVEKVQK------DGVDFHKECFKCEKCKKTLTLSGYSEHEGVPYCKNCHVAQFGPKGGGFGKGFQKAG   81 (200)
T ss_pred             chhhhccCcchHHHHHhc------cCcchhhhHHhccccccccccccccccccccccccchHhhhCcccccccccccccC
Confidence            468888888875554442      466999999999999999988889999999999985433310              


Q ss_pred             --------------------------CCcccccCcccccCcEEEeCCCccccCCccccccccccCCCCeeecCCCCCccC
Q psy10674         80 --------------------------IPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELCNQSYIPVTESRPGQD  133 (138)
Q Consensus        80 --------------------------~~~C~~C~~~I~~~~~~~~~~~~~H~~CF~C~~C~~~l~~~~f~~~~~~~~y~~  133 (138)
                                                ...|..|++.+.+.+-+...+..||..||+|+.|+..|+...+...+ |.+||+
T Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~g~~~~c~~c~k~vy~~Ek~~~~~~~~hk~cfrc~~~~~~ls~~~~~~~~-g~l~~~  160 (200)
T KOG1700|consen   82 GLGKDGKSLNESKPNQSAKFQVFAGEKEKCARCQKTVYPLEKVTGNGLEFHKSCFRCTHCGKKLSPKNYAALE-GVLYCK  160 (200)
T ss_pred             CCCcccccccccccccchhHHhhhccccccccccceeeehHHHhhhhhhhhhhheeecccccccCCcchhhcC-Cccccc
Confidence                                      15899999999876666688999999999999999999999999888 999987


Q ss_pred             CC
Q psy10674        134 SP  135 (138)
Q Consensus       134 ~~  135 (138)
                      -.
T Consensus       161 ~~  162 (200)
T KOG1700|consen  161 HH  162 (200)
T ss_pred             hh
Confidence            64


No 13 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=99.04  E-value=1.8e-10  Score=59.69  Aligned_cols=37  Identities=30%  Similarity=0.515  Sum_probs=33.0

Q ss_pred             cccccCcccccC-cEEEeCCCccccCCccccccccccC
Q psy10674         82 RCHACDELIFVN-EYTLAENKTFHVKHFCCYECDKELC  118 (138)
Q Consensus        82 ~C~~C~~~I~~~-~~~~~~~~~~H~~CF~C~~C~~~l~  118 (138)
                      +|.+|+++|.+. .++.+.++.||++||+|..|+++|.
T Consensus         1 ~C~~C~~~i~~~~~~~~~~~~~~H~~Cf~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGELVLRALGKVWHPECFKCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCcEEEEeCCccccccCCCCcccCCcCc
Confidence            589999999886 5666899999999999999999986


No 14 
>KOG4577|consensus
Probab=98.96  E-value=5.7e-11  Score=85.61  Aligned_cols=77  Identities=18%  Similarity=0.493  Sum_probs=58.5

Q ss_pred             eeecCCCcCcCCcccccccccccCCCeE------EEec-------c--------------ccCCCCCCcccCcccccCCc
Q psy10674          2 TLAENKTFHVKHFCCYECDKKVQFENYT------GKIT-------Q--------------SQESEVLWHPQCFVCSTCDE   54 (138)
Q Consensus         2 ~~a~g~~~h~~~~~C~~C~~~i~~~~~~------~~~~-------~--------------~~~~~~~~H~~Cf~C~~C~~   54 (138)
                      +.++++.||..|++|..|..+|.+.-+.      ...+       +              -.+.+.+||.+||.|.+|++
T Consensus        49 lKvl~R~wHs~CLkCs~C~~qL~drCFsR~~s~yCkedFfKrfGTKCsaC~~GIpPtqVVRkAqd~VYHl~CF~C~iC~R  128 (383)
T KOG4577|consen   49 LKVLDRHWHSSCLKCSDCHDQLADRCFSREGSVYCKEDFFKRFGTKCSACQEGIPPTQVVRKAQDFVYHLHCFACFICKR  128 (383)
T ss_pred             HHHHhhhhhhhhcchhhhhhHHHHHHhhcCCceeehHHHHHHhCCcchhhcCCCChHHHHHHhhcceeehhhhhhHhhhc
Confidence            4688999999999999999998743221      1100       0              01567899999999999999


Q ss_pred             cc-cCCcee-eeCCeeecHHHHHhhc
Q psy10674         55 LL-VDLMYF-HYKGNVYCLRDYATML   78 (138)
Q Consensus        55 ~l-~~~~~~-~~~~~~yC~~c~~~~~   78 (138)
                      +| .+..|| .+|+++.|+++|++..
T Consensus       129 ~L~TGdEFYLmeD~rLvCK~DYE~Ak  154 (383)
T KOG4577|consen  129 QLATGDEFYLMEDARLVCKDDYETAK  154 (383)
T ss_pred             ccccCCeeEEeccceeehhhhHHHHH
Confidence            99 444555 5899999999998753


No 15 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=98.64  E-value=3.2e-08  Score=51.04  Aligned_cols=38  Identities=32%  Similarity=0.749  Sum_probs=30.0

Q ss_pred             ccccccccccCCCeEEEeccccCCCCCCcccCcccccCCcccc
Q psy10674         15 CCYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLV   57 (138)
Q Consensus        15 ~C~~C~~~i~~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~   57 (138)
                      +|..|+++|.+++..+..     .+..||++||+|..|+++|.
T Consensus         1 ~C~~C~~~i~~~~~~~~~-----~~~~~H~~Cf~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGELVLRA-----LGKVWHPECFKCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCcEEEEe-----CCccccccCCCCcccCCcCc
Confidence            488999999866343332     46699999999999999885


No 16 
>KOG1700|consensus
Probab=97.84  E-value=3.5e-06  Score=59.15  Aligned_cols=54  Identities=24%  Similarity=0.485  Sum_probs=48.3

Q ss_pred             CcccccCcccccCcEEEeCCCccccCCccccccccccCCCCeeecCCCCCccCCC
Q psy10674         81 PRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELCNQSYIPVTESRPGQDSP  135 (138)
Q Consensus        81 ~~C~~C~~~I~~~~~~~~~~~~~H~~CF~C~~C~~~l~~~~f~~~~~~~~y~~~~  135 (138)
                      .+|.+|++.+...+.+...|..||..||+|..|.+.|....+..++ +.|||+.+
T Consensus         8 ~kc~~c~k~vy~~e~~~~~g~~~hk~c~~c~~~~k~l~~~~~~~~e-~~~yc~~~   61 (200)
T KOG1700|consen    8 DKCNACGKTVYFVEKVQKDGVDFHKECFKCEKCKKTLTLSGYSEHE-GVPYCKNC   61 (200)
T ss_pred             chhhhccCcchHHHHHhccCcchhhhHHhccccccccccccccccc-cccccccc
Confidence            5899999999876666688999999999999999999988899888 99999874


No 17 
>KOG0490|consensus
Probab=97.67  E-value=2.7e-06  Score=60.63  Aligned_cols=92  Identities=28%  Similarity=0.570  Sum_probs=72.9

Q ss_pred             CCCCcccCcccccCCcccc--CCceeeeCCeeecHHHHHh--hcCCCcccccCcccccCcEEE-eCCCccccCCcccccc
Q psy10674         39 EVLWHPQCFVCSTCDELLV--DLMYFHYKGNVYCLRDYAT--MLDIPRCHACDELIFVNEYTL-AENKTFHVKHFCCYEC  113 (138)
Q Consensus        39 ~~~~H~~Cf~C~~C~~~l~--~~~~~~~~~~~yC~~c~~~--~~~~~~C~~C~~~I~~~~~~~-~~~~~~H~~CF~C~~C  113 (138)
                      +..||..|..|..|...|.  ...+.. ++..||..++..  .++ .+|.+|...|...+.++ +..+. |..||.|..|
T Consensus        16 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-~g~~~~~~d~~~~~~~~-~rr~rt~~~~~ql~~ler~f~~~-h~Pd~~~r~~   92 (235)
T KOG0490|consen   16 DRYWHASCLKCAECDNPLGVGDTCFSK-DGSIYCKRDYQREFKFS-KRCARCKFTISQLDELERAFEKV-HLPCFACREC   92 (235)
T ss_pred             cHHHHHHHHhhhhhcchhccCCCcccC-CCcccccccchhhhhcc-ccccCCCCCcCHHHHHHHhhcCC-CcCccchHHH
Confidence            4589999999999999996  444445 999999999987  554 69999999996555444 66676 9999999999


Q ss_pred             ccccC-CCCeeecCCCCCccC
Q psy10674        114 DKELC-NQSYIPVTESRPGQD  133 (138)
Q Consensus       114 ~~~l~-~~~f~~~~~~~~y~~  133 (138)
                      ...+. +..+.++++.+.++.
T Consensus        93 la~~~~~~e~rVqvwFqnrra  113 (235)
T KOG0490|consen   93 LALLLTGDEFRVQVWFQNRRA  113 (235)
T ss_pred             HhhcCCCCeeeeehhhhhhcH
Confidence            88654 778888875566654


No 18 
>KOG1702|consensus
Probab=97.18  E-value=1.7e-05  Score=55.20  Aligned_cols=57  Identities=28%  Similarity=0.514  Sum_probs=45.6

Q ss_pred             ccccccccccCCCeEEEeccccCCCCCCcccCcccccCCccccCCceeeeCCeeecHHHHHhh
Q psy10674         15 CCYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATM   77 (138)
Q Consensus        15 ~C~~C~~~i~~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~   77 (138)
                      .|..|++.+.+-+.+..      ++..||..||+|..|+.+|....+...+.++||..+|.+.
T Consensus         6 n~~~cgk~vYPvE~v~c------ldk~whk~cfkce~c~mtlnmKnyKgy~kkpycn~hYpkq   62 (264)
T KOG1702|consen    6 NREDCGKTVYPVEEVKC------LDKVWHKQCFKCEVCGMTLNMKNYKGYDKKPYCNPHYPKQ   62 (264)
T ss_pred             hhhhhccccccHHHHhh------HHHHHHHHhheeeeccCChhhhhccccccCCCcCcccccc
Confidence            35677777765544433      4559999999999999999888888899999999998654


No 19 
>KOG1702|consensus
Probab=97.15  E-value=4e-05  Score=53.39  Aligned_cols=53  Identities=19%  Similarity=0.341  Sum_probs=44.6

Q ss_pred             CcccccCcccccCcEEEeCCCccccCCccccccccccCCCCeeecCCCCCccCC
Q psy10674         81 PRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELCNQSYIPVTESRPGQDS  134 (138)
Q Consensus        81 ~~C~~C~~~I~~~~~~~~~~~~~H~~CF~C~~C~~~l~~~~f~~~~~~~~y~~~  134 (138)
                      +.|..|++.+.+-+-+.-+++.||.-||+|..|+.+|.-.+|--.+ .+|||+.
T Consensus         5 ~n~~~cgk~vYPvE~v~cldk~whk~cfkce~c~mtlnmKnyKgy~-kkpycn~   57 (264)
T KOG1702|consen    5 CNREDCGKTVYPVEEVKCLDKVWHKQCFKCEVCGMTLNMKNYKGYD-KKPYCNP   57 (264)
T ss_pred             chhhhhccccccHHHHhhHHHHHHHHhheeeeccCChhhhhccccc-cCCCcCc
Confidence            4567888888776666688999999999999999999877776666 8999986


No 20 
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=95.17  E-value=0.0074  Score=30.66  Aligned_cols=32  Identities=28%  Similarity=0.668  Sum_probs=23.5

Q ss_pred             ccccCcccccCcEEE-eCCCccccCCcccccccccc
Q psy10674         83 CHACDELIFVNEYTL-AENKTFHVKHFCCYECDKEL  117 (138)
Q Consensus        83 C~~C~~~I~~~~~~~-~~~~~~H~~CF~C~~C~~~l  117 (138)
                      |.-|+++|.+..++. ..++.|+   |.|..|.+.|
T Consensus         1 Cd~CG~~I~~eP~~~k~~~~~y~---fCC~tC~~~f   33 (37)
T PF08394_consen    1 CDYCGGEITGEPIVVKIGNKVYY---FCCPTCLSQF   33 (37)
T ss_pred             CCccCCcccCCEEEEEECCeEEE---EECHHHHHHH
Confidence            677999998776554 7888888   6667776554


No 21 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=94.20  E-value=0.036  Score=30.56  Aligned_cols=36  Identities=14%  Similarity=0.471  Sum_probs=26.6

Q ss_pred             CcccccCcccc-cCcEEE--eCCCccccCCc----cccc--cccc
Q psy10674         81 PRCHACDELIF-VNEYTL--AENKTFHVKHF----CCYE--CDKE  116 (138)
Q Consensus        81 ~~C~~C~~~I~-~~~~~~--~~~~~~H~~CF----~C~~--C~~~  116 (138)
                      .+|..|+++|. ++++++  .=+..||.+|+    .|..  |+..
T Consensus         6 ~~C~~Cg~~~~~~dDiVvCp~CgapyHR~C~~~~g~C~~~~c~~~   50 (54)
T PF14446_consen    6 CKCPVCGKKFKDGDDIVVCPECGAPYHRDCWEKAGGCINYSCGTG   50 (54)
T ss_pred             ccChhhCCcccCCCCEEECCCCCCcccHHHHhhCCceEeccCCCC
Confidence            59999999997 345665  56889999988    3665  5544


No 22 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=90.79  E-value=0.19  Score=31.24  Aligned_cols=28  Identities=11%  Similarity=0.348  Sum_probs=20.6

Q ss_pred             CcccccCcccccCcEEE-eCCCccccCCc
Q psy10674         81 PRCHACDELIFVNEYTL-AENKTFHVKHF  108 (138)
Q Consensus        81 ~~C~~C~~~I~~~~~~~-~~~~~~H~~CF  108 (138)
                      ..|+.|+++|....++. ..|..+|..|+
T Consensus        79 ~~C~vC~k~l~~~~f~~~p~~~v~H~~C~  107 (109)
T PF10367_consen   79 TKCSVCGKPLGNSVFVVFPCGHVVHYSCI  107 (109)
T ss_pred             CCccCcCCcCCCceEEEeCCCeEEecccc
Confidence            58999999997665555 45666787775


No 23 
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=90.44  E-value=0.17  Score=33.99  Aligned_cols=50  Identities=16%  Similarity=0.383  Sum_probs=36.2

Q ss_pred             CeeecHHHHHhhcCCCcccccCcccccCcEE---EeCCCccccCCccccccccccC
Q psy10674         66 GNVYCLRDYATMLDIPRCHACDELIFVNEYT---LAENKTFHVKHFCCYECDKELC  118 (138)
Q Consensus        66 ~~~yC~~c~~~~~~~~~C~~C~~~I~~~~~~---~~~~~~~H~~CF~C~~C~~~l~  118 (138)
                      ..-||..|-.+..  ..|+.|+.+|.+..++   ...+..|++--| |..|+++++
T Consensus        27 ~~~fC~kCG~~tI--~~Cp~C~~~IrG~y~v~gv~~~g~~~~~PsY-C~~CGkpyP   79 (158)
T PF10083_consen   27 REKFCSKCGAKTI--TSCPNCSTPIRGDYHVEGVFGLGGHYEAPSY-CHNCGKPYP   79 (158)
T ss_pred             HHHHHHHhhHHHH--HHCcCCCCCCCCceecCCeeeeCCCCCCChh-HHhCCCCCc
Confidence            4569999998887  6999999999765332   144566665432 888888875


No 24 
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown]
Probab=89.39  E-value=0.045  Score=33.66  Aligned_cols=53  Identities=25%  Similarity=0.344  Sum_probs=39.5

Q ss_pred             cccccCcccccCcEEEeCCCccccCCccccccccccCCCCeeecCCCCCccCCC
Q psy10674         82 RCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELCNQSYIPVTESRPGQDSP  135 (138)
Q Consensus        82 ~C~~C~~~I~~~~~~~~~~~~~H~~CF~C~~C~~~l~~~~f~~~~~~~~y~~~~  135 (138)
                      .|..|...+..-.+....-..+++.+-.|..|.+.|+-..|.+.. .=|||.||
T Consensus        37 aCy~CHdel~~Hpf~p~~~~~~~~~~iiCGvC~~~LT~~EY~~~~-~Cp~C~sp   89 (105)
T COG4357          37 ACYHCHDELEDHPFEPWGLQEFNPKAIICGVCRKLLTRAEYGMCG-SCPYCQSP   89 (105)
T ss_pred             hHHHHHhHHhcCCCccCChhhcCCccEEhhhhhhhhhHHHHhhcC-CCCCcCCC
Confidence            566777666554455455567888888899999888877788777 78888885


No 25 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=88.76  E-value=0.26  Score=22.19  Aligned_cols=9  Identities=33%  Similarity=0.704  Sum_probs=4.7

Q ss_pred             ccccCcccc
Q psy10674         83 CHACDELIF   91 (138)
Q Consensus        83 C~~C~~~I~   91 (138)
                      |..|+..|.
T Consensus         2 Cp~CG~~~~   10 (23)
T PF13240_consen    2 CPNCGAEIE   10 (23)
T ss_pred             CcccCCCCC
Confidence            455555553


No 26 
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=88.01  E-value=0.18  Score=31.50  Aligned_cols=30  Identities=17%  Similarity=0.376  Sum_probs=23.2

Q ss_pred             cccccCcccccCcEEE-eCCCccccCCcccc
Q psy10674         82 RCHACDELIFVNEYTL-AENKTFHVKHFCCY  111 (138)
Q Consensus        82 ~C~~C~~~I~~~~~~~-~~~~~~H~~CF~C~  111 (138)
                      +|..|+++|..++... ..+..-|.+||+=.
T Consensus         4 kC~iCg~~I~~gqlFTF~~kG~VH~~C~~~~   34 (101)
T PF09943_consen    4 KCYICGKPIYEGQLFTFTKKGPVHYECFREK   34 (101)
T ss_pred             EEEecCCeeeecceEEEecCCcEeHHHHHHH
Confidence            7999999999877443 56678898888643


No 27 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=87.68  E-value=0.67  Score=26.01  Aligned_cols=50  Identities=20%  Similarity=0.431  Sum_probs=27.1

Q ss_pred             CcccccccccccCCCeEEEeccccCCCCCCcccCcccccCCccccCCceeeeCCeeecHHHHHhhcCCCcccccCc
Q psy10674         13 HFCCYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDE   88 (138)
Q Consensus        13 ~~~C~~C~~~i~~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~~~~C~~C~~   88 (138)
                      -.+|..|+.+|.+.+..+.               |.|-.|+..+..          -|..|-.+.. .-+|..|+.
T Consensus         7 ~~~CtSCg~~i~~~~~~~~---------------F~CPnCG~~~I~----------RC~~CRk~~~-~Y~CP~CGF   56 (59)
T PRK14890          7 PPKCTSCGIEIAPREKAVK---------------FLCPNCGEVIIY----------RCEKCRKQSN-PYTCPKCGF   56 (59)
T ss_pred             CccccCCCCcccCCCccCE---------------eeCCCCCCeeEe----------echhHHhcCC-ceECCCCCC
Confidence            3567788877775442211               677777765322          1555543333 246666653


No 28 
>KOG0490|consensus
Probab=86.69  E-value=0.13  Score=36.43  Aligned_cols=47  Identities=17%  Similarity=0.310  Sum_probs=37.2

