Query         psy10712
Match_columns 75
No_of_seqs    102 out of 225
Neff          4.3 
Searched_HMMs 46136
Date          Fri Aug 16 16:41:57 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10712.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10712hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF09538 FYDLN_acid:  Protein o  92.2   0.094   2E-06   34.9   1.7   33   15-48      6-39  (108)
  2 smart00714 LITAF Possible memb  91.7   0.086 1.9E-06   31.4   1.0   18   15-32     49-66  (67)
  3 PRK00398 rpoP DNA-directed RNA  90.3    0.37 7.9E-06   26.8   2.7   27   19-45      4-31  (46)
  4 PF10601 zf-LITAF-like:  LITAF-  90.2    0.16 3.4E-06   30.7   1.2   18   15-32     55-72  (73)
  5 TIGR02300 FYDLN_acid conserved  90.0    0.21 4.5E-06   34.7   1.7   35   15-50      6-41  (129)
  6 PF12773 DZR:  Double zinc ribb  87.2    0.34 7.3E-06   26.9   1.1   32   16-48     10-42  (50)
  7 PF12760 Zn_Tnp_IS1595:  Transp  85.7    0.55 1.2E-05   26.2   1.5   14   13-27     14-27  (46)
  8 PF13408 Zn_ribbon_recom:  Reco  82.4     1.2 2.6E-05   24.7   2.0   21   15-36      2-22  (58)
  9 PF10571 UPF0547:  Uncharacteri  81.8    0.98 2.1E-05   23.1   1.3   21   20-44      2-23  (26)
 10 PF13717 zinc_ribbon_4:  zinc-r  81.4    0.92   2E-05   24.5   1.2   11   18-28      2-12  (36)
 11 PF09862 DUF2089:  Protein of u  79.6    0.74 1.6E-05   31.1   0.5   27   21-51      1-28  (113)
 12 PF13248 zf-ribbon_3:  zinc-rib  77.5    0.86 1.9E-05   22.9   0.3   13   16-28     14-26  (26)
 13 PF13719 zinc_ribbon_5:  zinc-r  77.4     1.5 3.2E-05   23.7   1.2   10   18-27      2-11  (37)
 14 PRK00420 hypothetical protein;  76.8     1.7 3.6E-05   29.3   1.6   26   19-45     24-50  (112)
 15 smart00531 TFIIE Transcription  76.5     1.4   3E-05   29.9   1.1   18   15-32    120-137 (147)
 16 TIGR02098 MJ0042_CXXC MJ0042 f  76.0     1.8 3.8E-05   22.8   1.3   13   16-28     23-35  (38)
 17 PF13240 zinc_ribbon_2:  zinc-r  75.6     1.3 2.8E-05   22.0   0.6   21   20-44      1-22  (23)
 18 PF03966 Trm112p:  Trm112p-like  73.9     1.7 3.7E-05   25.9   1.0   14   13-26     48-61  (68)
 19 PF11781 RRN7:  RNA polymerase   72.7     1.3 2.9E-05   24.1   0.3   24   19-44      9-34  (36)
 20 PF06750 DiS_P_DiS:  Bacterial   71.8     3.4 7.4E-05   26.4   2.0   34   14-47     29-70  (92)
 21 PRK03681 hypA hydrogenase nick  71.7     4.2   9E-05   26.8   2.5   37   14-54     66-103 (114)
 22 PRK12380 hydrogenase nickel in  70.8     4.6  0.0001   26.5   2.5   36   14-54     66-102 (113)
 23 PF03604 DNA_RNApol_7kD:  DNA d  70.7     2.7 5.8E-05   22.5   1.1   24   21-45      3-27  (32)
 24 smart00659 RPOLCX RNA polymera  70.4     2.5 5.4E-05   23.9   1.1   13   16-28     17-29  (44)
 25 PRK11823 DNA repair protein Ra  70.4     2.8   6E-05   33.1   1.7   25   17-45      6-31  (446)
 26 PF03119 DNA_ligase_ZBD:  NAD-d  69.2       2 4.3E-05   22.2   0.4   10   20-29      1-10  (28)
 27 PF07282 OrfB_Zn_ribbon:  Putat  66.5     3.1 6.7E-05   24.3   0.9   25   19-44     29-55  (69)
 28 PF08996 zf-DNA_Pol:  DNA Polym  66.3     1.6 3.5E-05   30.7  -0.3   32   16-48     16-58  (188)
 29 cd00065 FYVE FYVE domain; Zinc  66.1     4.3 9.4E-05   22.6   1.5   31   19-51      3-34  (57)
 30 cd01121 Sms Sms (bacterial rad  65.6     3.6 7.7E-05   32.0   1.3   22   20-45      2-24  (372)
 31 TIGR00100 hypA hydrogenase nic  65.4     5.9 0.00013   26.0   2.2   36   14-54     66-102 (115)
 32 PF14599 zinc_ribbon_6:  Zinc-r  63.4       4 8.7E-05   24.7   1.0   31   15-46     27-59  (61)
 33 TIGR00416 sms DNA repair prote  61.9     4.8  0.0001   32.0   1.5   25   17-45      6-31  (454)
 34 COG1645 Uncharacterized Zn-fin  61.2     4.7  0.0001   28.0   1.2   12   15-26     41-52  (131)
 35 PRK05638 threonine synthase; V  58.9     6.7 0.00015   30.7   1.8   28   18-48      1-28  (442)
