Diaphorina citri psyllid: psy10707


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
LSPSLVKHFSTTQVQHDAAVHSKSDHTTLWTIERFLSAGLLAVIPAAYLVPSVALEYALVVSIVMHSHWGIEALVVDYARPEVVGVALAKIFHLSVYILSIITLAGLMNLILNGGGVVEGTKKLWAIKSK
cccccccEEECccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHEEEECccccHHHHHHHHHccccc
*************************HTTLWTIERFLSAGLLAVIPAAYLVPSVALEYALVVSIVMHSHWGIEALVVDYARPEVVGVALAKIFHLSVYILSIITLAGLMNLILNGGGVVEGTKKLWAIK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LSPSLVKHFSTTQVQHDAAVHSKSDHTTLWTIERFLSAGLLAVIPAAYLVPSVALEYALVVSIVMHSHWGIEALVVDYARPEVVGVALAKIFHLSVYILSIITLAGLMNLILNGGGVVEGTKKLWAIKSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).confidentQ95123
Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).confidentA5GZW8
Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).confidentQ9CXV1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0040007 [BP]growthprobableGO:0008150
GO:0020037 [MF]heme bindingprobableGO:0005488, GO:0097159, GO:0003674, GO:1901363, GO:0046906
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0045333 [BP]cellular respirationprobableGO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0008150, GO:0008152, GO:0006091, GO:0055114
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0048039 [MF]ubiquinone bindingprobableGO:0003674, GO:0048038, GO:0048037, GO:0005488
GO:0005749 [CC]mitochondrial respiratory chain complex IIprobableGO:0044464, GO:0031975, GO:0043229, GO:0005739, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0045283, GO:0044444, GO:0045281, GO:0044455, GO:0031967, GO:0031966, GO:0043234, GO:0045273, GO:0045257, GO:0032991, GO:0043231, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0005740, GO:0005746, GO:0044429, GO:0044424, GO:0044425, GO:0070469, GO:0044422
GO:0000104 [MF]succinate dehydrogenase activityprobableGO:0003824, GO:0016627, GO:0003674, GO:0016491

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VR8, chain D
Confidence level:very confident
Coverage over the Query: 23-127
View the alignment between query and template
View the model in PyMOL