Q ss_pred             cCcccccCcEEEeCCCccccCCccccccccccC--CCCeeecCCCCCccCC
Q psy10674         86 CDELIFVNEYTLAENKTFHVKHFCCYECDKELC--NQSYIPVTESRPGQDS  134 (138)
Q Consensus        86 C~~~I~~~~~~~~~~~~~H~~CF~C~~C~~~l~--~~~f~~~~~~~~y~~~  134 (138)
                      |+..|.+.....+.+..||..|..|..|...|.  ...|.. + |..||..
T Consensus         2 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~-g~~~~~~   50 (235)
T KOG0490|consen    2 CGRQILDRYLLRVLDRYWHASCLKCAECDNPLGVGDTCFSK-D-GSIYCKR   50 (235)
T ss_pred             CCccccchHHhhcccHHHHHHHHhhhhhcchhccCCCcccC-C-Ccccccc
Confidence            667777665555679999999999999999997  555555 6 9999875


No 29 
>PF10235 Cript:  Microtubule-associated protein CRIPT;  InterPro: IPR019367  The CRIPT protein is a cytoskeletal protein involved in microtubule production. This C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners []. 
Probab=85.62  E-value=0.49  Score=28.95  Aligned_cols=44  Identities=20%  Similarity=0.432  Sum_probs=32.3

Q ss_pred             CCcccCcccccCCccccCCceeeeCCeeecHHHHHhhcCCCcccccCcccccC
Q psy10674         41 LWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVN   93 (138)
Q Consensus        41 ~~H~~Cf~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~~~~C~~C~~~I~~~   93 (138)
                      .|-+.--.|..|+..+..      .|.-||..|..+.   -.|+.|++.|.+.
T Consensus        39 Py~~~~~~C~~CK~~v~q------~g~~YCq~CAYkk---GiCamCGKki~dt   82 (90)
T PF10235_consen   39 PYAPYSSKCKICKTKVHQ------PGAKYCQTCAYKK---GICAMCGKKILDT   82 (90)
T ss_pred             cccccCcccccccccccc------CCCccChhhhccc---CcccccCCeeccc
Confidence            565555578888877643      2467999998764   4899999999764


No 30 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=84.39  E-value=1.8  Score=24.29  Aligned_cols=20  Identities=10%  Similarity=0.265  Sum_probs=12.4

Q ss_pred             CcCCcccccccccccCCCeE
Q psy10674         10 HVKHFCCYECDKKVQFENYT   29 (138)
Q Consensus        10 h~~~~~C~~C~~~i~~~~~~   29 (138)
                      +..-.+|..|+..|.+++..
T Consensus         6 ~~~~~~CtSCg~~i~p~e~~   25 (61)
T COG2888           6 MKDPPVCTSCGREIAPGETA   25 (61)
T ss_pred             ccCCceeccCCCEeccCCce
Confidence            33456778888777555443


No 31 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=84.35  E-value=0.59  Score=21.58  Aligned_cols=9  Identities=33%  Similarity=0.730  Sum_probs=5.0

Q ss_pred             cccccCccc
Q psy10674         82 RCHACDELI   90 (138)
Q Consensus        82 ~C~~C~~~I   90 (138)
                      .|..|+..|
T Consensus         4 ~Cp~Cg~~~   12 (26)
T PF13248_consen    4 FCPNCGAEI   12 (26)
T ss_pred             CCcccCCcC
Confidence            455566554


No 32 
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=84.26  E-value=0.32  Score=28.31  Aligned_cols=59  Identities=19%  Similarity=0.373  Sum_probs=24.5

Q ss_pred             ccccCCccccCCceeeeCCeeecHHHHHhhcCCCcccccCcccccCcEEEeCCCccccCCccccccccccC
Q psy10674         48 VCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELC  118 (138)
Q Consensus        48 ~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~~~~C~~C~~~I~~~~~~~~~~~~~H~~CF~C~~C~~~l~  118 (138)
                      .|..|..+|..     .++..+|..|.........|+-|++++   +++.|-|..    =|.|..|+..++
T Consensus         3 ~CP~C~~~L~~-----~~~~~~C~~C~~~~~~~a~CPdC~~~L---e~LkACGAv----dYFC~~c~gLiS   61 (70)
T PF07191_consen    3 TCPKCQQELEW-----QGGHYHCEACQKDYKKEAFCPDCGQPL---EVLKACGAV----DYFCNHCHGLIS   61 (70)
T ss_dssp             B-SSS-SBEEE-----ETTEEEETTT--EEEEEEE-TTT-SB----EEEEETTEE----EEE-TTTT-EE-
T ss_pred             cCCCCCCccEE-----eCCEEECccccccceecccCCCcccHH---HHHHHhccc----ceeeccCCceee
Confidence            35555555422     235556655543322224777777777   344454421    134666666655


No 33 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=84.24  E-value=2  Score=23.74  Aligned_cols=49  Identities=16%  Similarity=0.173  Sum_probs=35.2

Q ss_pred             cccccCCccccCCceeeeCCeeecHHHHHhhcC-CCcccccCcccccCcEE
Q psy10674         47 FVCSTCDELLVDLMYFHYKGNVYCLRDYATMLD-IPRCHACDELIFVNEYT   96 (138)
Q Consensus        47 f~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~-~~~C~~C~~~I~~~~~~   96 (138)
                      |.|..|+..+.+ ......|..||+.+..+.+. ...|+.|++++...+++
T Consensus         2 ~~Cpi~~~~~~~-Pv~~~~G~v~~~~~i~~~~~~~~~cP~~~~~~~~~~l~   51 (63)
T smart00504        2 FLCPISLEVMKD-PVILPSGQTYERRAIEKWLLSHGTDPVTGQPLTHEDLI   51 (63)
T ss_pred             cCCcCCCCcCCC-CEECCCCCEEeHHHHHHHHHHCCCCCCCcCCCChhhce
Confidence            578888888865 45557789999988865431 24799999888655544


No 34 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=83.94  E-value=0.44  Score=23.98  Aligned_cols=24  Identities=17%  Similarity=0.135  Sum_probs=15.2

Q ss_pred             cccccccccCCCCeeecCCCCCccCCCCC
Q psy10674        109 CCYECDKELCNQSYIPVTESRPGQDSPGS  137 (138)
Q Consensus       109 ~C~~C~~~l~~~~f~~~~~~~~y~~~~~~  137 (138)
                      .|..|+..    .|...+ |+.||++.++
T Consensus        10 ~C~~C~~~----~~~~~d-G~~yC~~cG~   33 (36)
T PF11781_consen   10 PCPVCGSR----WFYSDD-GFYYCDRCGH   33 (36)
T ss_pred             cCCCCCCe----EeEccC-CEEEhhhCce
Confidence            37777643    344444 9999987653


No 35 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=83.44  E-value=0.9  Score=26.00  Aligned_cols=49  Identities=14%  Similarity=0.463  Sum_probs=22.2

Q ss_pred             cccccCCccccCCceeeeCCeeecHHHHHhhcCCCcccccCcccccCcEE
Q psy10674         47 FVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYT   96 (138)
Q Consensus        47 f~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~~~~C~~C~~~I~~~~~~   96 (138)
                      .+|+.|...|........=.-++|..|-.+.+| ..|+.|+.|--..++.
T Consensus         8 LrCs~C~~~l~~pv~l~~CeH~fCs~Ci~~~~~-~~CPvC~~Paw~qD~~   56 (65)
T PF14835_consen    8 LRCSICFDILKEPVCLGGCEHIFCSSCIRDCIG-SECPVCHTPAWIQDIQ   56 (65)
T ss_dssp             TS-SSS-S--SS-B---SSS--B-TTTGGGGTT-TB-SSS--B-S-SS--
T ss_pred             cCCcHHHHHhcCCceeccCccHHHHHHhHHhcC-CCCCCcCChHHHHHHH
Confidence            567888777754323344556788888877776 5799999887655543


No 36 
>PF10886 DUF2685:  Protein of unknown function (DUF2685);  InterPro: IPR024362 This is a family of uncharacterised bacteriophage proteins. Their function in unknown.
Probab=81.33  E-value=1.4  Score=24.24  Aligned_cols=26  Identities=19%  Similarity=0.194  Sum_probs=19.4

Q ss_pred             CcccccCcccccCcEEEeCCCccccC
Q psy10674         81 PRCHACDELIFVNEYTLAENKTFHVK  106 (138)
Q Consensus        81 ~~C~~C~~~I~~~~~~~~~~~~~H~~  106 (138)
                      .+|..|++||.+...+...+..-|+.
T Consensus         2 ~~CvVCKqpi~~a~~v~T~~G~VH~g   27 (54)
T PF10886_consen    2 EICVVCKQPIDDALVVETESGPVHPG   27 (54)
T ss_pred             CeeeeeCCccCcceEEEcCCCccCcH
Confidence            48999999998766665666677763


No 37 
>PF02069 Metallothio_Pro:  Prokaryotic metallothionein;  InterPro: IPR000518 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium and nickel. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, , ]. An empirical classification into three classes was proposed by Kojima [], with class III MTs including atypical polypeptides composed of gamma-glutamylcysteinyl units. Class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. The MT superfamily is subdivided into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects [], e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range.  Family 14 consists of prokaryota MTs. Its members are recognised by the sequence pattern K-C-A-C-x(2)-C-L-C.The taxonomic range of the members extends to cyanobacteria. Known characteristics are: 53 to 56 AAs; 9 conserved Cys; one conserved tyrosine residue; one conserved histidine residue; contain other unusual residues. ; GO: 0046872 metal ion binding; PDB: 1JJD_A.
Probab=81.24  E-value=0.93  Score=24.79  Aligned_cols=24  Identities=13%  Similarity=0.207  Sum_probs=9.7

Q ss_pred             ccccccccCCCCeeecCCCCCccCC
Q psy10674        110 CYECDKELCNQSYIPVTESRPGQDS  134 (138)
Q Consensus       110 C~~C~~~l~~~~f~~~~~~~~y~~~  134 (138)
                      |..|...++...=+.++ ||.||+.
T Consensus        10 C~~C~C~V~~~~Ai~~d-Gk~YCS~   33 (52)
T PF02069_consen   10 CPSCSCVVSEEEAIQKD-GKYYCSE   33 (52)
T ss_dssp             STT----B-TTTSEESS-S-EESSH
T ss_pred             CCCCEeEECchHhHHhC-CEeeecH
Confidence            44555555544445555 6666653


No 38 
>PF14569 zf-UDP:  Zinc-binding RING-finger; PDB: 1WEO_A.
Probab=80.19  E-value=2.1  Score=25.37  Aligned_cols=43  Identities=14%  Similarity=0.306  Sum_probs=15.4

Q ss_pred             ccccCCccc----cCCceee--eCCeeecHHHHH--hhcCCCcccccCccc
Q psy10674         48 VCSTCDELL----VDLMYFH--YKGNVYCLRDYA--TMLDIPRCHACDELI   90 (138)
Q Consensus        48 ~C~~C~~~l----~~~~~~~--~~~~~yC~~c~~--~~~~~~~C~~C~~~I   90 (138)
                      .|.+|+..+    .+..|..  .=+.+.|+.||.  ..-|...|.+|+.+-
T Consensus        11 iCqiCGD~VGl~~~Ge~FVAC~eC~fPvCr~CyEYErkeg~q~CpqCkt~y   61 (80)
T PF14569_consen   11 ICQICGDDVGLTENGEVFVACHECAFPVCRPCYEYERKEGNQVCPQCKTRY   61 (80)
T ss_dssp             B-SSS--B--B-SSSSB--S-SSS-----HHHHHHHHHTS-SB-TTT--B-
T ss_pred             ccccccCccccCCCCCEEEEEcccCCccchhHHHHHhhcCcccccccCCCc
Confidence            456665554    1222222  345678898884  344567899998543


No 39 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=79.04  E-value=1.3  Score=27.34  Aligned_cols=13  Identities=31%  Similarity=0.813  Sum_probs=6.0

Q ss_pred             cccCCccccCCce
Q psy10674         49 CSTCDELLVDLMY   61 (138)
Q Consensus        49 C~~C~~~l~~~~~   61 (138)
                      |..|+++|..+.|
T Consensus        81 C~vC~k~l~~~~f   93 (109)
T PF10367_consen   81 CSVCGKPLGNSVF   93 (109)
T ss_pred             ccCcCCcCCCceE
Confidence            4455555544333


No 40 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=78.59  E-value=3.8  Score=21.72  Aligned_cols=43  Identities=23%  Similarity=0.444  Sum_probs=27.6

Q ss_pred             ccccCCccccCCceeeeCCee-ecHHHHHhhc-CCCcccccCcccc
Q psy10674         48 VCSTCDELLVDLMYFHYKGNV-YCLRDYATML-DIPRCHACDELIF   91 (138)
Q Consensus        48 ~C~~C~~~l~~~~~~~~~~~~-yC~~c~~~~~-~~~~C~~C~~~I~   91 (138)
                      .|..|...... ..+..=|-. +|..|..+.. ...+|+.|..+|.
T Consensus         4 ~C~iC~~~~~~-~~~~pCgH~~~C~~C~~~~~~~~~~CP~Cr~~i~   48 (50)
T PF13920_consen    4 ECPICFENPRD-VVLLPCGHLCFCEECAERLLKRKKKCPICRQPIE   48 (50)
T ss_dssp             B-TTTSSSBSS-EEEETTCEEEEEHHHHHHHHHTTSBBTTTTBB-S
T ss_pred             CCccCCccCCc-eEEeCCCChHHHHHHhHHhcccCCCCCcCChhhc
Confidence            46666666543 233445566 9999997763 2369999999984


No 41 
>PF00645 zf-PARP:  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region;  InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents PARP (Poly(ADP) polymerase) type zinc finger domains. NAD(+) ADP-ribosyltransferase(2.4.2.30 from EC) [, ] is a eukaryotic enzyme that catalyses the covalent attachment of ADP-ribose units from NAD(+) to various nuclear acceptor proteins. This post-translational modification of nuclear proteins is dependent on DNA. It appears to be involved in the regulation of various important cellular processes such as differentiation, proliferation and tumour transformation as well as in the regulation of the molecular events involved in the recovery of the cell from DNA damage. Structurally, NAD(+) ADP-ribosyltransferase consists of three distinct domains: an N-terminal zinc-dependent DNA-binding domain, a central automodification domain and a C-terminal NAD-binding domain. The DNA-binding region contains a pair of PARP-type zinc finger domains which have been shown to bind DNA in a zinc-dependent manner. The PARP-type zinc finger domains seem to bind specifically to single-stranded DNA and to act as a DNA nick sensor. DNA ligase III [] contains, in its N-terminal section, a single copy of a zinc finger highly similar to those of PARP. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 1UW0_A 3OD8_D 3ODA_A 4AV1_A 2DMJ_A 4DQY_D 2L30_A 2CS2_A 2L31_A 3ODE_B ....
Probab=78.37  E-value=0.67  Score=27.56  Aligned_cols=35  Identities=20%  Similarity=0.321  Sum_probs=19.9

Q ss_pred             cccccccccccCCCeEEEeccccCC-----CCCCcccCcc
Q psy10674         14 FCCYECDKKVQFENYTGKITQSQES-----EVLWHPQCFV   48 (138)
Q Consensus        14 ~~C~~C~~~i~~~~~~~~~~~~~~~-----~~~~H~~Cf~   48 (138)
                      -+|..|++.|..+++.+-.......     ...||..||.
T Consensus         8 a~Ck~C~~~I~kg~lRiG~~~~~~~~~~~~~~W~H~~C~~   47 (82)
T PF00645_consen    8 AKCKGCKKKIAKGELRIGKIVPSPEGDGDIPKWYHWDCFF   47 (82)
T ss_dssp             EBETTTSCBE-TTSEEEEEEEEETTSSCEEEEEEEHHHHH
T ss_pred             ccCcccCCcCCCCCEEEEEEecccccCCCCCceECccccc
Confidence            4688999999977765432110001     1356777775


No 42 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=78.07  E-value=2.2  Score=23.15  Aligned_cols=29  Identities=14%  Similarity=0.323  Sum_probs=20.8

Q ss_pred             ccccCCccccCC-ceeeeCCeeecHHHHHhh
Q psy10674         48 VCSTCDELLVDL-MYFHYKGNVYCLRDYATM   77 (138)
Q Consensus        48 ~C~~C~~~l~~~-~~~~~~~~~yC~~c~~~~   77 (138)
                      .|..|+..++-- .+...|| ..|.+|+.+.
T Consensus         1 ~C~iCg~kigl~~~~k~~DG-~iC~~C~~Kl   30 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDG-YICKDCLKKL   30 (51)
T ss_pred             CCCccccccccccceeccCc-cchHHHHHHh
Confidence            478888888442 3556777 6899998775


No 43 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=77.47  E-value=1.7  Score=19.85  Aligned_cols=11  Identities=18%  Similarity=0.697  Sum_probs=6.1

Q ss_pred             cccccccccCC
Q psy10674         16 CYECDKKVQFE   26 (138)
Q Consensus        16 C~~C~~~i~~~   26 (138)
                      |..|+.+|.+.
T Consensus         1 C~sC~~~i~~r   11 (24)
T PF07754_consen    1 CTSCGRPIAPR   11 (24)
T ss_pred             CccCCCcccCc
Confidence            45566666543


No 44 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=74.94  E-value=1.6  Score=28.59  Aligned_cols=22  Identities=27%  Similarity=0.656  Sum_probs=16.8

Q ss_pred             ccccCCccccCCceeeeCCeeecHHHH
Q psy10674         48 VCSTCDELLVDLMYFHYKGNVYCLRDY   74 (138)
Q Consensus        48 ~C~~C~~~l~~~~~~~~~~~~yC~~c~   74 (138)
                      .|..|+.||    | .++|.+||+.|-
T Consensus        30 hCp~Cg~PL----F-~KdG~v~CPvC~   51 (131)
T COG1645          30 HCPKCGTPL----F-RKDGEVFCPVCG   51 (131)
T ss_pred             hCcccCCcc----e-eeCCeEECCCCC
Confidence            478898887    3 389999887764


No 45 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=74.57  E-value=1.6  Score=22.62  Aligned_cols=22  Identities=27%  Similarity=0.735  Sum_probs=13.1

Q ss_pred             ccccCCccccCCceeeeCCeeecHHH
Q psy10674         48 VCSTCDELLVDLMYFHYKGNVYCLRD   73 (138)
Q Consensus        48 ~C~~C~~~l~~~~~~~~~~~~yC~~c   73 (138)
                      .|..|+.||-    ..++++.||..|
T Consensus        19 ~Cp~C~~PL~----~~k~g~~~Cv~C   40 (41)
T PF06677_consen   19 HCPDCGTPLM----RDKDGKIYCVSC   40 (41)
T ss_pred             ccCCCCCeeE----EecCCCEECCCC
Confidence            4566777662    245677777543


No 46 
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=72.94  E-value=0.83  Score=22.77  Aligned_cols=28  Identities=18%  Similarity=0.433  Sum_probs=17.5

Q ss_pred             cccCCccccCCceeeeCCeeecHHHHHh
Q psy10674         49 CSTCDELLVDLMYFHYKGNVYCLRDYAT   76 (138)
Q Consensus        49 C~~C~~~l~~~~~~~~~~~~yC~~c~~~   76 (138)
                      |..|+.++.........+..+|..|...
T Consensus         6 C~~CGe~I~~~Rl~~~p~~~~C~~C~~~   33 (36)
T PF01258_consen    6 CEDCGEPIPEERLVAVPGATLCVECQER   33 (36)
T ss_dssp             -TTTSSBEEHHHHHHCTTECS-HHHHHH
T ss_pred             ccccCChHHHHHHHhCCCcEECHHHhCc
Confidence            7777777765555556777777777654


No 47 
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=72.92  E-value=1.4  Score=27.18  Aligned_cols=32  Identities=16%  Similarity=0.323  Sum_probs=22.3