 36 PF13453 zf-TFIIB:  Transcripti  58.1     4.4 9.6E-05   21.9   0.5   17   20-37      1-17  (41)
 37 PRK00564 hypA hydrogenase nick  57.2      14 0.00031   24.3   2.9   36   15-54     68-104 (117)
 38 PF14471 DUF4428:  Domain of un  56.7     2.2 4.8E-05   24.8  -0.9   34   20-53      1-38  (51)
 39 PRK08351 DNA-directed RNA poly  56.6     5.7 0.00012   24.2   0.9   17   20-37     17-33  (61)
 40 PF06044 DRP:  Dam-replacing fa  56.5     3.1 6.8E-05   31.8  -0.4   31   13-43     26-61  (254)
 41 PRK00432 30S ribosomal protein  56.2     6.8 0.00015   22.6   1.1   25   18-43     20-45  (50)
 42 cd04476 RPA1_DBD_C RPA1_DBD_C:  55.8     8.6 0.00019   25.9   1.8   38   19-57     35-76  (166)
 43 PRK14714 DNA polymerase II lar  55.1     9.9 0.00021   34.9   2.4   27   17-49    666-693 (1337)
 44 PRK11827 hypothetical protein;  53.9     7.6 0.00017   23.5   1.1   15   17-32      7-21  (60)
 45 TIGR00354 polC DNA polymerase,  53.7      11 0.00024   33.9   2.5   49    2-57    999-1048(1095)
 46 smart00834 CxxC_CXXC_SSSS Puta  53.7     6.5 0.00014   20.5   0.7   13   16-28     24-36  (41)
 47 PF08271 TF_Zn_Ribbon:  TFIIB z  53.4       7 0.00015   21.3   0.8   18   15-32     16-33  (43)
 48 cd01411 SIR2H SIR2H: Uncharact  52.3      19 0.00041   25.8   3.1   39   16-57    116-158 (225)
 49 COG1571 Predicted DNA-binding   52.2     8.5 0.00018   31.2   1.4   30   15-45    347-377 (421)
 50 PRK14559 putative protein seri  52.1     9.8 0.00021   32.1   1.8   27   16-48     13-40  (645)
 51 PRK00241 nudC NADH pyrophospha  51.4     7.6 0.00016   28.7   1.0   35   13-47     94-129 (256)
 52 TIGR00622 ssl1 transcription f  50.5     7.7 0.00017   26.2   0.8   31   20-54      3-34  (112)
 53 COG2093 DNA-directed RNA polym  50.0     7.8 0.00017   24.1   0.7   20   17-37     17-36  (64)
 54 COG1198 PriA Primosomal protei  49.8     8.7 0.00019   33.0   1.2   31   19-49    445-476 (730)
 55 PF06677 Auto_anti-p27:  Sjogre  49.4      10 0.00022   21.3   1.1   11   15-25     31-41  (41)
 56 COG5629 Predicted metal-bindin  49.1     6.4 0.00014   30.9   0.3   39   16-54    167-214 (321)
 57 smart00064 FYVE Protein presen  48.9     9.3  0.0002   22.1   0.9   28   19-48     11-39  (68)
 58 KOG1088|consensus               48.9      13 0.00028   25.8   1.7   16   13-28     93-108 (124)
 59 PRK03824 hypA hydrogenase nick  48.5      18 0.00038   24.5   2.3   13   15-27     67-79  (135)
 60 PF07754 DUF1610:  Domain of un  48.1      11 0.00024   19.1   1.0   10   16-25     14-23  (24)
 61 KOG3092|consensus               47.4     9.4  0.0002   28.6   0.9   12   15-26    131-142 (216)
 62 PRK08329 threonine synthase; V  47.2      13 0.00029   28.1   1.7   28   18-48      1-28  (347)
 63 PF14205 Cys_rich_KTR:  Cystein  47.0      11 0.00025   22.7   1.1    9   19-27      5-13  (55)
 64 PRK04023 DNA polymerase II lar  47.0      16 0.00035   33.1   2.4   49    2-57   1024-1073(1121)
 65 PRK14714 DNA polymerase II lar  46.8      16 0.00035   33.6   2.4   39   14-56   1249-1288(1337)
 66 PF03226 Yippee-Mis18:  Yippee   46.7     9.5 0.00021   23.7   0.8   15   16-30     55-69  (96)
 67 PF11648 RIG-I_C-RD:  C-termina  46.4     8.2 0.00018   25.7   0.5   26   15-40     57-82  (123)
 68 PF14353 CpXC:  CpXC protein     46.3      20 0.00043   23.2   2.3   13   16-28     36-48  (128)
 69 PF04606 Ogr_Delta:  Ogr/Delta-  45.6     9.3  0.0002   21.4   0.5    9   20-28      1-9   (47)
 70 PRK12495 hypothetical protein;  45.0      14 0.00031   27.8   1.6   40    4-46     29-69  (226)
 71 cd01412 SIRT5_Af1_CobB SIRT5_A  44.9      26 0.00056   24.7   2.8   41   16-56    107-151 (224)
 72 COG1996 RPC10 DNA-directed RNA  44.8      12 0.00025   22.0   0.9   13   16-28     22-34  (49)
 73 PF10122 Mu-like_Com:  Mu-like   44.7      15 0.00033   21.8   1.4   14   13-26     19-32  (51)