Q ss_pred             CcccccCcccccCcE-EEeCCCccccCCccccc
Q psy10674         81 PRCHACDELIFVNEY-TLAENKTFHVKHFCCYE  112 (138)
Q Consensus        81 ~~C~~C~~~I~~~~~-~~~~~~~~H~~CF~C~~  112 (138)
                      -+|..|+++|..++. +......-|-+||.=+.
T Consensus         7 wkC~VCg~~iieGqkFTF~~kGsVH~eCl~~s~   39 (103)
T COG4847           7 WKCYVCGGTIIEGQKFTFTKKGSVHYECLAESK   39 (103)
T ss_pred             eeEeeeCCEeeeccEEEEeeCCcchHHHHHHHH
Confidence            389999999987763 33455667878776444


No 48 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=72.89  E-value=6.6  Score=27.54  Aligned_cols=51  Identities=18%  Similarity=0.405  Sum_probs=33.3

Q ss_pred             CcccccCCccccCCceeeeCCeeecHHHHHhhc-----------------CCCcccccCcccccCcEEE
Q psy10674         46 CFVCSTCDELLVDLMYFHYKGNVYCLRDYATML-----------------DIPRCHACDELIFVNEYTL   97 (138)
Q Consensus        46 Cf~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~-----------------~~~~C~~C~~~I~~~~~~~   97 (138)
                      -|.|.+|...+.+ .....=|-.||..|..+..                 +..+|+.|..+|....++.
T Consensus        18 ~~~CpICld~~~d-PVvT~CGH~FC~~CI~~wl~~s~~s~~~~~~~~~~k~~~~CPvCR~~Is~~~LvP   85 (193)
T PLN03208         18 DFDCNICLDQVRD-PVVTLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREPPKCPVCKSDVSEATLVP   85 (193)
T ss_pred             ccCCccCCCcCCC-cEEcCCCchhHHHHHHHHHHhccccccccccccccCCCCcCCCCCCcCChhcEEE
Confidence            4777777766643 2344566778887775421                 1258999999998766554


No 49 
>KOG0320|consensus
Probab=71.28  E-value=2.7  Score=29.02  Aligned_cols=53  Identities=17%  Similarity=0.453  Sum_probs=37.6

Q ss_pred             cccCcccccCCccccCCc-eeeeCCeeecHHHHHhhcC-CCcccccCcccccCcE
Q psy10674         43 HPQCFVCSTCDELLVDLM-YFHYKGNVYCLRDYATMLD-IPRCHACDELIFVNEY   95 (138)
Q Consensus        43 H~~Cf~C~~C~~~l~~~~-~~~~~~~~yC~~c~~~~~~-~~~C~~C~~~I~~~~~   95 (138)
                      -..+++|-+|=....... +..+=|.++|+.|..+.+. +.+|+.|++.|...++
T Consensus       128 ~~~~~~CPiCl~~~sek~~vsTkCGHvFC~~Cik~alk~~~~CP~C~kkIt~k~~  182 (187)
T KOG0320|consen  128 KEGTYKCPICLDSVSEKVPVSTKCGHVFCSQCIKDALKNTNKCPTCRKKITHKQF  182 (187)
T ss_pred             cccccCCCceecchhhccccccccchhHHHHHHHHHHHhCCCCCCcccccchhhh
Confidence            345788888866664433 4457789999999876542 3599999998865444


No 50 
>PF12674 Zn_ribbon_2:  Putative zinc ribbon domain
Probab=70.69  E-value=1.9  Score=25.82  Aligned_cols=29  Identities=28%  Similarity=0.471  Sum_probs=19.2

Q ss_pred             ccccCCccccCCceee-----eCCeeecHHHHHh
Q psy10674         48 VCSTCDELLVDLMYFH-----YKGNVYCLRDYAT   76 (138)
Q Consensus        48 ~C~~C~~~l~~~~~~~-----~~~~~yC~~c~~~   76 (138)
                      .|+.|+.||.....+.     ..+.-||..||..
T Consensus         2 ~CQSCGMPl~~~~~~Gte~dGs~s~~YC~yCy~~   35 (81)
T PF12674_consen    2 FCQSCGMPLSKDEDFGTEADGSKSEDYCSYCYQN   35 (81)
T ss_pred             cCCcCcCccCCccccccccCCCCchhHHHHHhcC
Confidence            4888999996554332     2335689888864


No 51 
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=70.45  E-value=8.3  Score=21.39  Aligned_cols=45  Identities=24%  Similarity=0.425  Sum_probs=29.5

Q ss_pred             ccccCCccccCC---ceeeeCCeeecHHHHHhhcCCCcccccCcccccC
Q psy10674         48 VCSTCDELLVDL---MYFHYKGNVYCLRDYATMLDIPRCHACDELIFVN   93 (138)
Q Consensus        48 ~C~~C~~~l~~~---~~~~~~~~~yC~~c~~~~~~~~~C~~C~~~I~~~   93 (138)
                      .|..|++.|...   .+.=.-.=-||.+|...++. ..|+-|+..+..+
T Consensus         7 nCE~C~~dLp~~s~~A~ICSfECTFC~~C~e~~l~-~~CPNCgGelv~R   54 (57)
T PF06906_consen    7 NCECCDKDLPPDSPEAYICSFECTFCADCAETMLN-GVCPNCGGELVRR   54 (57)
T ss_pred             CccccCCCCCCCCCcceEEeEeCcccHHHHHHHhc-CcCcCCCCccccC
Confidence            467777777332   22223345588899888873 6999998776543


No 52 
>PRK00807 50S ribosomal protein L24e; Validated
Probab=67.67  E-value=2.6  Score=23.04  Aligned_cols=33  Identities=24%  Similarity=0.610  Sum_probs=20.7

Q ss_pred             CcccccCcccccCc---EEEeCCCccccCCccccccccc
Q psy10674         81 PRCHACDELIFVNE---YTLAENKTFHVKHFCCYECDKE  116 (138)
Q Consensus        81 ~~C~~C~~~I~~~~---~~~~~~~~~H~~CF~C~~C~~~  116 (138)
                      ..|.-|+..|.++.   ++...|+.|.   |.+..|.+.
T Consensus         2 ~~C~fcG~~I~pg~G~~~vr~Dgkv~~---Fcs~KC~~~   37 (52)
T PRK00807          2 RTCSFCGKEIEPGTGKMYVKKDGTILY---FCSSKCEKN   37 (52)
T ss_pred             cccCCCCCeEcCCCCeEEEEeCCcEEE---EeCHHHHHH
Confidence            36788888887554   2446677776   555566543


No 53 
>PF12773 DZR:  Double zinc ribbon
Probab=67.26  E-value=4.8  Score=21.29  Aligned_cols=11  Identities=18%  Similarity=0.425  Sum_probs=8.2

Q ss_pred             CcccccCcccc
Q psy10674         81 PRCHACDELIF   91 (138)
Q Consensus        81 ~~C~~C~~~I~   91 (138)
                      ..|..|+.++.
T Consensus        13 ~fC~~CG~~l~   23 (50)
T PF12773_consen   13 KFCPHCGTPLP   23 (50)
T ss_pred             cCChhhcCChh
Confidence            57888887775


No 54 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=66.69  E-value=3.9  Score=33.99  Aligned_cols=10  Identities=20%  Similarity=0.564  Sum_probs=5.2

Q ss_pred             cccccccccc
Q psy10674         15 CCYECDKKVQ   24 (138)
Q Consensus        15 ~C~~C~~~i~   24 (138)
                      +|..|+..+.
T Consensus         3 ~Cp~Cg~~n~   12 (645)
T PRK14559          3 ICPQCQFENP   12 (645)
T ss_pred             cCCCCCCcCC
Confidence            4555555544


No 55 
>cd02336 ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present in RSC8 and related proteins. RSC8 is a component of the RSC complex, which is closely related to the SWI/SNF complex and is involved in remodeling chromatin structure. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=65.37  E-value=7.6  Score=20.50  Aligned_cols=29  Identities=24%  Similarity=0.390  Sum_probs=17.5

Q ss_pred             ccccCCccccCCceee--eCCeeecHHHHHh
Q psy10674         48 VCSTCDELLVDLMYFH--YKGNVYCLRDYAT   76 (138)
Q Consensus        48 ~C~~C~~~l~~~~~~~--~~~~~yC~~c~~~   76 (138)
                      .|..|+..+....|.-  ..+..+|.+||.+
T Consensus         2 ~C~~Cg~D~t~vryh~~~~~~~dLC~~CF~~   32 (45)
T cd02336           2 HCFTCGNDCTRVRYHNLKAKKYDLCPSCYQE   32 (45)
T ss_pred             cccCCCCccCceEEEecCCCccccChHHHhC
Confidence            4667777775432321  2346688888876


No 56 
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=64.53  E-value=6.4  Score=25.68  Aligned_cols=49  Identities=16%  Similarity=0.443  Sum_probs=33.1

Q ss_pred             eeecHHHHHhhcCCCcccccCcccccCcEEE---eCCCccccCCccccccccccC
Q psy10674         67 NVYCLRDYATMLDIPRCHACDELIFVNEYTL---AENKTFHVKHFCCYECDKELC  118 (138)
Q Consensus        67 ~~yC~~c~~~~~~~~~C~~C~~~I~~~~~~~---~~~~~~H~~CF~C~~C~~~l~  118 (138)
                      ..+|..|-....  ..|+.|+-+|.+..++.   -.|.-|-+-=| |..|+++++
T Consensus        28 eafcskcgeati--~qcp~csasirgd~~vegvlglg~dye~psf-chncgs~fp   79 (160)
T COG4306          28 EAFCSKCGEATI--TQCPICSASIRGDYYVEGVLGLGGDYEPPSF-CHNCGSRFP   79 (160)
T ss_pred             HHHHhhhchHHH--hcCCccCCcccccceeeeeeccCCCCCCcch-hhcCCCCCC
Confidence            346777766655  58999999998765554   45566665533 777877765


No 57 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=62.67  E-value=8.3  Score=18.99  Aligned_cols=25  Identities=24%  Similarity=0.491  Sum_probs=12.7

Q ss_pred             CCeeecHHHHHhhcC--CCcccccCcc
Q psy10674         65 KGNVYCLRDYATMLD--IPRCHACDEL   89 (138)
Q Consensus        65 ~~~~yC~~c~~~~~~--~~~C~~C~~~   89 (138)
                      =+-.+|..|..+.+.  ..+|+.|+..
T Consensus        18 C~H~~c~~C~~~~~~~~~~~Cp~C~~~   44 (45)
T cd00162          18 CGHVFCRSCIDKWLKSGKNTCPLCRTP   44 (45)
T ss_pred             CCChhcHHHHHHHHHhCcCCCCCCCCc
Confidence            345566666543321  2357666654


No 58 
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein. Putative zinc-binding domain present in dystrophin-like proteins,  and CREB-binding protein/p300 homologues. The ZZ in dystrophin appears to bind calmodulin. A missense mutation of one of the conserved cysteines in dystrophin results in a patient with Duchenne muscular dystrophy [3].
Probab=62.28  E-value=9.2  Score=19.82  Aligned_cols=29  Identities=24%  Similarity=0.525  Sum_probs=14.1

Q ss_pred             ccccCCccccCCceee--eCCeeecHHHHHh
Q psy10674         48 VCSTCDELLVDLMYFH--YKGNVYCLRDYAT   76 (138)
Q Consensus        48 ~C~~C~~~l~~~~~~~--~~~~~yC~~c~~~   76 (138)
                      .|..|++++.+..|.=  =.+--+|..||.+
T Consensus         6 ~C~~C~~~i~g~ry~C~~C~d~dlC~~Cf~~   36 (44)
T smart00291        6 SCDTCGKPIVGVRYHCLVCPDYDLCQSCFAK   36 (44)
T ss_pred             CCCCCCCCCcCCEEECCCCCCccchHHHHhC
Confidence            4555555554433311  1234467777754


No 59 
>PRK00420 hypothetical protein; Validated
Probab=59.96  E-value=4.1  Score=26.01  Aligned_cols=23  Identities=26%  Similarity=0.468  Sum_probs=12.4

Q ss_pred             cccccCCccccCCceeeeCCeeecHHH
Q psy10674         47 FVCSTCDELLVDLMYFHYKGNVYCLRD   73 (138)
Q Consensus        47 f~C~~C~~~l~~~~~~~~~~~~yC~~c   73 (138)
                      -.|..|+.+|    |-.++|+.||..|
T Consensus        24 ~~CP~Cg~pL----f~lk~g~~~Cp~C   46 (112)
T PRK00420         24 KHCPVCGLPL----FELKDGEVVCPVH   46 (112)
T ss_pred             CCCCCCCCcc----eecCCCceECCCC
Confidence            3466777665    2225555555444


No 60 
>KOG1813|consensus
Probab=59.61  E-value=6  Score=29.57  Aligned_cols=45  Identities=16%  Similarity=0.323  Sum_probs=33.5

Q ss_pred             cccccCCccccCCceeeeCCeeecHHHHHhhcC-CCcccccCccccc
Q psy10674         47 FVCSTCDELLVDLMYFHYKGNVYCLRDYATMLD-IPRCHACDELIFV   92 (138)
Q Consensus        47 f~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~-~~~C~~C~~~I~~   92 (138)
                      |.|.+|.+.+.. +....-+..+|+.|..+.+- .++|..|++.+.+
T Consensus       242 f~c~icr~~f~~-pVvt~c~h~fc~~ca~~~~qk~~~c~vC~~~t~g  287 (313)
T KOG1813|consen  242 FKCFICRKYFYR-PVVTKCGHYFCEVCALKPYQKGEKCYVCSQQTHG  287 (313)
T ss_pred             cccccccccccc-chhhcCCceeehhhhccccccCCcceeccccccc
Confidence            788888887743 34456678899999876552 2799999999865


No 61 
>PF04570 DUF581:  Protein of unknown function (DUF581);  InterPro: IPR007650 This is a family of uncharacterised proteins.
Probab=59.36  E-value=6.4  Score=22.04  Aligned_cols=9  Identities=56%  Similarity=1.246  Sum_probs=4.5

Q ss_pred             ccccccccC
Q psy10674        110 CYECDKELC  118 (138)
Q Consensus       110 C~~C~~~l~  118 (138)
                      |..|++.|.
T Consensus        19 C~~C~k~L~   27 (58)
T PF04570_consen   19 CYLCKKKLD   27 (58)
T ss_pred             HHccCCCCC
Confidence            444555554


No 62 
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=58.61  E-value=6.4  Score=26.08  Aligned_cols=22  Identities=32%  Similarity=0.732  Sum_probs=11.1

Q ss_pred             ccccCCccccCCceeeeCCeeecHHHHH
Q psy10674         48 VCSTCDELLVDLMYFHYKGNVYCLRDYA   75 (138)
Q Consensus        48 ~C~~C~~~l~~~~~~~~~~~~yC~~c~~   75 (138)
                      .|..|++.+..      .++.+|..|+.
T Consensus         5 nC~~CgklF~~------~~~~iCp~C~~   26 (137)
T TIGR03826         5 NCPKCGRLFVK------TGRDVCPSCYE   26 (137)
T ss_pred             cccccchhhhh------cCCccCHHHhH
Confidence            45556554321      24456666663


No 63 
>smart00704 ZnF_CDGSH CDGSH-type zinc finger. Function unknown.
Probab=57.32  E-value=6.3  Score=20.01  Aligned_cols=7  Identities=29%  Similarity=0.192  Sum_probs=5.4

Q ss_pred             CCCccCC
Q psy10674        128 SRPGQDS  134 (138)
Q Consensus       128 ~~~y~~~  134 (138)
                      ++||||-
T Consensus        24 ~~PfCDG   30 (38)
T smart00704       24 NFPYCDG   30 (38)
T ss_pred             CCCccCC
Confidence            7888883


No 64 
>COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion]
Probab=57.31  E-value=3.7  Score=28.98  Aligned_cols=31  Identities=23%  Similarity=0.393  Sum_probs=24.9

Q ss_pred             cccccCCccccCCceeeeCCeeecHHHHHhh
Q psy10674         47 FVCSTCDELLVDLMYFHYKGNVYCLRDYATM   77 (138)
Q Consensus        47 f~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~   77 (138)
                      -+|+.|+..+....-...+|++.|..|+.+.
T Consensus       173 v~C~kCGE~~~e~~~~~~ng~~vC~~C~~~~  203 (206)
T COG2191         173 VRCSKCGELFMEPRAVVLNGKPVCKPCAEKK  203 (206)
T ss_pred             eeccccCcccccchhhhcCCceecccccccc
Confidence            5799999988666666789999999998643


No 65 
>KOG3002|consensus
Probab=56.37  E-value=11  Score=28.34  Aligned_cols=44  Identities=18%  Similarity=0.352  Sum_probs=36.3

Q ss_pred             CcccccCCccccCCceeeeCCeeecHHHHHhhcCCCcccccCcccc
Q psy10674         46 CFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIF   91 (138)
Q Consensus        46 Cf~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~~~~C~~C~~~I~   91 (138)
                      =+-|.+|...|....+.-.+|-+.|..|-.++.  .+|+.|..+|.
T Consensus        48 lleCPvC~~~l~~Pi~QC~nGHlaCssC~~~~~--~~CP~Cr~~~g   91 (299)
T KOG3002|consen   48 LLDCPVCFNPLSPPIFQCDNGHLACSSCRTKVS--NKCPTCRLPIG   91 (299)
T ss_pred             hccCchhhccCcccceecCCCcEehhhhhhhhc--ccCCccccccc
Confidence            366788888887666777899999999987765  69999999995


No 66 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=56.18  E-value=23  Score=17.52  Aligned_cols=30  Identities=23%  Similarity=0.436  Sum_probs=17.8

Q ss_pred             cccCCccccCCceeeeCCeeecHHHHHhhc
Q psy10674         49 CSTCDELLVDLMYFHYKGNVYCLRDYATML   78 (138)
Q Consensus        49 C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~   78 (138)
                      |..|...+.+......=|-.||..|..+.+
T Consensus         1 C~iC~~~~~~~~~~~~CGH~fC~~C~~~~~   30 (39)
T PF13923_consen    1 CPICLDELRDPVVVTPCGHSFCKECIEKYL   30 (39)
T ss_dssp             ETTTTSB-SSEEEECTTSEEEEHHHHHHHH
T ss_pred             CCCCCCcccCcCEECCCCCchhHHHHHHHH
Confidence            455656554422345667888888876543


No 67 
>PF11571 Med27:  Mediator complex subunit 27;  InterPro: IPR021627  Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function []. Mediator exists in two major forms in human cells: a smaller form that interacts strongly with pol II and activates transcription, and a large form that does not interact strongly with pol II and does not directly activate transcription. The ubiquitous expression of Med27 mRNA suggests a universal requirement for Med27 in transcriptional initiation. Loss of Crsp34/Med27 decreases amacrine cell number, but increases the number of rod photoreceptor cells []. 
Probab=55.55  E-value=6.5  Score=23.90  Aligned_cols=16  Identities=25%  Similarity=0.858  Sum_probs=13.0

Q ss_pred             HHhhcCCCcccccCccc
Q psy10674         74 YATMLDIPRCHACDELI   90 (138)
Q Consensus        74 ~~~~~~~~~C~~C~~~I   90 (138)
                      |..++ +..|.+|++.+
T Consensus        49 Y~~lf-s~pC~~C~klL   64 (90)
T PF11571_consen   49 YRNLF-STPCKKCGKLL   64 (90)
T ss_pred             Hhhhc-cchhhHHHhHh
Confidence            45667 57999999988


No 68 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=55.38  E-value=16  Score=18.71  Aligned_cols=40  Identities=18%  Similarity=0.491  Sum_probs=20.8

Q ss_pred             cccCCcccc-C-CceeeeCCeeecHHHHHhhc-CCCcccccCc
Q psy10674         49 CSTCDELLV-D-LMYFHYKGNVYCLRDYATML-DIPRCHACDE   88 (138)
Q Consensus        49 C~~C~~~l~-~-~~~~~~~~~~yC~~c~~~~~-~~~~C~~C~~   88 (138)
                      |..|...+. . ..+...=|-++|..|..+.. ....|+.|++
T Consensus         2 C~~C~~~~~~~~~~~l~~CgH~~C~~C~~~~~~~~~~CP~C~k   44 (44)
T PF14634_consen    2 CNICFEKYSEERRPRLTSCGHIFCEKCLKKLKGKSVKCPICRK   44 (44)
T ss_pred             CcCcCccccCCCCeEEcccCCHHHHHHHHhhcCCCCCCcCCCC
Confidence            445555541 1 22223445667777776654 1247777753


No 69 
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the PF04564 U-box:  U-box domain;  InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis. Molecular chaperones recognise and contribute to the refolding of misfolded or unfolded proteins, whereas the ubiquitin-proteasome system mediates the degradation of such abnormal proteins. Ubiquitin-protein ligases (E3s) determine the substrate specificity for ubiquitylation and have been classified into HECT and RING-finger families. More recently, however, U-box proteins, which contain a domain (the U box) of about 70 amino acids that is conserved from yeast to humans, have been identified as a new type of E3 []. Members of the U-box family of proteins constitute a class of ubiquitin-protein ligases (E3s) distinct from the HECT-type and RING finger-containing E3 families []. Using yeast two-hybrid technology, all mammalian U-box proteins have been reported to interact with molecular chaperones or co-chaperones, including Hsp90, Hsp70, DnaJc7, EKN1, CRN, and VCP. This suggests that the function of U box-type E3s is to mediate the degradation of unfolded or misfolded proteins in conjunction with molecular chaperones as receptors that recognise such abnormal proteins [, ]. Unlike the RING finger domain, IPR001841 from INTERPRO, that is stabilised by Zn2+ ions coordinated by the cysteines and a histidine, the U-box scaffold is probably stabilised by a system of salt-bridges and hydrogen bonds. The charged and polar residues that participate in this network of bonds are more strongly conserved in the U-box proteins than in classic RING fingers, which supports their role in maintaining the stability of the U box. Thus, the U box appears to have evolved from a RING finger domain by appropriation of a new set of residues required to stabilise its structure, concomitant with the loss of the original, metal-chelating residues [].; GO: 0004842 ubiquitin-protein ligase activity, 0016567 protein ubiquitination, 0000151 ubiquitin ligase complex; PDB: 1T1H_A 2C2L_D 2C2V_V 1WGM_A 2KR4_A 3L1Z_B 3L1X_A 2KRE_A 3M63_A 2QIZ_A ....
Probab=54.31  E-value=30  Score=19.89  Aligned_cols=51  Identities=16%  Similarity=0.164  Sum_probs=32.3

Q ss_pred             cCcccccCCccccCCceeeeCCeeecHHHHHhhcC--CCcccccCcccccCcEE
Q psy10674         45 QCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLD--IPRCHACDELIFVNEYT   96 (138)
Q Consensus        45 ~Cf~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~--~~~C~~C~~~I~~~~~~   96 (138)
                      +=|.|..++..+.+ ......|..|.+....+.+.  ...|..++.+|...+++
T Consensus         3 ~~f~CpIt~~lM~d-PVi~~~G~tyer~~I~~~l~~~~~~~P~t~~~l~~~~l~   55 (73)
T PF04564_consen    3 DEFLCPITGELMRD-PVILPSGHTYERSAIERWLEQNGGTDPFTRQPLSESDLI   55 (73)
T ss_dssp             GGGB-TTTSSB-SS-EEEETTSEEEEHHHHHHHHCTTSSB-TTT-SB-SGGGSE
T ss_pred             cccCCcCcCcHhhC-ceeCCcCCEEcHHHHHHHHHcCCCCCCCCCCcCCcccce
Confidence            44788888887755 46667889999887755442  25799998888765544


No 71 
>PF00569 ZZ:  Zinc finger, ZZ type;  InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZZ-type zinc finger domains, named because of their ability to bind two zinc ions []. These domains contain 4-6 Cys residues that participate in zinc binding (plus additional Ser/His residues), including a Cys-X2-Cys motif found in other zinc finger domains. These zinc fingers are thought to be involved in protein-protein interactions. The structure of the ZZ domain shows that it belongs to the family of cross-brace zinc finger motifs that include the PHD, RING, and FYVE domains []. ZZ-type zinc finger domains are found in:   Transcription factors P300 and CBP. Plant proteins involved in light responses, such as Hrb1. E3 ubiquitin ligases MEX and MIB2 (6.3.2 from EC). Dystrophin and its homologues.   Single copies of the ZZ zinc finger occur in the transcriptional adaptor/coactivator proteins P300, in cAMP response element-binding protein (CREB)-binding protein (CBP) and ADA2. CBP provides several binding sites for transcriptional coactivators. The site of interaction with the tumour suppressor protein p53 and the oncoprotein E1A with CBP/P300 is a Cys-rich region that incorporates two zinc-binding motifs: ZZ-type and TAZ2-type. The ZZ-type zinc finger of CBP contains two twisted anti-parallel beta-sheets and a short alpha-helix, and binds two zinc ions []. One zinc ion is coordinated by four cysteine residues via 2 Cys-X2-Cys motifs, and the third zinc ion via a third Cys-X-Cys motif and a His-X-His motif. The first zinc cluster is strictly conserved, whereas the second zinc cluster displays variability in the position of the two His residues. In Arabidopsis thaliana (Mouse-ear cress), the hypersensitive to red and blue 1 (Hrb1) protein, which regulating both red and blue light responses, contains a ZZ-type zinc finger domain [].  ZZ-type zinc finger domains have also been identified in the testis-specific E3 ubiquitin ligase MEX that promotes death receptor-induced apoptosis []. MEX has four putative zinc finger domains: one ZZ-type, one SWIM-type and two RING-type. The region containing the ZZ-type and RING-type zinc fingers is required for interaction with UbcH5a and MEX self-association, whereas the SWIM domain was critical for MEX ubiquitination. In addition, the Cys-rich domains of dystrophin, utrophin and an 87kDa post-synaptic protein contain a ZZ-type zinc finger with high sequence identity to P300/CBP ZZ-type zinc fingers. In dystrophin and utrophin, the ZZ-type zinc finger lies between a WW domain (flanked by and EF hand) and the C-terminal coiled-coil domain. Dystrophin is thought to act as a link between the actin cytoskeleton and the extracellular matrix, and perturbations of the dystrophin-associated complex, for example, between dystrophin and the transmembrane glycoprotein beta-dystroglycan, may lead to muscular dystrophy. Dystrophin and its autosomal homologue utrophin interact with beta-dystroglycan via their C-terminal regions, which are comprised of a WW domain, an EF hand domain and a ZZ-type zinc finger domain []. The WW domain is the primary site of interaction between dystrophin or utrophin and dystroglycan, while the EF hand and ZZ-type zinc finger domains stabilise and strengthen this interaction.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1TOT_A 2DIP_A 2FC7_A 2E5R_A.
Probab=53.50  E-value=19  Score=18.83  Aligned_cols=11  Identities=9%  Similarity=0.223  Sum_probs=7.5

Q ss_pred             CeeecHHHHHh
Q psy10674         66 GNVYCLRDYAT   76 (138)
Q Consensus        66 ~~~yC~~c~~~   76 (138)
                      +--+|..||.+
T Consensus        27 d~dLC~~C~~~   37 (46)
T PF00569_consen   27 DYDLCEDCFSK   37 (46)
T ss_dssp             S-EEEHHHHHH
T ss_pred             CCchhhHHHhC
Confidence            45588888876


No 72 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=53.34  E-value=3.4  Score=19.50  Aligned_cols=11  Identities=27%  Similarity=0.585  Sum_probs=6.0

Q ss_pred             CcccccCcccc
Q psy10674         81 PRCHACDELIF   91 (138)
Q Consensus        81 ~~C~~C~~~I~   91 (138)
                      .+|..|...|.
T Consensus         2 ~~C~rC~~~~~   12 (30)
T PF06827_consen    2 EKCPRCWNYIE   12 (30)
T ss_dssp             SB-TTT--BBE
T ss_pred             CcCccCCCcce
Confidence            57888888874


No 73 
>PF12855 Ecl1:  Life-span regulatory factor;  InterPro: IPR024368  The fungal proteins in this entry are involved in the regulation of chronological life-span [, ]. Overexpression of these proteins has been shown to extend the chronological life-span of wild-type strains. The mechanism by which this happens is not known, but microarray data suggests that they may function as pleiptropic stress regulators.
Probab=53.25  E-value=7  Score=20.47  Aligned_cols=20  Identities=20%  Similarity=0.365  Sum_probs=12.1

Q ss_pred             ccccccccCCCCeeecCCCCCccCC
Q psy10674        110 CYECDKELCNQSYIPVTESRPGQDS  134 (138)
Q Consensus       110 C~~C~~~l~~~~f~~~~~~~~y~~~  134 (138)
                      |..|.+.+..     ..++.+|||.
T Consensus         9 C~~Cdk~~~~-----~~~~~lYCSe   28 (43)
T PF12855_consen    9 CIVCDKQIDP-----PDDGSLYCSE   28 (43)
T ss_pred             HHHhhccccC-----CCCCccccCH
Confidence            5556666543     3347888874


No 74 
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=52.62  E-value=14  Score=19.33  Aligned_cols=26  Identities=15%  Similarity=0.282  Sum_probs=11.8

Q ss_pred             ccccCcccccCcEEE--eCCCccccCCc
Q psy10674         83 CHACDELIFVNEYTL--AENKTFHVKHF  108 (138)
Q Consensus        83 C~~C~~~I~~~~~~~--~~~~~~H~~CF  108 (138)
                      |..|++.-.++.++.  .=++.||..|.
T Consensus         2 C~vC~~~~~~~~~i~C~~C~~~~H~~C~   29 (51)
T PF00628_consen    2 CPVCGQSDDDGDMIQCDSCNRWYHQECV   29 (51)
T ss_dssp             BTTTTSSCTTSSEEEBSTTSCEEETTTS
T ss_pred             CcCCCCcCCCCCeEEcCCCChhhCcccC
Confidence            445555333334443  22455565543


No 75 
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=51.21  E-value=5.8  Score=28.02  Aligned_cols=46  Identities=15%  Similarity=0.356  Sum_probs=33.7

Q ss_pred             cccccCCccccCCceeeeCCeeecHHHHHhhc-CCCcccccCcccccC
Q psy10674         47 FVCSTCDELLVDLMYFHYKGNVYCLRDYATML-DIPRCHACDELIFVN   93 (138)
Q Consensus        47 f~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~-~~~~C~~C~~~I~~~   93 (138)
                      |.|..|++.... +....=|..+|..|+.+.+ ..+.|..|++...+.
T Consensus       197 F~C~iCKkdy~s-pvvt~CGH~FC~~Cai~~y~kg~~C~~Cgk~t~G~  243 (259)
T COG5152         197 FLCGICKKDYES-PVVTECGHSFCSLCAIRKYQKGDECGVCGKATYGR  243 (259)
T ss_pred             eeehhchhhccc-hhhhhcchhHHHHHHHHHhccCCcceecchhhccc
Confidence            788999887643 3445667889999997654 237999999887654


No 76 
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit
Probab=50.45  E-value=13  Score=32.74  Aligned_cols=25  Identities=16%  Similarity=0.243  Sum_probs=14.7

Q ss_pred             CeeecHHHHH--hhcCCCcccccCccc
Q psy10674         66 GNVYCLRDYA--TMLDIPRCHACDELI   90 (138)
Q Consensus        66 ~~~yC~~c~~--~~~~~~~C~~C~~~I   90 (138)
                      +-+.|+.||+  +.-|...|++|+..-
T Consensus        43 ~FPVCrpCYEYEr~eG~q~CPqCktrY   69 (1079)
T PLN02638         43 AFPVCRPCYEYERKDGNQSCPQCKTKY   69 (1079)
T ss_pred             CCccccchhhhhhhcCCccCCccCCch
Confidence            3456666662  344556777777643


No 77 
>cd02335 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present in ADA2, a putative transcriptional adaptor, and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=47.56  E-value=22  Score=18.83  Aligned_cols=9  Identities=22%  Similarity=0.615  Sum_probs=4.9

Q ss_pred             eecHHHHHh
Q psy10674         68 VYCLRDYAT   76 (138)
Q Consensus        68 ~yC~~c~~~   76 (138)
                      -+|..||..
T Consensus        25 dLC~~Cf~~   33 (49)
T cd02335          25 DLCLECFSA   33 (49)
T ss_pred             chhHHhhhC
Confidence            356666543


No 78 
>PF14570 zf-RING_4:  RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B.
Probab=47.06  E-value=26  Score=18.76  Aligned_cols=24  Identities=33%  Similarity=0.589  Sum_probs=11.5

Q ss_pred             CeeecHHHHHhhcC--CCcccccCcc
Q psy10674         66 GNVYCLRDYATMLD--IPRCHACDEL   89 (138)
Q Consensus        66 ~~~yC~~c~~~~~~--~~~C~~C~~~   89 (138)
                      +--+|..||.+...  .-+|++|.++
T Consensus        21 gf~IC~~C~~~i~~~~~g~CPgCr~~   46 (48)
T PF14570_consen   21 GFQICRFCYHDILENEGGRCPGCREP   46 (48)
T ss_dssp             S----HHHHHHHTTSS-SB-TTT--B
T ss_pred             CCcHHHHHHHHHHhccCCCCCCCCCC
Confidence            34578888876652  3589999875


No 79 
>PF04641 Rtf2:  Rtf2 RING-finger
Probab=46.06  E-value=52  Score=24.05  Aligned_cols=56  Identities=11%  Similarity=0.258  Sum_probs=41.5

Q ss_pred             cccCcccccCCccccCC-cee--eeCCeeecHHHHHhhcCCCcccccCcccccCcEEEe
Q psy10674         43 HPQCFVCSTCDELLVDL-MYF--HYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLA   98 (138)
Q Consensus        43 H~~Cf~C~~C~~~l~~~-~~~--~~~~~~yC~~c~~~~~~~~~C~~C~~~I~~~~~~~~   98 (138)
                      ...-|.|.+.++.|.+. .|.  ..-|-++......++-....|..|+++....++|..
T Consensus       110 ~~~~~~CPvt~~~~~~~~~fv~l~~cG~V~s~~alke~k~~~~Cp~c~~~f~~~DiI~L  168 (260)
T PF04641_consen  110 SEGRFICPVTGKEFNGKHKFVYLRPCGCVFSEKALKELKKSKKCPVCGKPFTEEDIIPL  168 (260)
T ss_pred             CCceeECCCCCcccCCceeEEEEcCCCCEeeHHHHHhhcccccccccCCccccCCEEEe
Confidence            45568899999999653 232  267889999888776413589999999987777753


No 80 
>KOG3476|consensus
Probab=46.04  E-value=2.9  Score=25.29  Aligned_cols=38  Identities=24%  Similarity=0.501  Sum_probs=27.4

Q ss_pred             cccccCCccccCCceeeeCCeeecHHHHHhhcCCCcccccCcccccC
Q psy10674         47 FVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVN   93 (138)
Q Consensus        47 f~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~~~~C~~C~~~I~~~   93 (138)
                      -+|..|...+.      ..|.-||..|..+.   -.|+-|++.|.+.
T Consensus        55 ~kC~iCk~~vH------Q~GshYC~tCAY~K---giCAMCGKki~nT   92 (100)
T KOG3476|consen   55 AKCRICKQLVH------QPGSHYCQTCAYKK---GICAMCGKKILNT   92 (100)
T ss_pred             chhHHHHHHhc------CCcchhHhHhhhhh---hHHHHhhhHhhcc
Confidence            45777766552      24567999998775   3899999999654


No 81 
>PLN02195 cellulose synthase A
Probab=44.87  E-value=19  Score=31.49  Aligned_cols=25  Identities=12%  Similarity=0.069  Sum_probs=17.9

Q ss_pred             eeecHHHH--HhhcCCCcccccCcccc
Q psy10674         67 NVYCLRDY--ATMLDIPRCHACDELIF   91 (138)
Q Consensus        67 ~~yC~~c~--~~~~~~~~C~~C~~~I~   91 (138)
                      -+.|+.||  ++.-|...|++|+..-.
T Consensus        33 ~pvCrpCyeyer~eg~q~CpqCkt~Yk   59 (977)
T PLN02195         33 YPLCKACLEYEIKEGRKVCLRCGGPYD   59 (977)
T ss_pred             CccccchhhhhhhcCCccCCccCCccc
Confidence            45677777  34556789999998776


No 82 
>KOG3579|consensus
Probab=44.83  E-value=12  Score=27.98  Aligned_cols=48  Identities=17%  Similarity=0.180  Sum_probs=34.1

Q ss_pred             CcccccCcccccCcEEEeCCCccccCCccccccccccCCCCeeecCCCCCccCC
Q psy10674         81 PRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELCNQSYIPVTESRPGQDS  134 (138)
Q Consensus        81 ~~C~~C~~~I~~~~~~~~~~~~~H~~CF~C~~C~~~l~~~~f~~~~~~~~y~~~  134 (138)
                      -.|.-|++.+.+..+|.--...-|.-||-|++  ..|..+    -..|..||-|
T Consensus       269 LcCTLC~ERLEDTHFVQCPSVp~HKFCFPCSR--esIK~Q----g~sgevYCPS  316 (352)
T KOG3579|consen  269 LCCTLCHERLEDTHFVQCPSVPSHKFCFPCSR--ESIKQQ----GASGEVYCPS  316 (352)
T ss_pred             eeehhhhhhhccCceeecCCCcccceecccCH--HHHHhh----cCCCceeCCC
Confidence            37888999998888888778888999999975  223221    1126777766


No 83 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=44.45  E-value=7  Score=16.75  Aligned_cols=12  Identities=25%  Similarity=0.722  Sum_probs=8.6

Q ss_pred             ccccccccccCC
Q psy10674        108 FCCYECDKELCN  119 (138)
Q Consensus       108 F~C~~C~~~l~~  119 (138)
                      |.|..|++.+..
T Consensus         1 y~C~~C~~~f~~   12 (23)
T PF00096_consen    1 YKCPICGKSFSS   12 (23)
T ss_dssp             EEETTTTEEESS
T ss_pred             CCCCCCCCccCC
Confidence            568888877653


No 84 
>KOG0978|consensus
Probab=44.17  E-value=6.6  Score=32.89  Aligned_cols=49  Identities=22%  Similarity=0.482  Sum_probs=28.5

Q ss_pred             cccccCCccccCCceeeeCCeeecHHHHHhhcCC--CcccccCcccccCcEE
Q psy10674         47 FVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDI--PRCHACDELIFVNEYT   96 (138)
Q Consensus        47 f~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~~--~~C~~C~~~I~~~~~~   96 (138)
                      .+|..|+....+ .....=+-+||..|-..++.+  -+|+.|+.+..+.++.
T Consensus       644 LkCs~Cn~R~Kd-~vI~kC~H~FC~~Cvq~r~etRqRKCP~Cn~aFganDv~  694 (698)
T KOG0978|consen  644 LKCSVCNTRWKD-AVITKCGHVFCEECVQTRYETRQRKCPKCNAAFGANDVH  694 (698)
T ss_pred             eeCCCccCchhh-HHHHhcchHHHHHHHHHHHHHhcCCCCCCCCCCCccccc
Confidence            456666654432 122244556777776554421  4888888888766654


No 85 
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=42.93  E-value=14  Score=17.27  Aligned_cols=11  Identities=45%  Similarity=0.779  Sum_probs=3.2