 74 PF13790 DUF4182:  Domain of un  44.1      14 0.00029   20.8   1.0   17   17-33      2-18  (38)
 75 PRK06835 DNA replication prote  44.1      14  0.0003   28.3   1.5   25   16-44     96-120 (329)
 76 TIGR00595 priA primosomal prot  44.0      14  0.0003   29.7   1.5   25   19-43    223-248 (505)
 77 PRK14873 primosome assembly pr  43.5      19  0.0004   30.4   2.2   26   19-44    393-419 (665)
 78 PF01096 TFIIS_C:  Transcriptio  43.4      11 0.00023   20.5   0.6   12   20-31      2-13  (39)
 79 PF03811 Zn_Tnp_IS1:  InsA N-te  43.0      14 0.00031   20.0   1.0   14   18-31      5-18  (36)
 80 PF01363 FYVE:  FYVE zinc finge  42.9     6.1 0.00013   22.9  -0.5   35    2-46      1-36  (69)
 81 PF04810 zf-Sec23_Sec24:  Sec23  42.7      15 0.00032   20.0   1.0   17   37-53      3-20  (40)
 82 TIGR02605 CxxC_CxxC_SSSS putat  42.5      11 0.00025   20.8   0.6   11   16-26     24-34  (52)
 83 PF10005 DUF2248:  Uncharacteri  42.1      17 0.00036   28.9   1.6   22   20-45      1-23  (343)
 84 PF14803 Nudix_N_2:  Nudix N-te  41.8      11 0.00024   20.3   0.4    9   20-28      2-10  (34)
 85 PTZ00396 Casein kinase II subu  41.6      12 0.00026   28.3   0.8   12   15-26    145-156 (251)
 86 PF01214 CK_II_beta:  Casein ki  40.6      13 0.00029   26.6   0.8   11   15-25    124-134 (184)
 87 COG3877 Uncharacterized protei  39.6      15 0.00032   25.3   0.9   30   19-52      7-37  (122)
 88 PTZ00409 Sir2 (Silent Informat  39.4      29 0.00063   25.9   2.5   42   16-57    135-186 (271)
 89 TIGR03844 cysteate_syn cysteat  38.7      27 0.00058   27.4   2.3   28   18-48      2-30  (398)
 90 PRK11088 rrmA 23S rRNA methylt  38.5      14 0.00031   26.6   0.7   23   19-43      3-25  (272)
 91 PF08772 NOB1_Zn_bind:  Nin one  37.9      13 0.00028   23.3   0.3   12   16-27     22-33  (73)
 92 PF01396 zf-C4_Topoisom:  Topoi  37.5      15 0.00033   19.9   0.6    9   20-28      3-11  (39)
 93 COG3478 Predicted nucleic-acid  37.5      17 0.00037   22.8   0.8   11   17-27      3-13  (68)
 94 PRK09401 reverse gyrase; Revie  37.4      14 0.00031   33.0   0.7   26   18-43      7-33  (1176)
 95 PTZ00408 NAD-dependent deacety  37.2      25 0.00055   25.8   1.9   36   16-54    115-158 (242)
 96 PF13695 zf-3CxxC:  Zinc-bindin  35.6      45 0.00098   21.1   2.6   36   15-50      2-53  (98)
 97 PF04438 zf-HIT:  HIT zinc fing  35.1      17 0.00037   18.9   0.5   13   16-28     11-23  (30)
 98 PRK06450 threonine synthase; V  35.1      31 0.00067   26.3   2.1   29   18-49      3-32  (338)
 99 PF13878 zf-C2H2_3:  zinc-finge  34.8      17 0.00036   20.0   0.4   15   12-26      7-21  (41)
100 PHA00626 hypothetical protein   34.5      17 0.00037   22.3   0.5   44   19-62      1-50  (59)
101 PF13005 zf-IS66:  zinc-finger   34.2      19 0.00041   19.5   0.6   10   20-29      4-13  (47)
102 PRK00481 NAD-dependent deacety  34.2      38 0.00082   24.3   2.3   39   16-57    120-164 (242)
103 cd01410 SIRT7 SIRT7: Eukaryoti  34.0      32 0.00069   24.4   1.9   38   17-55     94-140 (206)
104 PRK14890 putative Zn-ribbon RN  33.6      26 0.00056   21.4   1.2   12   16-27     23-34  (59)
105 COG3809 Uncharacterized protei  33.5      17 0.00038   23.7   0.5   39   19-63      2-44  (88)
106 PF00130 C1_1:  Phorbol esters/  33.4      14  0.0003   20.3  -0.0   28   17-45     10-38  (53)
107 PF08209 Sgf11:  Sgf11 (transcr  33.3      22 0.00047   19.1   0.7   12   18-29      4-15  (33)
108 PHA02325 hypothetical protein   33.2      18  0.0004   22.8   0.5   14   20-33      5-20  (72)
109 PRK05580 primosome assembly pr  33.0      25 0.00055   29.3   1.4   11   19-29    391-401 (679)
110 PF02591 DUF164:  Putative zinc  32.5      31 0.00067   19.6   1.4   13   16-28     44-56  (56)