Q ss_pred             cccccCccccc
Q psy10674         82 RCHACDELIFV   92 (138)
Q Consensus        82 ~C~~C~~~I~~   92 (138)
                      .|..|++++.+
T Consensus         2 ~C~~C~~~~~~   12 (30)
T PF07649_consen    2 RCDACGKPIDG   12 (30)
T ss_dssp             --TTTS----S
T ss_pred             cCCcCCCcCCC
Confidence            46667776643


No 86 
>PF13834 DUF4193:  Domain of unknown function (DUF4193)
Probab=42.83  E-value=8.3  Score=24.00  Aligned_cols=29  Identities=14%  Similarity=0.228  Sum_probs=19.5

Q ss_pred             CCccccccccccCCCCeeecCCCCCccCC
Q psy10674        106 KHFCCYECDKELCNQSYIPVTESRPGQDS  134 (138)
Q Consensus       106 ~CF~C~~C~~~l~~~~f~~~~~~~~y~~~  134 (138)
                      +=|+|+.|--+-...+-....+|++||.-
T Consensus        69 DEFTCssCFLV~HRSqLa~~~~g~~iC~D   97 (99)
T PF13834_consen   69 DEFTCSSCFLVHHRSQLAREKDGQPICRD   97 (99)
T ss_pred             CceeeeeeeeEechhhhccccCCCEeccc
Confidence            45889998666554444555559999863


No 87 
>PLN02400 cellulose synthase
Probab=42.21  E-value=17  Score=32.04  Aligned_cols=44  Identities=14%  Similarity=0.293  Sum_probs=26.9

Q ss_pred             cccccCCccc----cCCceee--eCCeeecHHHHH--hhcCCCcccccCccc
Q psy10674         47 FVCSTCDELL----VDLMYFH--YKGNVYCLRDYA--TMLDIPRCHACDELI   90 (138)
Q Consensus        47 f~C~~C~~~l----~~~~~~~--~~~~~yC~~c~~--~~~~~~~C~~C~~~I   90 (138)
                      -.|++|+..+    .+..|..  .=+-|.|+.||+  ++-|...|++|+..-
T Consensus        37 qiCqICGD~VG~t~dGe~FVAC~eCaFPVCRpCYEYERkeGnq~CPQCkTrY   88 (1085)
T PLN02400         37 QICQICGDDVGVTETGDVFVACNECAFPVCRPCYEYERKDGTQCCPQCKTRY   88 (1085)
T ss_pred             ceeeecccccCcCCCCCEEEEEccCCCccccchhheecccCCccCcccCCcc
Confidence            3677787765    2223332  445678888873  344567888887643


No 88 
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=41.68  E-value=5.4  Score=19.62  Aligned_cols=17  Identities=18%  Similarity=0.669  Sum_probs=10.9

Q ss_pred             ccccccccccCCCCeee
Q psy10674        108 FCCYECDKELCNQSYIP  124 (138)
Q Consensus       108 F~C~~C~~~l~~~~f~~  124 (138)
                      |.|..|++++...+|..
T Consensus         5 ~~C~nC~R~v~a~RfA~   21 (33)
T PF08209_consen    5 VECPNCGRPVAASRFAP   21 (33)
T ss_dssp             EE-TTTSSEEEGGGHHH
T ss_pred             EECCCCcCCcchhhhHH
Confidence            45777777777666654


No 89 
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=41.41  E-value=7.1  Score=19.36  Aligned_cols=11  Identities=36%  Similarity=0.576  Sum_probs=4.9

Q ss_pred             ccccccccccc
Q psy10674         14 FCCYECDKKVQ   24 (138)
Q Consensus        14 ~~C~~C~~~i~   24 (138)
                      +.|..|++++.
T Consensus         4 ~~C~eC~~~f~   14 (34)
T PF01286_consen    4 PKCDECGKPFM   14 (34)
T ss_dssp             EE-TTT--EES
T ss_pred             chHhHhCCHHH
Confidence            45666666665


No 90 
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=40.62  E-value=17  Score=18.98  Aligned_cols=10  Identities=30%  Similarity=0.757  Sum_probs=6.6

Q ss_pred             cccccCcccc
Q psy10674         82 RCHACDELIF   91 (138)
Q Consensus        82 ~C~~C~~~I~   91 (138)
                      .|..|+++|.
T Consensus         2 ~C~~C~~~i~   11 (46)
T cd02249           2 SCDGCLKPIV   11 (46)
T ss_pred             CCcCCCCCCc
Confidence            4777777664


No 91 
>KOG2893|consensus
Probab=40.47  E-value=7.3  Score=28.35  Aligned_cols=11  Identities=55%  Similarity=1.123  Sum_probs=5.3

Q ss_pred             Ccccccccccc
Q psy10674        107 HFCCYECDKEL  117 (138)
Q Consensus       107 CF~C~~C~~~l  117 (138)
                      +|+|.+|.+.|
T Consensus        34 hfkchichkkl   44 (341)
T KOG2893|consen   34 HFKCHICHKKL   44 (341)
T ss_pred             cceeeeehhhh
Confidence            45555554443


No 92 
>KOG3579|consensus
Probab=40.31  E-value=14  Score=27.62  Aligned_cols=48  Identities=27%  Similarity=0.580  Sum_probs=31.5

Q ss_pred             CcccccccccccCCCeEEEeccccCCCCCCcccCcccccCCccccCCceeeeCCeeecH
Q psy10674         13 HFCCYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCL   71 (138)
Q Consensus        13 ~~~C~~C~~~i~~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~yC~   71 (138)
                      .+.|..|++.|++.-|+..-      ...-|+-||-|+.=  .|..   ....+.+||.
T Consensus       268 pLcCTLC~ERLEDTHFVQCP------SVp~HKFCFPCSRe--sIK~---Qg~sgevYCP  315 (352)
T KOG3579|consen  268 PLCCTLCHERLEDTHFVQCP------SVPSHKFCFPCSRE--SIKQ---QGASGEVYCP  315 (352)
T ss_pred             ceeehhhhhhhccCceeecC------CCcccceecccCHH--HHHh---hcCCCceeCC
Confidence            36799999999988777543      22678889987632  2211   1234578885


No 93 
>KOG3896|consensus
Probab=39.14  E-value=13  Score=28.54  Aligned_cols=37  Identities=24%  Similarity=0.284  Sum_probs=27.8

Q ss_pred             CCcccccCcccccCcEEEeCCCccccCCccccccccccC
Q psy10674         80 IPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELC  118 (138)
Q Consensus        80 ~~~C~~C~~~I~~~~~~~~~~~~~H~~CF~C~~C~~~l~  118 (138)
                      +..|..|-+.+...+..  ..+.-..+||.|..|...|+
T Consensus        45 shfCp~CLEn~ps~EAr--lKKn~CAnCfDCP~C~htLS   81 (449)
T KOG3896|consen   45 SHFCPRCLENSPSPEAR--LKKNKCANCFDCPKCAHTLS   81 (449)
T ss_pred             cccchhhccCCCchHHH--hhhccccccccCcchhhhhh
Confidence            35888898888654432  34556789999999998887


No 94 
>PHA02610 uvsY.-2 hypothetical protein; Provisional
Probab=38.90  E-value=27  Score=19.02  Aligned_cols=25  Identities=20%  Similarity=0.238  Sum_probs=15.6

Q ss_pred             CcccccCcccccCcEEEeCCCcccc
Q psy10674         81 PRCHACDELIFVNEYTLAENKTFHV  105 (138)
Q Consensus        81 ~~C~~C~~~I~~~~~~~~~~~~~H~  105 (138)
                      .+|..|++||.....+......-|+
T Consensus         2 ~iCvvCK~Pi~~al~v~T~~Gpvh~   26 (53)
T PHA02610          2 KICVVCKQPIEKALVVETEKGPVHP   26 (53)
T ss_pred             ceeeeeCCchhhceEEecCCCCCCC
Confidence            3788999999554444344455554


No 95 
>PF12156 ATPase-cat_bd:  Putative metal-binding domain of cation transport ATPase;  InterPro: IPR021993  This domain is found in bacteria, and is approximately 90 amino acids in length. It is found associated with PF00403 from PFAM, PF00122 from PFAM, PF00702 from PFAM. The cysteine-rich nature and composition suggest this might be a cation-binding domain; most members are annotated as being cation transport ATPases. 
Probab=38.74  E-value=12  Score=22.61  Aligned_cols=33  Identities=21%  Similarity=0.609  Sum_probs=20.6

Q ss_pred             cccccCcccccCc-EEE-eCCCccccCCcccccccccc
Q psy10674         82 RCHACDELIFVNE-YTL-AENKTFHVKHFCCYECDKEL  117 (138)
Q Consensus        82 ~C~~C~~~I~~~~-~~~-~~~~~~H~~CF~C~~C~~~l  117 (138)
                      .|..|+.+|..+. +.. ..|..   .=|.|..|..+.
T Consensus         2 ~C~HCg~~~p~~~~~~~~~~g~~---~~FCC~GC~~V~   36 (88)
T PF12156_consen    2 KCYHCGLPVPEGAKITVEIDGEE---RPFCCPGCQAVY   36 (88)
T ss_pred             CCCCCCCCCCCCCCeeeeeCCCc---cccccHHHHHHH
Confidence            6889999996433 322 44543   336788887653


No 96 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=38.58  E-value=21  Score=16.40  Aligned_cols=9  Identities=22%  Similarity=0.818  Sum_probs=5.0

Q ss_pred             cccccCccc
Q psy10674         82 RCHACDELI   90 (138)
Q Consensus        82 ~C~~C~~~I   90 (138)
                      .|+.|+..|
T Consensus         2 ~CP~C~~~V   10 (26)
T PF10571_consen    2 TCPECGAEV   10 (26)
T ss_pred             cCCCCcCCc
Confidence            455555555


No 97 
>cd02342 ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger present in plant ubiquitin-associated (UBA) proteins. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=37.86  E-value=35  Score=17.84  Aligned_cols=29  Identities=14%  Similarity=0.295  Sum_probs=13.4

Q ss_pred             ccccCCc-cccCCceee--eCCeeecHHHHHh
Q psy10674         48 VCSTCDE-LLVDLMYFH--YKGNVYCLRDYAT   76 (138)
Q Consensus        48 ~C~~C~~-~l~~~~~~~--~~~~~yC~~c~~~   76 (138)
                      .|..|+. |+.+..|.-  -.+--+|+.||.+
T Consensus         2 ~CDgCg~~PI~G~RykC~~C~dyDLC~~C~~~   33 (43)
T cd02342           2 QCDGCGVLPITGPRYKSKVKEDYDLCTICFSR   33 (43)
T ss_pred             CCCCCCCCcccccceEeCCCCCCccHHHHhhh
Confidence            3555654 454443321  2233356666544


No 98 
>PLN02436 cellulose synthase A
Probab=37.61  E-value=26  Score=31.07  Aligned_cols=44  Identities=14%  Similarity=0.246  Sum_probs=26.8

Q ss_pred             cccccCCccc----cCCceee--eCCeeecHHHHH--hhcCCCcccccCccc
Q psy10674         47 FVCSTCDELL----VDLMYFH--YKGNVYCLRDYA--TMLDIPRCHACDELI   90 (138)
Q Consensus        47 f~C~~C~~~l----~~~~~~~--~~~~~yC~~c~~--~~~~~~~C~~C~~~I   90 (138)
                      -.|++|+..+    .+..|..  .=+-+.|+.||+  +.-|...|++|+..-
T Consensus        37 ~iCqICGD~Vg~t~dGe~FVACn~C~fpvCr~Cyeyer~eg~~~Cpqckt~Y   88 (1094)
T PLN02436         37 QTCQICGDEIELTVDGEPFVACNECAFPVCRPCYEYERREGNQACPQCKTRY   88 (1094)
T ss_pred             ccccccccccCcCCCCCEEEeeccCCCccccchhhhhhhcCCccCcccCCch
Confidence            3677777765    2222322  345677888873  334567888888754


No 99 
>PF05502 Dynactin_p62:  Dynactin p62 family;  InterPro: IPR008603 Dynactin is a multi-subunit complex and a required cofactor for most, or all, o f the cellular processes powered by the microtubule-based motor cytoplasmic dyn ein. p62 binds directly to the Arp1 subunit of dynactin [, ].
Probab=37.49  E-value=20  Score=28.86  Aligned_cols=36  Identities=22%  Similarity=0.300  Sum_probs=19.7

Q ss_pred             cccccCcccccCcEEEeCCCccccCCccccccccccC
Q psy10674         82 RCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELC  118 (138)
Q Consensus        82 ~C~~C~~~I~~~~~~~~~~~~~H~~CF~C~~C~~~l~  118 (138)
                      .|+.|-..+...++. +.+..=-.+||.|..|..+|.
T Consensus        28 yCp~CL~~~p~~e~~-~~~nrC~r~Cf~CP~C~~~L~   63 (483)
T PF05502_consen   28 YCPNCLFEVPSSEAR-SEKNRCSRNCFDCPICFSPLS   63 (483)
T ss_pred             ECccccccCChhhhe-eccceeccccccCCCCCCcce
Confidence            555555555433322 222222337888888888776


No 100
>KOG2462|consensus
Probab=37.47  E-value=12  Score=27.72  Aligned_cols=33  Identities=21%  Similarity=0.577  Sum_probs=18.5

Q ss_pred             CcccccCcccccCcEE------E-eCCCccccCCccccccccccCC
Q psy10674         81 PRCHACDELIFVNEYT------L-AENKTFHVKHFCCYECDKELCN  119 (138)
Q Consensus        81 ~~C~~C~~~I~~~~~~------~-~~~~~~H~~CF~C~~C~~~l~~  119 (138)
                      -.|..|++... +.++      . ...+.     |.|..|++.|.+
T Consensus       188 c~C~iCGKaFS-RPWLLQGHiRTHTGEKP-----F~C~hC~kAFAD  227 (279)
T KOG2462|consen  188 CECGICGKAFS-RPWLLQGHIRTHTGEKP-----FSCPHCGKAFAD  227 (279)
T ss_pred             ccccccccccc-chHHhhcccccccCCCC-----ccCCcccchhcc
Confidence            36777777663 2221      1 22233     668888877764


No 101
>PF10080 DUF2318:  Predicted membrane protein (DUF2318);  InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function. 
Probab=36.98  E-value=23  Score=22.21  Aligned_cols=32  Identities=13%  Similarity=0.237  Sum_probs=22.9

Q ss_pred             CCcccCcccccCCccccCCceeeeCCeeecHHHHHh
Q psy10674         41 LWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYAT   76 (138)
Q Consensus        41 ~~H~~Cf~C~~C~~~l~~~~~~~~~~~~yC~~c~~~   76 (138)
                      .+...==.|..|    .+..|+.+++.+.|..|-.+
T Consensus        30 ~~~va~daCeiC----~~~GY~q~g~~lvC~~C~~~   61 (102)
T PF10080_consen   30 SYRVAFDACEIC----GPKGYYQEGDQLVCKNCGVR   61 (102)
T ss_pred             CEEEEEEecccc----CCCceEEECCEEEEecCCCE
Confidence            444444468888    35679999999999888643


No 102
>PLN02189 cellulose synthase
Probab=36.83  E-value=27  Score=30.79  Aligned_cols=45  Identities=18%  Similarity=0.335  Sum_probs=27.8

Q ss_pred             cccccCCcccc----CCceee--eCCeeecHHHHH--hhcCCCcccccCcccc
Q psy10674         47 FVCSTCDELLV----DLMYFH--YKGNVYCLRDYA--TMLDIPRCHACDELIF   91 (138)
Q Consensus        47 f~C~~C~~~l~----~~~~~~--~~~~~yC~~c~~--~~~~~~~C~~C~~~I~   91 (138)
                      -.|.+|+..++    +..|..  .=+-+.|+.||+  +.-|...|++|+..-.
T Consensus        35 ~~C~iCgd~vg~~~~g~~fvaC~~C~fpvCr~Cyeyer~eg~q~CpqCkt~Y~   87 (1040)
T PLN02189         35 QVCEICGDEIGLTVDGDLFVACNECGFPVCRPCYEYERREGTQNCPQCKTRYK   87 (1040)
T ss_pred             ccccccccccCcCCCCCEEEeeccCCCccccchhhhhhhcCCccCcccCCchh
Confidence            36778877762    223332  345678888874  3345678888887543


No 103
>PHA02929 N1R/p28-like protein; Provisional
Probab=36.47  E-value=21  Score=25.97  Aligned_cols=38  Identities=21%  Similarity=0.473  Sum_probs=22.6

Q ss_pred             CcccccCcccccCc-------EEEeCCCccccCCc--------cccccccccC
Q psy10674         81 PRCHACDELIFVNE-------YTLAENKTFHVKHF--------CCYECDKELC  118 (138)
Q Consensus        81 ~~C~~C~~~I~~~~-------~~~~~~~~~H~~CF--------~C~~C~~~l~  118 (138)
                      ..|+.|...+.+.+       ++..-+..||.+|.        .|..|..++.
T Consensus       175 ~eC~ICle~~~~~~~~~~~~~vl~~C~H~FC~~CI~~Wl~~~~tCPlCR~~~~  227 (238)
T PHA02929        175 KECAICMEKVYDKEIKNMYFGILSNCNHVFCIECIDIWKKEKNTCPVCRTPFI  227 (238)
T ss_pred             CCCccCCcccccCccccccceecCCCCCcccHHHHHHHHhcCCCCCCCCCEee
Confidence            46777777765432       11133566777776        4777776654


No 104
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=36.36  E-value=34  Score=18.02  Aligned_cols=10  Identities=30%  Similarity=0.969  Sum_probs=6.8

Q ss_pred             CcccccCccc
Q psy10674         81 PRCHACDELI   90 (138)
Q Consensus        81 ~~C~~C~~~I   90 (138)
                      ..|..|++.|
T Consensus        12 ~~C~~C~~~i   21 (53)
T PF00130_consen   12 TYCDVCGKFI   21 (53)
T ss_dssp             EB-TTSSSBE
T ss_pred             CCCcccCccc
Confidence            4777888777


No 105
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=36.02  E-value=14  Score=15.44  Aligned_cols=11  Identities=36%  Similarity=0.760  Sum_probs=5.9

Q ss_pred             ccccccccccC
Q psy10674        108 FCCYECDKELC  118 (138)
Q Consensus       108 F~C~~C~~~l~  118 (138)
                      |.|..|+..+.
T Consensus         1 ~~C~~C~~~~~   11 (24)
T PF13894_consen    1 FQCPICGKSFR   11 (24)
T ss_dssp             EE-SSTS-EES
T ss_pred             CCCcCCCCcCC
Confidence            56777777655


No 106
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=35.72  E-value=7.7  Score=19.83  Aligned_cols=27  Identities=22%  Similarity=0.278  Sum_probs=15.9

Q ss_pred             cccccCcccccCc-EEE-eCCCccccCCc
Q psy10674         82 RCHACDELIFVNE-YTL-AENKTFHVKHF  108 (138)
Q Consensus        82 ~C~~C~~~I~~~~-~~~-~~~~~~H~~CF  108 (138)
                      .|+.|.+.+.+++ ++. .=+..||.+|.
T Consensus         2 ~C~IC~~~~~~~~~~~~l~C~H~fh~~Ci   30 (44)
T PF13639_consen    2 ECPICLEEFEDGEKVVKLPCGHVFHRSCI   30 (44)
T ss_dssp             CETTTTCBHHTTSCEEEETTSEEEEHHHH
T ss_pred             CCcCCChhhcCCCeEEEccCCCeeCHHHH
Confidence            5778888885433 332 33566666654


No 107
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=35.12  E-value=24  Score=15.85  Aligned_cols=13  Identities=38%  Similarity=0.938  Sum_probs=9.7