111 PRK06393 rpoE DNA-directed RNA  32.4      20 0.00044   22.1   0.6   17   20-37     19-35  (64)
112 PRK14138 NAD-dependent deacety  32.2      49  0.0011   24.1   2.7   38   16-56    117-164 (244)
113 PF02318 FYVE_2:  FYVE-type zin  31.7      16 0.00034   23.9  -0.0   35   17-52     53-88  (118)
114 TIGR01206 lysW lysine biosynth  31.7      26 0.00056   20.7   0.9   14   17-30     21-34  (54)
115 cd01408 SIRT1 SIRT1: Eukaryoti  31.1      33 0.00072   24.8   1.6   38   16-56    114-161 (235)
116 PRK06418 transcription elongat  30.9      12 0.00026   26.6  -0.7   16   18-33     13-30  (166)
117 PRK14715 DNA polymerase II lar  30.9      41 0.00089   31.6   2.4   39   14-57   1538-1577(1627)
118 PF09723 Zn-ribbon_8:  Zinc rib  30.4      24 0.00052   19.2   0.6   11   16-26     24-34  (42)
119 smart00109 C1 Protein kinase C  30.3      31 0.00068   17.9   1.1   25   19-45     12-37  (49)
120 PRK07218 replication factor A;  30.2      30 0.00066   27.8   1.4   18   20-43    299-317 (423)
121 cd01413 SIR2_Af2 SIR2_Af2: Arc  30.1      55  0.0012   23.3   2.6   39   16-57    111-158 (222)
122 PF02943 FeThRed_B:  Ferredoxin  29.9      22 0.00047   23.7   0.4   33   16-49     42-91  (108)
123 COG2816 NPY1 NTP pyrophosphohy  29.2      32 0.00069   26.5   1.3   46   14-59    107-157 (279)
124 PRK06260 threonine synthase; V  29.0      47   0.001   25.5   2.2   30   18-49      3-33  (397)
125 PF10955 DUF2757:  Protein of u  28.9      30 0.00066   21.9   1.0   16   18-33      4-19  (76)
126 PF08600 Rsm1:  Rsm1-like;  Int  28.5      37  0.0008   21.4   1.3   21   16-37     17-37  (91)
127 COG1933 Archaeal DNA polymeras  28.3      35 0.00075   26.2   1.4   39   15-57    164-203 (253)
128 PF09855 DUF2082:  Nucleic-acid  28.3      29 0.00062   21.1   0.8    8   20-27      2-9   (64)
129 PF10272 Tmpp129:  Putative tra  28.1      23 0.00051   28.0   0.4   17   12-28    334-350 (358)
130 PF01485 IBR:  IBR domain;  Int  27.9      48   0.001   18.1   1.6   27   19-45     19-50  (64)
131 COG5041 SKB2 Casein kinase II,  27.6      27 0.00059   26.5   0.7   12   15-26    146-157 (242)
132 cd01407 SIR2-fam SIR2 family o  27.3      78  0.0017   22.3   2.9   41   16-57    107-155 (218)
133 PRK07591 threonine synthase; V  27.0      50  0.0011   25.8   2.1   29   18-49     18-47  (421)
134 PF06054 CoiA:  Competence prot  26.9      35 0.00076   26.5   1.2   13   16-28     28-40  (375)
135 PRK06386 replication factor A;  26.5      49  0.0011   26.1   2.0   26   20-53    238-264 (358)
136 smart00647 IBR In Between Ring  26.5      63  0.0014   17.7   1.9   29   16-44     16-49  (64)
137 PF08646 Rep_fac-A_C:  Replicat  26.3      30 0.00066   22.8   0.7   25   19-45     19-47  (146)
138 cd00162 RING RING-finger (Real  26.1      33 0.00071   16.9   0.7   12   17-28     34-45  (45)
139 TIGR00155 pqiA_fam integral me  26.0      41 0.00089   26.6   1.5   15   16-30     31-45  (403)
140 PRK08402 replication factor A;  25.8      45 0.00098   26.1   1.6   10   19-28    213-222 (355)
141 TIGR01374 soxD sarcosine oxida  25.8      32 0.00069   22.2   0.7   44   19-68      2-50  (84)
142 PF09814 HECT_2:  HECT-like Ubi  25.8      66  0.0014   23.9   2.4   32   17-60    192-223 (354)
143 PRK08197 threonine synthase; V  25.3      49  0.0011   25.4   1.7   26   18-45      7-32  (394)
144 COG2888 Predicted Zn-ribbon RN  25.2      39 0.00086   20.8   1.0   11   15-25     24-34  (61)
145 PF07503 zf-HYPF:  HypF finger;  25.2      36 0.00078   18.4   0.7   11   18-28     21-31  (35)
146 PF03884 DUF329:  Domain of unk  25.2      36 0.00078   20.4   0.8   12   18-29      2-13  (57)
147 COG1066 Sms Predicted ATP-depe  25.0      55  0.0012   27.0   2.1   25   17-45      6-31  (456)
148 PF06906 DUF1272:  Protein of u  25.0      35 0.00075   20.8   0.7   10   19-28     42-51  (57)
149 PF15616 TerY-C:  TerY-C metal   24.8      26 0.00057   24.1   0.2   16   14-29     73-88  (131)
150 PHA02942 putative transposase;  24.8      36 0.00078   26.6   0.9   25   19-44    326-351 (383)
151 TIGR02443 conserved hypothetic  24.8      34 0.00074   20.8   0.6    9   19-27     10-18  (59)
152 KOG2807|consensus               24.7      27 0.00058   28.1   0.2   36   16-55    274-310 (378)
153 COG1096 Predicted RNA-binding   24.6      38 0.00082   24.9   0.9   25   19-45    150-175 (188)
154 smart00661 RPOL9 RNA polymeras  24.3      39 0.00084   18.3   0.8   24   20-43      2-28  (52)
155 PRK09521 exosome complex RNA-b  24.3      41 0.00089   23.4   1.1   27   17-44    146-175 (189)
156 COG1867 TRM1 N2,N2-dimethylgua  24.3      52  0.0011   26.5   1.7   26   18-44    240-266 (380)
157 KOG0801|consensus               24.2      42 0.00091   24.8   1.1   16   31-47    134-150 (205)
158 COG0143 MetG Methionyl-tRNA sy  24.0      45 0.00098   27.8   1.4   26   19-49    143-169 (558)
159 COG2956 Predicted N-acetylgluc  24.0      46 0.00099   27.0   1.4   26   16-45    352-378 (389)
160 PF14169 YdjO:  Cold-inducible   23.7      32  0.0007   20.9   0.4   22    3-28     28-49  (59)
161 PRK09678 DNA-binding transcrip  23.6      37 0.00081   21.1   0.7   10   19-28      2-11  (72)
162 PF09889 DUF2116:  Uncharacteri  23.5      39 0.00085   20.3   0.7   10   20-29      5-14  (59)
163 TIGR03655 anti_R_Lar restricti  23.4      41 0.00088   19.0   0.8   26   20-45      3-36  (53)
164 PF14255 Cys_rich_CPXG:  Cystei  23.4      34 0.00075   20.0   0.5   10   19-28      1-10  (52)
165 cd00029 C1 Protein kinase C co  23.4      34 0.00073   18.0   0.4   26   19-45     12-38  (50)
166 cd00246 RabGEF Nucleotide exch  23.3      43 0.00092   22.4   0.9   11   18-28      2-12  (103)
167 PF09151 DUF1936:  Domain of un  23.2      43 0.00093   18.5   0.8    9   19-27      2-10  (36)
168 PF10083 DUF2321:  Uncharacteri  23.2      50  0.0011   23.7   1.3   13   19-31     40-52  (158)
169 PRK12366 replication factor A;  23.2      52  0.0011   27.5   1.6   29   19-50    533-562 (637)
170 PF14690 zf-ISL3:  zinc-finger   23.1      41  0.0009   17.9   0.7   10   19-28      3-12  (47)
171 PF09526 DUF2387:  Probable met  22.9      39 0.00084   20.9   0.6   27   19-45      9-40  (71)
172 COG1905 NuoE NADH:ubiquinone o  22.7      52  0.0011   23.4   1.3   24   27-53    113-138 (160)
173 PF12387 Peptidase_C74:  Pestiv  22.5      54  0.0012   24.3   1.4   28   15-47    159-187 (200)
174 COG3677 Transposase and inacti  22.3      37  0.0008   22.9   0.5   32   14-45     26-63  (129)
175 COG0675 Transposase and inacti  22.1      41 0.00088   23.6   0.7   31   18-53    309-344 (364)
176 PRK14701 reverse gyrase; Provi  21.5      39 0.00085   31.5   0.6   24   19-42      7-31  (1638)
177 smart00440 ZnF_C2C2 C2C2 Zinc   21.4      57  0.0012   17.7   1.0   12   20-31      2-13  (40)
178 PF06170 DUF983:  Protein of un  21.2      41  0.0009   21.3   0.5   19   15-33      5-23  (86)
179 PRK13130 H/ACA RNA-protein com  21.0      51  0.0011   19.7   0.9   12   17-28     16-27  (56)
180 TIGR00373 conserved hypothetic  21.0      44 0.00096   23.0   0.7    8   21-28    112-119 (158)
181 PF13913 zf-C2HC_2:  zinc-finge  20.9      46 0.00099   16.3   0.6   11   19-29      3-13  (25)
182 PF04475 DUF555:  Protein of un  20.6      50  0.0011   22.2   0.9   13   16-28     45-57  (102)
183 PRK12496 hypothetical protein;  20.5      45 0.00097   23.2   0.6   10   20-29    145-154 (164)
184 TIGR01054 rgy reverse gyrase.   20.5      47   0.001   29.8   0.9   25   19-43      8-33  (1171)
185 PRK11788 tetratricopeptide rep  20.4      87  0.0019   22.6   2.1   27   16-46    352-379 (389)
186 cd00729 rubredoxin_SM Rubredox  20.2      41 0.00088   17.7   0.3   13   19-31     19-31  (34)