Q ss_pred             ccccccccccCCC
Q psy10674        108 FCCYECDKELCNQ  120 (138)
Q Consensus       108 F~C~~C~~~l~~~  120 (138)
                      |.|..|++.+.+.
T Consensus         2 ~~C~~C~k~f~~~   14 (27)
T PF12171_consen    2 FYCDACDKYFSSE   14 (27)
T ss_dssp             CBBTTTTBBBSSH
T ss_pred             CCcccCCCCcCCH
Confidence            6688888887743


No 108
>PLN02915 cellulose synthase A [UDP-forming], catalytic subunit
Probab=34.66  E-value=31  Score=30.50  Aligned_cols=24  Identities=17%  Similarity=0.259  Sum_probs=12.6

Q ss_pred             eeecHHHHH--hhcCCCcccccCccc
Q psy10674         67 NVYCLRDYA--TMLDIPRCHACDELI   90 (138)
Q Consensus        67 ~~yC~~c~~--~~~~~~~C~~C~~~I   90 (138)
                      -+.|+.||+  +.-|...|++|+.+-
T Consensus        42 fpvCr~cyeye~~~g~~~cp~c~t~y   67 (1044)
T PLN02915         42 FPVCKPCYEYERSEGNQCCPQCNTRY   67 (1044)
T ss_pred             CccccchhhhhhhcCCccCCccCCch
Confidence            345555552  333455677776543


No 109
>COG0266 Nei Formamidopyrimidine-DNA glycosylase [DNA replication, recombination, and repair]
Probab=34.51  E-value=23  Score=26.35  Aligned_cols=11  Identities=27%  Similarity=0.588  Sum_probs=9.7

Q ss_pred             CcccccCcccc
Q psy10674         81 PRCHACDELIF   91 (138)
Q Consensus        81 ~~C~~C~~~I~   91 (138)
                      +.|..|+.+|.
T Consensus       246 epC~~CGt~I~  256 (273)
T COG0266         246 EPCRRCGTPIE  256 (273)
T ss_pred             CCCCccCCEeE
Confidence            68999999994


No 110
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=34.46  E-value=23  Score=18.93  Aligned_cols=10  Identities=30%  Similarity=0.750  Sum_probs=6.2

Q ss_pred             cccccCc-ccc
Q psy10674         82 RCHACDE-LIF   91 (138)
Q Consensus        82 ~C~~C~~-~I~   91 (138)
                      .|..|+. +|.
T Consensus         2 ~Cd~C~~~pI~   12 (48)
T cd02341           2 KCDSCGIEPIP   12 (48)
T ss_pred             CCCCCCCCccc
Confidence            4667776 664


No 111
>KOG4443|consensus
Probab=34.32  E-value=23  Score=29.51  Aligned_cols=22  Identities=23%  Similarity=0.338  Sum_probs=17.9

Q ss_pred             eCCCccccCCccccccccccCC
Q psy10674         98 AENKTFHVKHFCCYECDKELCN  119 (138)
Q Consensus        98 ~~~~~~H~~CF~C~~C~~~l~~  119 (138)
                      ..+..+-++|++|..|+..|.|
T Consensus       106 ~sg~~~ckk~~~c~qc~~~lpg  127 (694)
T KOG4443|consen  106 PSGPWLCKKCTRCRQCDSTLPG  127 (694)
T ss_pred             cCcccccHHHHhhhhccccccc
Confidence            4677778888999999888876


No 112
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=33.29  E-value=14  Score=16.08  Aligned_cols=12  Identities=33%  Similarity=0.905  Sum_probs=8.6

Q ss_pred             ccccccccccCC
Q psy10674        108 FCCYECDKELCN  119 (138)
Q Consensus       108 F~C~~C~~~l~~  119 (138)
                      |.|..|++.+.+
T Consensus         1 ~~C~~C~~~f~s   12 (25)
T PF12874_consen    1 FYCDICNKSFSS   12 (25)
T ss_dssp             EEETTTTEEESS
T ss_pred             CCCCCCCCCcCC
Confidence            568888877764


No 113
>PF14149 YhfH:  YhfH-like protein
Probab=32.71  E-value=14  Score=18.68  Aligned_cols=19  Identities=21%  Similarity=0.398  Sum_probs=13.6

Q ss_pred             HHhhcCCCcccccCccccc
Q psy10674         74 YATMLDIPRCHACDELIFV   92 (138)
Q Consensus        74 ~~~~~~~~~C~~C~~~I~~   92 (138)
                      |.+.+....|..|++.|..
T Consensus         7 FfrnLp~K~C~~CG~~i~E   25 (37)
T PF14149_consen    7 FFRNLPPKKCTECGKEIEE   25 (37)
T ss_pred             HHHhCCCcccHHHHHHHHH
Confidence            4444556799999999853


No 114
>PLN03123 poly [ADP-ribose] polymerase; Provisional
Probab=32.11  E-value=34  Score=30.12  Aligned_cols=30  Identities=20%  Similarity=0.310  Sum_probs=20.6

Q ss_pred             CCcccccCcccccCcEEEe--------CC---CccccCCcc
Q psy10674         80 IPRCHACDELIFVNEYTLA--------EN---KTFHVKHFC  109 (138)
Q Consensus        80 ~~~C~~C~~~I~~~~~~~~--------~~---~~~H~~CF~  109 (138)
                      ...|.+|++.|.-+++-.+        .|   ..||..||.
T Consensus        17 Rs~Ck~C~~~I~K~~lRi~~~v~~~~~dg~~~~W~H~~Cf~   57 (981)
T PLN03123         17 RSSCKTCKSPIDKDELRLGKMVQSTQFDGFMPMWNHASCIL   57 (981)
T ss_pred             CccccccCCcccCCCeEEEEeecccccCCCCCeeecccccc
Confidence            4589999999976653321        13   467889986


No 115
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=31.35  E-value=29  Score=27.99  Aligned_cols=39  Identities=23%  Similarity=0.419  Sum_probs=26.5

Q ss_pred             ccccCCccccCCceeeeCCeeecHHHHHhhcCCCcccccCcc
Q psy10674         48 VCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDEL   89 (138)
Q Consensus        48 ~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~~~~C~~C~~~   89 (138)
                      +|..|+.+|   .|....+.+.|..|-.+..-...|+.|+..
T Consensus       224 ~C~~C~~~l---~~h~~~~~l~Ch~Cg~~~~~~~~Cp~C~s~  262 (505)
T TIGR00595       224 CCPNCDVSL---TYHKKEGKLRCHYCGYQEPIPKTCPQCGSE  262 (505)
T ss_pred             CCCCCCCce---EEecCCCeEEcCCCcCcCCCCCCCCCCCCC
Confidence            456666666   355567788898887554323689999874


No 116
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=31.03  E-value=22  Score=19.20  Aligned_cols=10  Identities=20%  Similarity=0.733  Sum_probs=7.2

Q ss_pred             CcccccCccc
Q psy10674         81 PRCHACDELI   90 (138)
Q Consensus        81 ~~C~~C~~~I   90 (138)
                      -+|..|+..+
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            3677777777


No 117
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=31.01  E-value=26  Score=23.24  Aligned_cols=14  Identities=14%  Similarity=0.619  Sum_probs=7.6

Q ss_pred             cccCcccccCCccc
Q psy10674         43 HPQCFVCSTCDELL   56 (138)
Q Consensus        43 H~~Cf~C~~C~~~l   56 (138)
                      +.+-+.|..|++..
T Consensus       121 ~~~f~~C~~C~kiy  134 (147)
T PF01927_consen  121 YDEFWRCPGCGKIY  134 (147)
T ss_pred             CCeEEECCCCCCEe
Confidence            33445666666544


No 118
>PRK11595 DNA utilization protein GntX; Provisional
Probab=30.95  E-value=50  Score=23.53  Aligned_cols=37  Identities=16%  Similarity=0.175  Sum_probs=21.7

Q ss_pred             ccccCCccccCCceeeeCCeeecHHHHHhhcC-CCcccccCccc
Q psy10674         48 VCSTCDELLVDLMYFHYKGNVYCLRDYATMLD-IPRCHACDELI   90 (138)
Q Consensus        48 ~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~-~~~C~~C~~~I   90 (138)
                      .|..|+.++...      ...+|..|..++.. .+.|..|+.++
T Consensus         7 ~C~~C~~~~~~~------~~~lC~~C~~~l~~~~~~C~~Cg~~~   44 (227)
T PRK11595          7 LCWLCRMPLALS------HWGICSVCSRALRTLKTCCPQCGLPA   44 (227)
T ss_pred             cCccCCCccCCC------CCcccHHHHhhCCcccCcCccCCCcC
Confidence            356676666321      12378888765421 24688888775


No 119
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=30.90  E-value=9.7  Score=19.57  Aligned_cols=10  Identities=20%  Similarity=0.863  Sum_probs=5.9

Q ss_pred             cccccCCccc
Q psy10674         47 FVCSTCDELL   56 (138)
Q Consensus        47 f~C~~C~~~l   56 (138)
                      |+|..|+..+
T Consensus         6 y~C~~Cg~~f   15 (42)
T PF09723_consen    6 YRCEECGHEF   15 (42)
T ss_pred             EEeCCCCCEE
Confidence            5566666544


No 120
>PHA02768 hypothetical protein; Provisional
Probab=30.47  E-value=10  Score=20.97  Aligned_cols=12  Identities=8%  Similarity=0.177  Sum_probs=5.8

Q ss_pred             CccccccccccC
Q psy10674        107 HFCCYECDKELC  118 (138)
Q Consensus       107 CF~C~~C~~~l~  118 (138)
                      =++|..|++.+.
T Consensus        31 ~~kc~~C~k~f~   42 (55)
T PHA02768         31 NLKLSNCKRISL   42 (55)
T ss_pred             cccCCcccceec
Confidence            345555555433


No 121
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=30.44  E-value=16  Score=19.88  Aligned_cols=28  Identities=21%  Similarity=0.412  Sum_probs=13.1

Q ss_pred             cccccCcccccCcEE-EeCCCccccCCccc
Q psy10674         82 RCHACDELIFVNEYT-LAENKTFHVKHFCC  110 (138)
Q Consensus        82 ~C~~C~~~I~~~~~~-~~~~~~~H~~CF~C  110 (138)
                      .|+.|+.+|.- .+- ...++.|-.+|-.|
T Consensus         2 ~CPyCge~~~~-~iD~s~~~Q~yiEDC~vC   30 (52)
T PF14255_consen    2 QCPYCGEPIEI-LIDPSAGDQEYIEDCQVC   30 (52)
T ss_pred             CCCCCCCeeEE-EEecCCCCeeEEeehhhc
Confidence            36666666631 111 13345566565444


No 122
>KOG2186|consensus
Probab=30.11  E-value=11  Score=27.63  Aligned_cols=42  Identities=19%  Similarity=0.472  Sum_probs=27.3

Q ss_pred             cccccccccccCCCeEEEeccccCCCCCCcccCcccccCCccccCCcee
Q psy10674         14 FCCYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYF   62 (138)
Q Consensus        14 ~~C~~C~~~i~~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~   62 (138)
                      |+|..|+..+.-..+--...       ..|..+|.|..|++.+.+..|.
T Consensus         4 FtCnvCgEsvKKp~vekH~s-------rCrn~~fSCIDC~k~F~~~sYk   45 (276)
T KOG2186|consen    4 FTCNVCGESVKKPQVEKHMS-------RCRNAYFSCIDCGKTFERVSYK   45 (276)
T ss_pred             EehhhhhhhccccchHHHHH-------hccCCeeEEeecccccccchhh
Confidence            78888988876322211111       3466789999999988665443


No 123
>PRK01343 zinc-binding protein; Provisional
Probab=29.88  E-value=36  Score=18.96  Aligned_cols=10  Identities=20%  Similarity=0.577  Sum_probs=7.2

Q ss_pred             CcccccCccc
Q psy10674         81 PRCHACDELI   90 (138)
Q Consensus        81 ~~C~~C~~~I   90 (138)
                      .+|..|+++.
T Consensus        10 ~~CP~C~k~~   19 (57)
T PRK01343         10 RPCPECGKPS   19 (57)
T ss_pred             CcCCCCCCcC
Confidence            4677787765


No 124
>PRK14873 primosome assembly protein PriA; Provisional
Probab=29.75  E-value=28  Score=29.22  Aligned_cols=39  Identities=21%  Similarity=0.198  Sum_probs=26.1

Q ss_pred             cccccCCccccCCceeeeCCeeecHHHHHhhcCCCcccccCcc
Q psy10674         47 FVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDEL   89 (138)
Q Consensus        47 f~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~~~~C~~C~~~   89 (138)
                      ++|..|+.+|.   |....+.+.|..|-.... ...|..|+..
T Consensus       393 ~~C~~C~~~L~---~h~~~~~l~Ch~CG~~~~-p~~Cp~Cgs~  431 (665)
T PRK14873        393 ARCRHCTGPLG---LPSAGGTPRCRWCGRAAP-DWRCPRCGSD  431 (665)
T ss_pred             eECCCCCCcee---EecCCCeeECCCCcCCCc-CccCCCCcCC
Confidence            34666766663   444566788888866554 4689999875


No 125
>PRK14891 50S ribosomal protein L24e/unknown domain fusion protein; Provisional
Probab=29.74  E-value=38  Score=22.18  Aligned_cols=33  Identities=21%  Similarity=0.432  Sum_probs=22.1

Q ss_pred             CcccccCcccccCc---EEEeCCCccccCCccccccccc
Q psy10674         81 PRCHACDELIFVNE---YTLAENKTFHVKHFCCYECDKE  116 (138)
Q Consensus        81 ~~C~~C~~~I~~~~---~~~~~~~~~H~~CF~C~~C~~~  116 (138)
                      ..|.-|+.+|.++.   +|...|+.|+   |.=++|.+.
T Consensus         5 e~CsFcG~kIyPG~G~~fVR~DGkvf~---FcssKC~k~   40 (131)
T PRK14891          5 RTCDYTGEEIEPGTGTMFVRKDGTVLH---FVDSKCEKN   40 (131)
T ss_pred             eeecCcCCcccCCCCcEEEecCCCEEE---EecHHHHHH
Confidence            57999999998875   4546678777   333345433


No 126
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=29.62  E-value=41  Score=15.74  Aligned_cols=11  Identities=18%  Similarity=0.633  Sum_probs=4.8

Q ss_pred             cccccccccCC
Q psy10674        109 CCYECDKELCN  119 (138)
Q Consensus       109 ~C~~C~~~l~~  119 (138)
                      .|..|.+.+.+
T Consensus         2 ~C~~C~~~~~~   12 (30)
T PF03107_consen    2 WCDVCRRKIDG   12 (30)
T ss_pred             CCCCCCCCcCC
Confidence            34444444443


No 127
>COG2075 RPL24A Ribosomal protein L24E [Translation, ribosomal structure and biogenesis]
Probab=29.28  E-value=45  Score=19.14  Aligned_cols=9  Identities=44%  Similarity=1.051  Sum_probs=5.6

Q ss_pred             ccccCCccc
Q psy10674         48 VCSTCDELL   56 (138)
Q Consensus        48 ~C~~C~~~l   56 (138)
                      +|+-|+..+
T Consensus         5 ~CsFcG~~I   13 (66)
T COG2075           5 VCSFCGKKI   13 (66)
T ss_pred             EecCcCCcc
Confidence            456666666


No 128
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=29.16  E-value=48  Score=16.72  Aligned_cols=30  Identities=23%  Similarity=0.389  Sum_probs=12.9

Q ss_pred             CcccccCcccccCcEEEeCCCccccCCcccccccc
Q psy10674         81 PRCHACDELIFVNEYTLAENKTFHVKHFCCYECDK  115 (138)
Q Consensus        81 ~~C~~C~~~I~~~~~~~~~~~~~H~~CF~C~~C~~  115 (138)
                      .+|..|+--|-+-..+...++.|     +|..|+.
T Consensus         3 ~rC~~C~aylNp~~~~~~~~~~w-----~C~~C~~   32 (40)
T PF04810_consen    3 VRCRRCRAYLNPFCQFDDGGKTW-----ICNFCGT   32 (40)
T ss_dssp             -B-TTT--BS-TTSEEETTTTEE-----EETTT--
T ss_pred             cccCCCCCEECCcceEcCCCCEE-----ECcCCCC
Confidence            47777777775543333444554     4666654


No 129
>cd00472 Ribosomal_L24e_L24 Ribosomal protein L24e/L24 is a ribosomal protein found in eukaryotes (L24) and in archaea (L24e, distinct from archaeal L24). L24e/L24 is located on the surface of the large subunit, adjacent to proteins L14 and L3, and near the translation factor binding site.  L24e/L24 appears to play a role in the kinetics of peptide synthesis, and may be involved in interactions between the large and small subunits, either directly or through other factors. In mouse, a deletion mutation in L24 has been identified as the cause for the belly spot and tail (Bst) mutation that results in disrupted pigmentation, somitogenesis and retinal cell fate determination.  L24 may be an important protein in eukaryotic reproduction:  in shrimp, L24 expression is elevated in the ovary, suggesting a role in oogenesis, and in Arabidopsis, L24 has been proposed to have a specific function in gynoecium development. No protein with sequence or structural homology to L24e/L24 has been identifi
Probab=29.04  E-value=39  Score=18.57  Aligned_cols=24  Identities=25%  Similarity=0.629  Sum_probs=16.8

Q ss_pred             CcccccCcccccCc---EEEeCCCccc
Q psy10674         81 PRCHACDELIFVNE---YTLAENKTFH  104 (138)
Q Consensus        81 ~~C~~C~~~I~~~~---~~~~~~~~~H  104 (138)
                      ..|.-|+..|.++.   ++...|+.++
T Consensus         4 ~~C~f~g~~I~PG~G~~~Vr~Dgkv~~   30 (54)
T cd00472           4 EKCSFCGYKIYPGHGKMYVRNDGKVFR   30 (54)
T ss_pred             EEecCcCCeecCCCccEEEecCCCEEE
Confidence            57888888888764   4446666665


No 130
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=29.02  E-value=22  Score=29.97  Aligned_cols=85  Identities=20%  Similarity=0.425  Sum_probs=52.9

Q ss_pred             CcCCcccccccccccCCCeEEEeccccCCCCCCcccCcccccCCccccCCceeeeCCeeecHHHH-HhhcCCCcccccCc
Q psy10674         10 HVKHFCCYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDY-ATMLDIPRCHACDE   88 (138)
Q Consensus        10 h~~~~~C~~C~~~i~~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~yC~~c~-~~~~~~~~C~~C~~   88 (138)
                      -|+-.+|..|-+.|.+.           .++.|+=---.|..|+-.     |...+..||=+..- ...|  +.|..|.+
T Consensus        98 ~pD~a~C~~Cl~Ei~dp-----------~~rrY~YPF~~CT~CGPR-----fTIi~alPYDR~nTsM~~F--~lC~~C~~  159 (750)
T COG0068          98 PPDAATCEDCLEEIFDP-----------NSRRYLYPFINCTNCGPR-----FTIIEALPYDRENTSMADF--PLCPFCDK  159 (750)
T ss_pred             CCchhhhHHHHHHhcCC-----------CCcceeccccccCCCCcc-----eeeeccCCCCcccCccccC--cCCHHHHH
Confidence            45667788887777532           233566665678999654     33333344322211 1223  67887775


Q ss_pred             ccccCcEEEeCCCccccCCcccccccccc
Q psy10674         89 LIFVNEYTLAENKTFHVKHFCCYECDKEL  117 (138)
Q Consensus        89 ~I~~~~~~~~~~~~~H~~CF~C~~C~~~l  117 (138)
                           ++....++.||..=..|..|+-.+
T Consensus       160 -----EY~dP~nRRfHAQp~aCp~CGP~~  183 (750)
T COG0068         160 -----EYKDPLNRRFHAQPIACPKCGPHL  183 (750)
T ss_pred             -----HhcCccccccccccccCcccCCCe
Confidence                 234478899999999999998754