No 1  
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=92.18  E-value=0.094  Score=34.87  Aligned_cols=33  Identities=27%  Similarity=0.651  Sum_probs=27.3

Q ss_pred             ccceeeCCCCCCccceeecCCCCCCC-CCCcccce
Q psy10712         15 LKDKLKCPNCSTNLGAFDYVSGHKCP-CKQQCVPF   48 (75)
Q Consensus        15 ~~GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v~Pa   48 (75)
                      +--|-.||+|++|.=-+|= .-.-|+ ||+-+.|.
T Consensus         6 lGtKR~Cp~CG~kFYDLnk-~PivCP~CG~~~~~~   39 (108)
T PF09538_consen    6 LGTKRTCPSCGAKFYDLNK-DPIVCPKCGTEFPPE   39 (108)
T ss_pred             cCCcccCCCCcchhccCCC-CCccCCCCCCccCcc
Confidence            3457889999999877777 678898 99988777


No 2  
>smart00714 LITAF Possible membrane-associated motif in LPS-induced tumor necrosis factor alpha factor (LITAF), also known as PIG7, and other animal proteins.
Probab=91.75  E-value=0.086  Score=31.40  Aligned_cols=18  Identities=33%  Similarity=0.798  Sum_probs=15.4

Q ss_pred             ccceeeCCCCCCccceee
Q psy10712         15 LKDKLKCPNCSTNLGAFD   32 (75)
Q Consensus        15 ~~GKL~CP~C~aKLGsf~   32 (75)
                      .+-.-+||+|++.||.|+
T Consensus        49 kd~~H~Cp~C~~~lg~~~   66 (67)
T smart00714       49 KDVNHYCPNCGAFLGTYN   66 (67)
T ss_pred             cCccEECCCCCCEeEEec
Confidence            456689999999999985


No 3  
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=90.32  E-value=0.37  Score=26.84  Aligned_cols=27  Identities=30%  Similarity=0.832  Sum_probs=18.4

Q ss_pred             eeCCCCCCccceeecCCCCCCC-CCCcc
Q psy10712         19 LKCPNCSTNLGAFDYVSGHKCP-CKQQC   45 (75)
Q Consensus        19 L~CP~C~aKLGsf~wv~G~kCs-CG~~v   45 (75)
                      ..||+|++.+=.-.-....+|+ ||.-+
T Consensus         4 y~C~~CG~~~~~~~~~~~~~Cp~CG~~~   31 (46)
T PRK00398          4 YKCARCGREVELDEYGTGVRCPYCGYRI   31 (46)
T ss_pred             EECCCCCCEEEECCCCCceECCCCCCeE
Confidence            5799999987433332367898 99654


No 4  
>PF10601 zf-LITAF-like:  LITAF-like zinc ribbon domain;  InterPro: IPR006629 Members of this family display a conserved zinc ribbon structure [] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS). The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure []. 
Probab=90.21  E-value=0.16  Score=30.67  Aligned_cols=18  Identities=33%  Similarity=0.713  Sum_probs=15.2

Q ss_pred             ccceeeCCCCCCccceee
Q psy10712         15 LKDKLKCPNCSTNLGAFD   32 (75)
Q Consensus        15 ~~GKL~CP~C~aKLGsf~   32 (75)
                      .+=..+||+|++.||.|+
T Consensus        55 kd~~H~Cp~C~~~lg~~~   72 (73)
T PF10601_consen   55 KDVYHYCPNCGAFLGTYK   72 (73)
T ss_pred             cCceEECCCCCCEeEEEe
Confidence            455688999999999985


No 5  
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=89.96  E-value=0.21  Score=34.70  Aligned_cols=35  Identities=23%  Similarity=0.295  Sum_probs=28.4

Q ss_pred             ccceeeCCCCCCccceeecCCCCCCC-CCCcccceEE
Q psy10712         15 LKDKLKCPNCSTNLGAFDYVSGHKCP-CKQQCVPFIH   50 (75)
Q Consensus        15 ~~GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v~Paf~   50 (75)
                      +--|-.||+|++|.=-.|= .-.-|+ ||+-+.|...
T Consensus         6 lGtKr~Cp~cg~kFYDLnk-~p~vcP~cg~~~~~~~~   41 (129)
T TIGR02300         6 LGTKRICPNTGSKFYDLNR-RPAVSPYTGEQFPPEEA   41 (129)
T ss_pred             hCccccCCCcCccccccCC-CCccCCCcCCccCcchh
Confidence            3457889999999877777 788997 9999888843


No 6  
>PF12773 DZR:  Double zinc ribbon
Probab=87.16  E-value=0.34  Score=26.92  Aligned_cols=32  Identities=38%  Similarity=0.694  Sum_probs=23.5

Q ss_pred             cceeeCCCCCCccceeecCCCCCCC-CCCcccce
Q psy10712         16 KDKLKCPNCSTNLGAFDYVSGHKCP-CKQQCVPF   48 (75)
Q Consensus        16 ~GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v~Pa   48 (75)
                      .+...||+|+++|....= ....|+ ||+-+.+.
T Consensus        10 ~~~~fC~~CG~~l~~~~~-~~~~C~~Cg~~~~~~   42 (50)
T PF12773_consen   10 DDAKFCPHCGTPLPPPDQ-SKKICPNCGAENPPN   42 (50)
T ss_pred             ccccCChhhcCChhhccC-CCCCCcCCcCCCcCC
Confidence            456789999999984444 467895 99876554


No 7  
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=85.69  E-value=0.55  Score=26.23  Aligned_cols=14  Identities=21%  Similarity=0.873  Sum_probs=11.2

Q ss_pred             ccccceeeCCCCCCc
Q psy10712         13 NFLKDKLKCPNCSTN   27 (75)
Q Consensus        13 ~~~~GKL~CP~C~aK   27 (75)
                      -|-+| ..||+|++.
T Consensus        14 RW~~g-~~CP~Cg~~   27 (46)
T PF12760_consen   14 RWPDG-FVCPHCGST   27 (46)
T ss_pred             cCCCC-CCCCCCCCe
Confidence            46677 779999997