No 131
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=29.00  E-value=11  Score=18.73  Aligned_cols=10  Identities=20%  Similarity=0.916  Sum_probs=5.8

Q ss_pred             cccccCCccc
Q psy10674         47 FVCSTCDELL   56 (138)
Q Consensus        47 f~C~~C~~~l   56 (138)
                      |+|..|+..+
T Consensus         6 y~C~~Cg~~f   15 (41)
T smart00834        6 YRCEDCGHTF   15 (41)
T ss_pred             EEcCCCCCEE
Confidence            4566666544


No 132
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=28.88  E-value=27  Score=17.33  Aligned_cols=18  Identities=22%  Similarity=0.510  Sum_probs=9.1

Q ss_pred             CCCCcccCcccccCCccc
Q psy10674         39 EVLWHPQCFVCSTCDELL   56 (138)
Q Consensus        39 ~~~~H~~Cf~C~~C~~~l   56 (138)
                      ++.||-.=..|..|+=.+
T Consensus        14 ~RR~~~~~isC~~CGPr~   31 (35)
T PF07503_consen   14 NRRFHYQFISCTNCGPRY   31 (35)
T ss_dssp             STTTT-TT--BTTCC-SC
T ss_pred             CCcccCcCccCCCCCCCE
Confidence            446777777777776544


No 133
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=28.77  E-value=13  Score=24.74  Aligned_cols=35  Identities=23%  Similarity=0.381  Sum_probs=23.1

Q ss_pred             CcccccCcccccCcEEEeCCCccccCCccccccccccC
Q psy10674         81 PRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELC  118 (138)
Q Consensus        81 ~~C~~C~~~I~~~~~~~~~~~~~H~~CF~C~~C~~~l~  118 (138)
                      -.|+.|+......+.+...+.   ..=|.|..|+.+|.
T Consensus       100 Y~Cp~C~~~y~~~ea~~~~d~---~~~f~Cp~Cg~~l~  134 (147)
T smart00531      100 YKCPNCQSKYTFLEANQLLDM---DGTFTCPRCGEELE  134 (147)
T ss_pred             EECcCCCCEeeHHHHHHhcCC---CCcEECCCCCCEEE
Confidence            379999987765544322221   33499999998875


No 134
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=28.70  E-value=19  Score=16.00  Aligned_cols=12  Identities=42%  Similarity=0.944  Sum_probs=8.4

Q ss_pred             ccccccccccCC
Q psy10674        108 FCCYECDKELCN  119 (138)
Q Consensus       108 F~C~~C~~~l~~  119 (138)
                      |.|..|++.+..
T Consensus         2 ~~C~~C~~~F~~   13 (27)
T PF13912_consen    2 FECDECGKTFSS   13 (27)
T ss_dssp             EEETTTTEEESS
T ss_pred             CCCCccCCccCC
Confidence            568888877663


No 135
>cd02344 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present in HERC2 and related proteins. HERC2 is a potential E3 ubiquitin protein ligase and/or guanine nucleotide exchange factor. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=28.40  E-value=54  Score=17.24  Aligned_cols=10  Identities=20%  Similarity=0.404  Sum_probs=5.9

Q ss_pred             eeecHHHHHh
Q psy10674         67 NVYCLRDYAT   76 (138)
Q Consensus        67 ~~yC~~c~~~   76 (138)
                      --+|+.||..
T Consensus        24 yDLC~~Cf~~   33 (45)
T cd02344          24 FDFCENCFKT   33 (45)
T ss_pred             ccchHHhhCC
Confidence            4466666654


No 136
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=27.85  E-value=17  Score=22.19  Aligned_cols=37  Identities=22%  Similarity=0.297  Sum_probs=19.6

Q ss_pred             cccccCCccccCCceeeeCCeeecHHHHHhhcCCCcccccCccccc
Q psy10674         47 FVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFV   92 (138)
Q Consensus        47 f~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~~~~C~~C~~~I~~   92 (138)
                      -.|..|+++|.-..-..     .=.  |.-..  -+|..|+++|..
T Consensus        34 S~C~~C~~~L~~~~lIP-----i~S--~l~lr--GrCr~C~~~I~~   70 (92)
T PF06750_consen   34 SHCPHCGHPLSWWDLIP-----ILS--YLLLR--GRCRYCGAPIPP   70 (92)
T ss_pred             CcCcCCCCcCcccccch-----HHH--HHHhC--CCCcccCCCCCh
Confidence            45777777774322111     111  33333  378888888753


No 137
>COG3813 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.84  E-value=92  Score=18.28  Aligned_cols=45  Identities=18%  Similarity=0.285  Sum_probs=27.7

Q ss_pred             ccccCCccccCCc---eeeeCCeeecHHHHHhhcCCCcccccCcccccC
Q psy10674         48 VCSTCDELLVDLM---YFHYKGNVYCLRDYATMLDIPRCHACDELIFVN   93 (138)
Q Consensus        48 ~C~~C~~~l~~~~---~~~~~~~~yC~~c~~~~~~~~~C~~C~~~I~~~   93 (138)
                      .|.-|.+.|....   ..-.-.--+|.+|...+++ ..|.-|+..+...
T Consensus         7 nCECCDrDLpp~s~dA~ICtfEcTFCadCae~~l~-g~CPnCGGelv~R   54 (84)
T COG3813           7 NCECCDRDLPPDSTDARICTFECTFCADCAENRLH-GLCPNCGGELVAR   54 (84)
T ss_pred             CCcccCCCCCCCCCceeEEEEeeehhHhHHHHhhc-CcCCCCCchhhcC
Confidence            3555667663321   1112334578889887775 6999999866543


No 138
>PF10764 Gin:  Inhibitor of sigma-G Gin;  InterPro: IPR019700  Gin allows sigma-F to delay late forespore transcription by preventing sigma-G to take over before the cell has reached a critical stage of development. Gin is also known as CsfB []. 
Probab=27.71  E-value=82  Score=16.60  Aligned_cols=7  Identities=14%  Similarity=0.264  Sum_probs=2.7

Q ss_pred             ccCCccc
Q psy10674         50 STCDELL   56 (138)
Q Consensus        50 ~~C~~~l   56 (138)
                      ..|+++.
T Consensus         3 iiC~~~~    9 (46)
T PF10764_consen    3 IICGKEK    9 (46)
T ss_pred             EeCCCcC
Confidence            3344433


No 139
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=26.91  E-value=11  Score=17.83  Aligned_cols=16  Identities=38%  Similarity=0.968  Sum_probs=11.3

Q ss_pred             ccccccccccCCCCee
Q psy10674        108 FCCYECDKELCNQSYI  123 (138)
Q Consensus       108 F~C~~C~~~l~~~~f~  123 (138)
                      |.|..|.+.+.+..|.
T Consensus         1 ~sCiDC~~~F~~~~y~   16 (28)
T PF08790_consen    1 FSCIDCSKDFDGDSYK   16 (28)
T ss_dssp             EEETTTTEEEEGGGTT
T ss_pred             CeeecCCCCcCcCCcC
Confidence            5688888888765553


No 140
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=26.87  E-value=39  Score=17.42  Aligned_cols=20  Identities=25%  Similarity=0.687  Sum_probs=12.7

Q ss_pred             cccccCcccccCcEEEeCCCccccCCccccccc
Q psy10674         82 RCHACDELIFVNEYTLAENKTFHVKHFCCYECD  114 (138)
Q Consensus        82 ~C~~C~~~I~~~~~~~~~~~~~H~~CF~C~~C~  114 (138)
                      .|.+|+++|.+.             -|+|..|.
T Consensus         2 ~Cd~C~~~i~G~-------------ry~C~~C~   21 (43)
T cd02340           2 ICDGCQGPIVGV-------------RYKCLVCP   21 (43)
T ss_pred             CCCCCCCcCcCC-------------eEECCCCC
Confidence            577777766431             26777774


No 141
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=26.75  E-value=80  Score=23.97  Aligned_cols=29  Identities=21%  Similarity=0.444  Sum_probs=19.4

Q ss_pred             CeeecHHHHHhhc--CCCcccccCcccccCc
Q psy10674         66 GNVYCLRDYATML--DIPRCHACDELIFVNE   94 (138)
Q Consensus        66 ~~~yC~~c~~~~~--~~~~C~~C~~~I~~~~   94 (138)
                      |-.+|..|....+  +...|+.|+.++....
T Consensus        27 GH~~C~sCv~~l~~~~~~~CP~C~~~lrk~~   57 (309)
T TIGR00570        27 GHTLCESCVDLLFVRGSGSCPECDTPLRKNN   57 (309)
T ss_pred             CCcccHHHHHHHhcCCCCCCCCCCCccchhh
Confidence            4557777776644  2347999998886543


No 142
>PF09360 zf-CDGSH:  Iron-binding zinc finger CDGSH type;  InterPro: IPR018967 This entry represents iron-sulphur domain containing proteins that have a CDGSH sequence motif (although the Ser residue can also be an Ala or Thr), and is found in proteins from a wide range of organisms with the exception of fungi. The CDGSH-type domain binds a redox-active pH-labile 2Fe-2S cluster. The conserved sequence C-X-C-X2-(S/T)-X3-P-X-C-D-G-(S/A/T)-H is a defining feature of this family []. CDGSH-type domains are found in mitoNEET, an iron-containing integral protein of the outer mitochondrian membrane (OMM). MitoNEET forms a dimeric structure with a NEET fold, and contains two domains: a beta-cap region and a cluster-binding domain that coordinated two acid-labile 2Fe-2S clusters (one bound to each protomer) []. The CDGSH iron-sulphur domain is oriented towards the cytoplasm and is tethered to the mitochondrial membrane by a more N-terminal domain found in higher vertebrates, (IPR019610 from INTERPRO) [, ]. The whole protein regulates oxidative capacity and may function in electron transfer, for instance in redox reactions with metabolic intermediates, cofactors and/or proteins localized at the OMM. ; GO: 0051537 2 iron, 2 sulfur cluster binding, 0043231 intracellular membrane-bounded organelle; PDB: 3TBO_A 3FNV_B 3TBM_B 3TBN_A 3S2R_A 3S2Q_A 3LPQ_A 2QH7_A 3EW0_A 2R13_A ....
Probab=26.64  E-value=31  Score=17.36  Aligned_cols=7  Identities=29%  Similarity=0.415  Sum_probs=3.8

Q ss_pred             CCCccCC
Q psy10674        128 SRPGQDS  134 (138)
Q Consensus       128 ~~~y~~~  134 (138)
                      ++||||-
T Consensus        29 ~~PfCDG   35 (38)
T PF09360_consen   29 NKPFCDG   35 (38)
T ss_dssp             TTTB--S
T ss_pred             CCCccCC
Confidence            7888874


No 143
>cd02338 ZZ_PCMF_like Zinc finger, ZZ type. Zinc finger present in potassium channel modulatory factor (PCMF) 1  and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Human potassium channel modulatory factor 1 or FIGC has been shown to possess intrinsic E3 ubiquitin ligase activity and to promote ubiquitination.
Probab=26.47  E-value=54  Score=17.38  Aligned_cols=9  Identities=22%  Similarity=0.478  Sum_probs=5.1

Q ss_pred             eecHHHHHh
Q psy10674         68 VYCLRDYAT   76 (138)
Q Consensus        68 ~yC~~c~~~   76 (138)
                      -+|..||..
T Consensus        25 dlC~~Cf~~   33 (49)
T cd02338          25 DLCADCYDS   33 (49)
T ss_pred             ccchhHHhC
Confidence            356666653


No 144
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=26.39  E-value=8.4  Score=21.05  Aligned_cols=11  Identities=18%  Similarity=0.483  Sum_probs=4.9

Q ss_pred             cccccCccccc
Q psy10674         82 RCHACDELIFV   92 (138)
Q Consensus        82 ~C~~C~~~I~~   92 (138)
                      .|.+|+-.|.+
T Consensus        24 ~C~gC~~~l~~   34 (56)
T PF02591_consen   24 TCSGCHMELPP   34 (56)
T ss_pred             ccCCCCEEcCH
Confidence            44444444433


No 145
>KOG2114|consensus
Probab=25.77  E-value=29  Score=29.88  Aligned_cols=36  Identities=22%  Similarity=0.545  Sum_probs=23.5

Q ss_pred             CcccccCcccccCcEEE-eCCCccccCCcc-----cccccccc
Q psy10674         81 PRCHACDELIFVNEYTL-AENKTFHVKHFC-----CYECDKEL  117 (138)
Q Consensus        81 ~~C~~C~~~I~~~~~~~-~~~~~~H~~CF~-----C~~C~~~l  117 (138)
                      .+|..|..++ +-.+|. .-+..||.+||.     |.+|...+
T Consensus       841 skCs~C~~~L-dlP~VhF~CgHsyHqhC~e~~~~~CP~C~~e~  882 (933)
T KOG2114|consen  841 SKCSACEGTL-DLPFVHFLCGHSYHQHCLEDKEDKCPKCLPEL  882 (933)
T ss_pred             eeecccCCcc-ccceeeeecccHHHHHhhccCcccCCccchhh
Confidence            3788888777 334444 347778888876     77776543


No 146
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=25.72  E-value=16  Score=25.20  Aligned_cols=32  Identities=31%  Similarity=0.743  Sum_probs=20.2

Q ss_pred             CCcccccccccccCCCeEEEeccccCCCCCCcccCcccccCCcccc
Q psy10674         12 KHFCCYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLV   57 (138)
Q Consensus        12 ~~~~C~~C~~~i~~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~   57 (138)
                      .-+.|..|+..+...+..         +     .-|.|..|+.+|.
T Consensus       116 ~~Y~Cp~C~~rytf~eA~---------~-----~~F~Cp~Cg~~L~  147 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAM---------E-----YGFRCPQCGEMLE  147 (178)
T ss_pred             CEEECCCCCcEEeHHHHh---------h-----cCCcCCCCCCCCe
Confidence            346788887665533221         1     1389999999884


No 147
>PF13901 DUF4206:  Domain of unknown function (DUF4206)
Probab=25.61  E-value=49  Score=23.26  Aligned_cols=29  Identities=24%  Similarity=0.434  Sum_probs=16.2

Q ss_pred             CcccccCc--ccccCc---EEE--eCCCccccCCcc
Q psy10674         81 PRCHACDE--LIFVNE---YTL--AENKTFHVKHFC  109 (138)
Q Consensus        81 ~~C~~C~~--~I~~~~---~~~--~~~~~~H~~CF~  109 (138)
                      ..|..|+.  .|.+=+   .+.  .=+..||.+||.
T Consensus       153 fiCe~C~~~~~IfPF~~~~~~~C~~C~~v~H~~C~~  188 (202)
T PF13901_consen  153 FICEICNSDDIIFPFQIDTTVRCPKCKSVFHKSCFR  188 (202)
T ss_pred             CCCccCCCCCCCCCCCCCCeeeCCcCccccchhhcC
Confidence            47888874  343311   222  225667888776


No 148
>COG4068 Uncharacterized protein containing a Zn-ribbon [Function unknown]
Probab=24.79  E-value=32  Score=19.30  Aligned_cols=16  Identities=25%  Similarity=0.488  Sum_probs=11.4

Q ss_pred             CcccccCcccccCcEE
Q psy10674         81 PRCHACDELIFVNEYT   96 (138)
Q Consensus        81 ~~C~~C~~~I~~~~~~   96 (138)
                      ..|..|+++|..++.+
T Consensus         9 ~HC~VCg~aIp~de~~   24 (64)
T COG4068           9 RHCVVCGKAIPPDEQV   24 (64)
T ss_pred             ccccccCCcCCCccch
Confidence            4788888888766543


No 149
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=24.51  E-value=29  Score=18.00  Aligned_cols=29  Identities=21%  Similarity=0.528  Sum_probs=17.8

Q ss_pred             CcccccCcccccCcEEEeCCCccccCCccccccccccC
Q psy10674         81 PRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELC  118 (138)
Q Consensus        81 ~~C~~C~~~I~~~~~~~~~~~~~H~~CF~C~~C~~~l~  118 (138)
                      -+|..|+..+...+..    .     =++|..|+.++.
T Consensus         4 y~C~~CG~~~~~~~~~----~-----~~~Cp~CG~~~~   32 (46)
T PRK00398          4 YKCARCGREVELDEYG----T-----GVRCPYCGYRIL   32 (46)
T ss_pred             EECCCCCCEEEECCCC----C-----ceECCCCCCeEE
Confidence            3789999877432211    1     256888876543


No 150
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=24.50  E-value=77  Score=19.32  Aligned_cols=37  Identities=19%  Similarity=0.496  Sum_probs=26.1

Q ss_pred             CCcccccCcccccCcEEEeCCCccccCCccccccccccCCCCeeec
Q psy10674         80 IPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELCNQSYIPV  125 (138)
Q Consensus        80 ~~~C~~C~~~I~~~~~~~~~~~~~H~~CF~C~~C~~~l~~~~f~~~  125 (138)
                      ...|+.|+++....    .....|     .|..|+..+.|..|...
T Consensus        35 ~~~Cp~C~~~~VkR----~a~GIW-----~C~kCg~~fAGgay~P~   71 (89)
T COG1997          35 KHVCPFCGRTTVKR----IATGIW-----KCRKCGAKFAGGAYTPV   71 (89)
T ss_pred             CCcCCCCCCcceee----eccCeE-----EcCCCCCeecccccccc
Confidence            36999999986432    333444     48999999998877653


No 151
>cd02334 ZZ_dystrophin Zinc finger, ZZ type. Zinc finger present in dystrophin and dystrobrevin. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Dystrophin attaches actin filaments to an integral membrane glycoprotein complex in muscle cells. The ZZ domain in dystrophin has been shown to be essential for binding to the membrane protein beta-dystroglycan.
Probab=24.01  E-value=74  Score=16.98  Aligned_cols=10  Identities=10%  Similarity=0.218  Sum_probs=5.9

Q ss_pred             eeecHHHHHh
Q psy10674         67 NVYCLRDYAT   76 (138)
Q Consensus        67 ~~yC~~c~~~   76 (138)
                      --+|..||..
T Consensus        24 ~DLC~~Cf~~   33 (49)
T cd02334          24 YDLCQSCFFS   33 (49)
T ss_pred             cCchHHHHhC
Confidence            3466667654


No 152
>KOG1244|consensus
Probab=23.86  E-value=66  Score=24.05  Aligned_cols=10  Identities=10%  Similarity=0.155  Sum_probs=5.6

Q ss_pred             CCeeecHHHH
Q psy10674         65 KGNVYCLRDY   74 (138)
Q Consensus        65 ~~~~yC~~c~   74 (138)
                      |..++|.+|-
T Consensus       294 dqllfcddcd  303 (336)
T KOG1244|consen  294 DQLLFCDDCD  303 (336)
T ss_pred             ceeEeecccC
Confidence            4455666653


No 153
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=23.86  E-value=45  Score=28.43  Aligned_cols=40  Identities=20%  Similarity=0.319  Sum_probs=28.2

Q ss_pred             cccccCCccccCCceeeeCCeeecHHHHHhhcCCCcccccCcc
Q psy10674         47 FVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDEL   89 (138)
Q Consensus        47 f~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~~~~C~~C~~~   89 (138)
                      ++|..|+.+|   .+....+.+.|..|-.+..-...|+.|+..
T Consensus       445 ~~Cp~Cd~~l---t~H~~~~~L~CH~Cg~~~~~p~~Cp~Cgs~  484 (730)
T COG1198         445 AECPNCDSPL---TLHKATGQLRCHYCGYQEPIPQSCPECGSE  484 (730)
T ss_pred             ccCCCCCcce---EEecCCCeeEeCCCCCCCCCCCCCCCCCCC
Confidence            5677787776   355566888898887653324689999876


No 154
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=23.64  E-value=41  Score=18.85  Aligned_cols=13  Identities=23%  Similarity=0.554  Sum_probs=9.5

Q ss_pred             CcccccCcccccC
Q psy10674         81 PRCHACDELIFVN   93 (138)
Q Consensus        81 ~~C~~C~~~I~~~   93 (138)
                      ..|..|+++|.++
T Consensus         4 kHC~~CG~~Ip~~   16 (59)
T PF09889_consen    4 KHCPVCGKPIPPD   16 (59)
T ss_pred             CcCCcCCCcCCcc
Confidence            4688888888654


No 155
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=23.59  E-value=30  Score=18.08  Aligned_cols=10  Identities=20%  Similarity=0.873  Sum_probs=5.1

Q ss_pred             cccccCCccc
Q psy10674         47 FVCSTCDELL   56 (138)
Q Consensus        47 f~C~~C~~~l   56 (138)
                      +.|..|+..+
T Consensus         3 Y~C~~Cg~~~   12 (44)
T smart00659        3 YICGECGREN   12 (44)
T ss_pred             EECCCCCCEe
Confidence            3455555543


No 156
>PRK12495 hypothetical protein; Provisional
Probab=23.12  E-value=33  Score=24.64  Aligned_cols=11  Identities=18%  Similarity=0.682  Sum_probs=7.7

Q ss_pred             cccccCCcccc
Q psy10674         47 FVCSTCDELLV   57 (138)
Q Consensus        47 f~C~~C~~~l~   57 (138)
                      +.|..|+.+|.
T Consensus        43 ~hC~~CG~PIp   53 (226)
T PRK12495         43 AHCDECGDPIF   53 (226)
T ss_pred             hhcccccCccc
Confidence            56777877774


No 157
>KOG1734|consensus
Probab=23.06  E-value=21  Score=26.53  Aligned_cols=14  Identities=29%  Similarity=0.676  Sum_probs=8.3

Q ss_pred             cccCcccccCCccc
Q psy10674         43 HPQCFVCSTCDELL   56 (138)
Q Consensus        43 H~~Cf~C~~C~~~l   56 (138)
                      |.+=-.|..|++++
T Consensus       221 hl~d~vCaVCg~~~  234 (328)
T KOG1734|consen  221 HLSDSVCAVCGQQI  234 (328)
T ss_pred             CCCcchhHhhcchh
Confidence            44445666666666


No 158
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=23.04  E-value=68  Score=29.17  Aligned_cols=54  Identities=20%  Similarity=0.356  Sum_probs=27.7

Q ss_pred             cccccCCccccCCceeeeCCeeecHHHHHhhcCCCcccccCcccccCcEEEeCCCccccCCccccccccccCC
Q psy10674         47 FVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELCN  119 (138)
Q Consensus        47 f~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~~~~C~~C~~~I~~~~~~~~~~~~~H~~CF~C~~C~~~l~~  119 (138)
                      ++|..|+.....         .+|..|-........|..|+..+...+-.    ..      .|..|+.++..
T Consensus       668 rkCPkCG~~t~~---------~fCP~CGs~te~vy~CPsCGaev~~des~----a~------~CP~CGtplv~  721 (1337)
T PRK14714        668 RRCPSCGTETYE---------NRCPDCGTHTEPVYVCPDCGAEVPPDESG----RV------ECPRCDVELTP  721 (1337)
T ss_pred             EECCCCCCcccc---------ccCcccCCcCCCceeCccCCCccCCCccc----cc------cCCCCCCcccc
Confidence            667777664321         15666644332113577777766443211    11      26677777653


No 159
>smart00355 ZnF_C2H2 zinc finger.
Probab=23.01  E-value=43  Score=13.89  Aligned_cols=12  Identities=33%  Similarity=0.775  Sum_probs=7.7

Q ss_pred             ccccccccccCC
Q psy10674        108 FCCYECDKELCN  119 (138)
Q Consensus       108 F~C~~C~~~l~~  119 (138)
                      |.|..|++.+..
T Consensus         1 ~~C~~C~~~f~~   12 (26)
T smart00355        1 YRCPECGKVFKS   12 (26)
T ss_pred             CCCCCCcchhCC
Confidence            457777776653


No 160
>PF01246 Ribosomal_L24e:  Ribosomal protein L24e;  InterPro: IPR000988 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeabacterial ribosomal proteins can be grouped on the basis of sequence similarities. One of these families [] consists of mammalian ribosomal protein L24; yeast ribosomal protein L30A/B (Rp29) (YL21); Kluyveromyces lactis ribosomal protein L30; Arabidopsis thaliana ribosomal protein L24 homolog; Haloarcula marismortui ribosomal protein HL21/HL22; and Methanocaldococcus jannaschii (Methanococcus jannaschii) MJ1201. These proteins have 60 to 160 amino-acid residues. This entry represents proteins related to the L24e ribosomal proteins.; PDB: 2ZKR_u 1VQ9_U 1VQL_U 1KD1_V 1VQP_U 3CCM_U 3CD6_U 3CCL_U 3CCR_U 1Q86_V ....
Probab=22.93  E-value=39  Score=19.71  Aligned_cols=24  Identities=21%  Similarity=0.433  Sum_probs=13.3

Q ss_pred             CcccccCcccccCc---EEEeCCCccc
Q psy10674         81 PRCHACDELIFVNE---YTLAENKTFH  104 (138)
Q Consensus        81 ~~C~~C~~~I~~~~---~~~~~~~~~H  104 (138)
                      ..|.-|+..|.++.   +|...|+.++
T Consensus         4 ~~C~Fsg~~I~PG~G~~~Vr~DG~v~~   30 (71)
T PF01246_consen    4 EKCSFSGYKIYPGHGKMYVRNDGKVFY   30 (71)
T ss_dssp             EE-TTT-SEE-SSSSEEEE-TTS-EEE
T ss_pred             EEecccCCccCCCCCeEEEecCCCeEE
Confidence            57888888888775   4445666665


No 161
>COG3369 Zinc finger domain containing protein (CDGSH-type) [Function unknown]
Probab=22.90  E-value=41  Score=19.94  Aligned_cols=7  Identities=29%  Similarity=0.415  Sum_probs=6.0

Q ss_pred             CCCccCC
Q psy10674        128 SRPGQDS  134 (138)
Q Consensus       128 ~~~y~~~  134 (138)
                      ++||||-
T Consensus        41 NKPfCDG   47 (78)
T COG3369          41 NKPFCDG   47 (78)
T ss_pred             CCCccCC
Confidence            8999984


No 162
>TIGR00270 conserved hypothetical protein TIGR00270.
Probab=22.69  E-value=1e+02  Score=20.78  Aligned_cols=26  Identities=15%  Similarity=0.290  Sum_probs=17.5

Q ss_pred             cccCCccccCCceee-eCC--eeecHHHH
Q psy10674         49 CSTCDELLVDLMYFH-YKG--NVYCLRDY   74 (138)
Q Consensus        49 C~~C~~~l~~~~~~~-~~~--~~yC~~c~   74 (138)
                      |..|++++.+..+.+ .+|  ...|..|+
T Consensus         3 CEiCG~~i~~~~~~v~iega~l~vC~~C~   31 (154)
T TIGR00270         3 CEICGRKIKGKGFKIVIEGSEMTVCGECR   31 (154)
T ss_pred             cccCCCccCCCCeEEEEcCeEEehhhhHH
Confidence            788888887765543 344  34778887


No 163
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=22.61  E-value=34  Score=18.57  Aligned_cols=8  Identities=25%  Similarity=1.007  Sum_probs=3.1

Q ss_pred             ccccCccc
Q psy10674         83 CHACDELI   90 (138)
Q Consensus        83 C~~C~~~I   90 (138)
                      |.+|.+++
T Consensus         2 CfgC~~~~    9 (51)
T PF07975_consen    2 CFGCQKPF    9 (51)
T ss_dssp             ETTTTEE-
T ss_pred             CccCCCCC
Confidence            34444444


No 164
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=22.06  E-value=29  Score=15.60  Aligned_cols=10  Identities=30%  Similarity=0.833  Sum_probs=5.3

Q ss_pred             cccccccccc
Q psy10674        108 FCCYECDKEL  117 (138)
Q Consensus       108 F~C~~C~~~l  117 (138)
                      |.|..|++.+
T Consensus        15 ~~C~~C~k~F   24 (26)
T PF13465_consen   15 YKCPYCGKSF   24 (26)
T ss_dssp             EEESSSSEEE
T ss_pred             CCCCCCcCee
Confidence            4566665543


No 165
>KOG4739|consensus
Probab=21.98  E-value=60  Score=23.55  Aligned_cols=34  Identities=18%  Similarity=0.300  Sum_probs=23.5

Q ss_pred             CCceee-eCCeeecHHHHHhhcCCCcccccCccccc
Q psy10674         58 DLMYFH-YKGNVYCLRDYATMLDIPRCHACDELIFV   92 (138)
Q Consensus        58 ~~~~~~-~~~~~yC~~c~~~~~~~~~C~~C~~~I~~   92 (138)
                      ...|+. -=.-++|..|.....+ +.|..|+++|..
T Consensus        15 ~~~f~LTaC~HvfC~~C~k~~~~-~~C~lCkk~ir~   49 (233)
T KOG4739|consen   15 QDPFFLTACRHVFCEPCLKASSP-DVCPLCKKSIRI   49 (233)
T ss_pred             CCceeeeechhhhhhhhcccCCc-cccccccceeee
Confidence            334544 4567888888766653 599999999754


No 166
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=21.79  E-value=38  Score=21.69  Aligned_cols=9  Identities=33%  Similarity=0.877  Sum_probs=4.1

Q ss_pred             ccccccccC
Q psy10674        110 CYECDKELC  118 (138)
Q Consensus       110 C~~C~~~l~  118 (138)
                      |..|++.+.
T Consensus        15 C~~C~t~i~   23 (113)
T PF09862_consen   15 CPSCGTEIE   23 (113)
T ss_pred             cCCCCCEEE
Confidence            444444443


No 167
>cd02345 ZZ_dah Zinc finger, ZZ type. Zinc finger present in Drosophila dah and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Dah (discontinuous actin hexagon) is a membrane associated protein essential for cortical furrow formation in Drosophila.
Probab=21.71  E-value=73  Score=16.88  Aligned_cols=9  Identities=33%  Similarity=0.696  Sum_probs=5.1

Q ss_pred             eecHHHHHh
Q psy10674         68 VYCLRDYAT   76 (138)
Q Consensus        68 ~yC~~c~~~   76 (138)
                      -+|..||..
T Consensus        25 dLC~~Cf~~   33 (49)
T cd02345          25 SLCLGCYTK   33 (49)
T ss_pred             CchHHHHhC
Confidence            356666653


No 168
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=21.61  E-value=1.2e+02  Score=14.81  Aligned_cols=13  Identities=23%  Similarity=0.097  Sum_probs=8.7

Q ss_pred             eCCee-ecHHHHHh
Q psy10674         64 YKGNV-YCLRDYAT   76 (138)
Q Consensus        64 ~~~~~-yC~~c~~~   76 (138)
                      .++.. +|..|...
T Consensus        16 ~~g~~~LCn~Cg~~   29 (36)
T PF00320_consen   16 PNGNRTLCNACGLY   29 (36)
T ss_dssp             TTSEE-EEHHHHHH
T ss_pred             CCCCCHHHHHHHHH
Confidence            35555 89888743


No 169
>PF08189 Meleagrin:  Meleagrin/Cygnin family;  InterPro: IPR012573 This family consists of meleagrin and cygnin basic peptides that are isolated from turkey and black swan respectively. Both peptides are low in molecular weight and contain three disulphide bonds with high concentrations of aromatic residues. These peptides show similarity to transferrins and probably play some vital role in avian eggs but the exact function is still unknown [].
Probab=21.51  E-value=39  Score=16.97  Aligned_cols=7  Identities=29%  Similarity=-0.192  Sum_probs=4.8

Q ss_pred             ccCCCCC
Q psy10674        131 GQDSPGS  137 (138)
Q Consensus       131 y~~~~~~  137 (138)
                      |||+.+|
T Consensus        11 YCS~~Cs   17 (39)
T PF08189_consen   11 YCSSKCS   17 (39)
T ss_pred             eeccccc
Confidence            7777665


No 170
>PRK05580 primosome assembly protein PriA; Validated
Probab=21.25  E-value=60  Score=27.32  Aligned_cols=39  Identities=18%  Similarity=0.372  Sum_probs=24.7

Q ss_pred             ccccCCccccCCceeeeCCeeecHHHHHhhcCCCcccccCcc
Q psy10674         48 VCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDEL   89 (138)
Q Consensus        48 ~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~~~~C~~C~~~   89 (138)
                      +|..|+.+|   .|....+.+.|..|-....-...|+.|+..
T Consensus       392 ~C~~C~~~l---~~h~~~~~l~Ch~Cg~~~~~~~~Cp~Cg~~  430 (679)
T PRK05580        392 ECPHCDASL---TLHRFQRRLRCHHCGYQEPIPKACPECGST  430 (679)
T ss_pred             CCCCCCCce---eEECCCCeEECCCCcCCCCCCCCCCCCcCC
Confidence            455565555   244456778888886553223589999775


No 171
>PF13926 DUF4211:  Domain of unknown function (DUF4211)
Probab=21.13  E-value=72  Score=21.20  Aligned_cols=23  Identities=13%  Similarity=0.346  Sum_probs=13.6

Q ss_pred             cccccccccCCCCeeecCCCCCc
Q psy10674        109 CCYECDKELCNQSYIPVTESRPG  131 (138)
Q Consensus       109 ~C~~C~~~l~~~~f~~~~~~~~y  131 (138)
                      .|..|++.-....+.+.-.|+||
T Consensus       118 ~C~AC~~~~~~a~~~i~l~G~~Y  140 (153)
T PF13926_consen  118 SCDACNRSGHPATFRIRLSGKPY  140 (153)
T ss_pred             cCcccCCCCCCceEEEEeCCCCC
Confidence            46666665433356655557777


No 172
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=20.83  E-value=54  Score=17.25  Aligned_cols=10  Identities=40%  Similarity=0.866  Sum_probs=7.2

Q ss_pred             CcccccCccc
Q psy10674         81 PRCHACDELI   90 (138)
Q Consensus        81 ~~C~~C~~~I   90 (138)
                      -+|..|+...
T Consensus         6 y~C~~Cg~~f   15 (52)
T TIGR02605         6 YRCTACGHRF   15 (52)
T ss_pred             EEeCCCCCEe
Confidence            3788888755


No 173
>PF05864 Chordopox_RPO7:  Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide (RPO7);  InterPro: IPR008448 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This family consists of several Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide sequences. DNA-dependent RNA polymerase catalyses the transcription of DNA into RNA [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=20.82  E-value=20  Score=20.01  Aligned_cols=16  Identities=25%  Similarity=0.752  Sum_probs=11.1

Q ss_pred             cccccccccCCCCeee
Q psy10674        109 CCYECDKELCNQSYIP  124 (138)
Q Consensus       109 ~C~~C~~~l~~~~f~~  124 (138)
                      .|+.|++.|+..+|.+
T Consensus         6 vCSTCGrDlSeeRy~L   21 (63)
T PF05864_consen    6 VCSTCGRDLSEERYRL   21 (63)
T ss_pred             eecccCCcchHHHHHH
Confidence            4778888877666643


No 174
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=20.81  E-value=75  Score=15.43  Aligned_cols=10  Identities=10%  Similarity=0.175  Sum_probs=4.3

Q ss_pred             eeCCeeecHH
Q psy10674         63 HYKGNVYCLR   72 (138)
Q Consensus        63 ~~~~~~yC~~   72 (138)
                      ..++..+|..
T Consensus        17 ~~~~~~~C~~   26 (33)
T PF08792_consen   17 KEDDYEVCIF   26 (33)
T ss_pred             ecCCeEEccc
Confidence            3444444443


No 175
>PF04981 NMD3:  NMD3 family ;  InterPro: IPR007064 The NMD3 protein is involved in nonsense mediated mRNA decay. This N-terminal region contains four conserved CXXC motifs that could be metal binding. NMD3 is involved in export of the 60S ribosomal subunit is mediated by the adapter protein Nmd3p in a Crm1p-dependent pathway [].
Probab=20.74  E-value=1e+02  Score=22.15  Aligned_cols=24  Identities=21%  Similarity=0.501  Sum_probs=13.2

Q ss_pred             cccCCccccCCceeeeCCeeecHHHHHhhc
Q psy10674         49 CSTCDELLVDLMYFHYKGNVYCLRDYATML   78 (138)
Q Consensus        49 C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~   78 (138)
                      |..||++....    .  .-+|..||.+.+
T Consensus         1 C~~CG~~~~~~----~--~~lC~~C~~~~~   24 (236)
T PF04981_consen    1 CPRCGREIEPL----I--DGLCPDCYLKRF   24 (236)
T ss_pred             CCCCCCCCCCc----c--cccChHHhcccC
Confidence            55677654321    1  127888886654


No 176
>PHA03082 DNA-dependent RNA polymerase subunit; Provisional
Probab=20.34  E-value=20  Score=20.00  Aligned_cols=15  Identities=27%  Similarity=0.853  Sum_probs=10.5

Q ss_pred             cccccccccCCCCee
Q psy10674        109 CCYECDKELCNQSYI  123 (138)
Q Consensus       109 ~C~~C~~~l~~~~f~  123 (138)
                      .|+.|++.|+..+|.
T Consensus         6 VCsTCGrDlSeeRy~   20 (63)
T PHA03082          6 VCSTCGRDLSEERYR   20 (63)
T ss_pred             eecccCcchhHHHHH
Confidence            477888877766653


No 177
>KOG3039|consensus
Probab=20.20  E-value=1.8e+02  Score=21.47  Aligned_cols=84  Identities=11%  Similarity=0.129  Sum_probs=53.8

Q ss_pred             cccccccccccCCCeEEEe---ccc--cCCCCCCcccCcccccCCccccCC-cee--eeCCeeecHHHHHhhcC-CCccc
Q psy10674         14 FCCYECDKKVQFENYTGKI---TQS--QESEVLWHPQCFVCSTCDELLVDL-MYF--HYKGNVYCLRDYATMLD-IPRCH   84 (138)
Q Consensus        14 ~~C~~C~~~i~~~~~~~~~---~~~--~~~~~~~H~~Cf~C~~C~~~l~~~-~~~--~~~~~~yC~~c~~~~~~-~~~C~   84 (138)
                      .+|..=+++|.-.+++..-   ...  .-.+..-|..=|.|.++...|.+. ...  ..-|.+++..|.+++.. -..|.
T Consensus       184 v~CP~s~kplklkdL~~VkFT~l~s~~~et~l~a~s~ryiCpvtrd~LtNt~~ca~Lr~sg~Vv~~ecvEklir~D~v~p  263 (303)
T KOG3039|consen  184 VVCPVSGKPLKLKDLFAVKFTPLNSEETETKLIAASKRYICPVTRDTLTNTTPCAVLRPSGHVVTKECVEKLIRKDMVDP  263 (303)
T ss_pred             eeccCCCCccchhhcceeeeeecCCchhhhhhhhhccceecccchhhhcCccceEEeccCCcEeeHHHHHHhcccccccc
Confidence            4577777777654443210   000  000112355668899999999653 333  37789999999987652 14899


Q ss_pred             ccCcccccCcEEE
Q psy10674         85 ACDELIFVNEYTL   97 (138)
Q Consensus        85 ~C~~~I~~~~~~~   97 (138)
                      .|++++.+.++|.
T Consensus       264 v~d~plkdrdiI~  276 (303)
T KOG3039|consen  264 VTDKPLKDRDIIG  276 (303)
T ss_pred             CCCCcCcccceEe
Confidence            9999999988774


Done!