No 8  
>PF13408 Zn_ribbon_recom:  Recombinase zinc beta ribbon domain
Probab=82.38  E-value=1.2  Score=24.72  Aligned_cols=21  Identities=24%  Similarity=0.594  Sum_probs=18.1

Q ss_pred             ccceeeCCCCCCccceeecCCC
Q psy10712         15 LKDKLKCPNCSTNLGAFDYVSG   36 (75)
Q Consensus        15 ~~GKL~CP~C~aKLGsf~wv~G   36 (75)
                      ..|+|.|+.|+.++-...+ .+
T Consensus         2 l~g~l~C~~CG~~m~~~~~-~~   22 (58)
T PF13408_consen    2 LSGLLRCGHCGSKMTRRKR-KG   22 (58)
T ss_pred             CCCcEEcccCCcEeEEEEC-CC
Confidence            5789999999999998888 44


No 9  
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=81.80  E-value=0.98  Score=23.14  Aligned_cols=21  Identities=33%  Similarity=0.936  Sum_probs=15.0

Q ss_pred             eCCCCCCccceeecCCCCCCC-CCCc
Q psy10712         20 KCPNCSTNLGAFDYVSGHKCP-CKQQ   44 (75)
Q Consensus        20 ~CP~C~aKLGsf~wv~G~kCs-CG~~   44 (75)
                      .||.|++.+    -++-..|+ ||.-
T Consensus         2 ~CP~C~~~V----~~~~~~Cp~CG~~   23 (26)
T PF10571_consen    2 TCPECGAEV----PESAKFCPHCGYD   23 (26)
T ss_pred             cCCCCcCCc----hhhcCcCCCCCCC
Confidence            488888888    22567787 8863


No 10 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=81.40  E-value=0.92  Score=24.51  Aligned_cols=11  Identities=36%  Similarity=1.114  Sum_probs=8.9

Q ss_pred             eeeCCCCCCcc
Q psy10712         18 KLKCPNCSTNL   28 (75)
Q Consensus        18 KL~CP~C~aKL   28 (75)
                      +|.||+|+++.
T Consensus         2 ~i~Cp~C~~~y   12 (36)
T PF13717_consen    2 IITCPNCQAKY   12 (36)
T ss_pred             EEECCCCCCEE
Confidence            58899999863


No 11 
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=79.59  E-value=0.74  Score=31.08  Aligned_cols=27  Identities=37%  Similarity=0.800  Sum_probs=15.4

Q ss_pred             CCCCCCccceeecCCCCCCC-CCCcccceEEE
Q psy10712         21 CPNCSTNLGAFDYVSGHKCP-CKQQCVPFIHL   51 (75)
Q Consensus        21 CP~C~aKLGsf~wv~G~kCs-CG~~v~Paf~i   51 (75)
                      ||.|+.+|    =|+..+|+ |++-|.=.|.+
T Consensus         1 CPvCg~~l----~vt~l~C~~C~t~i~G~F~l   28 (113)
T PF09862_consen    1 CPVCGGEL----VVTRLKCPSCGTEIEGEFEL   28 (113)
T ss_pred             CCCCCCce----EEEEEEcCCCCCEEEeeecc
Confidence            66666655    23556664 66666555544


No 12 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=77.49  E-value=0.86  Score=22.88  Aligned_cols=13  Identities=46%  Similarity=0.986  Sum_probs=8.4

Q ss_pred             cceeeCCCCCCcc
Q psy10712         16 KDKLKCPNCSTNL   28 (75)
Q Consensus        16 ~GKL~CP~C~aKL   28 (75)
                      .+--.||+|+++|
T Consensus        14 ~~~~fC~~CG~~L   26 (26)
T PF13248_consen   14 PDAKFCPNCGAKL   26 (26)
T ss_pred             cccccChhhCCCC
Confidence            3445677777765


No 13 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=77.42  E-value=1.5  Score=23.70  Aligned_cols=10  Identities=50%  Similarity=1.271  Sum_probs=8.0

Q ss_pred             eeeCCCCCCc
Q psy10712         18 KLKCPNCSTN   27 (75)
Q Consensus        18 KL~CP~C~aK   27 (75)
                      ++.||+|+++
T Consensus         2 ~i~CP~C~~~   11 (37)
T PF13719_consen    2 IITCPNCQTR   11 (37)
T ss_pred             EEECCCCCce
Confidence            4789999874


No 14 
>PRK00420 hypothetical protein; Validated
Probab=76.78  E-value=1.7  Score=29.28  Aligned_cols=26  Identities=23%  Similarity=0.459  Sum_probs=20.0

Q ss_pred             eeCCCCCCccceeecCCCCCCC-CCCcc
Q psy10712         19 LKCPNCSTNLGAFDYVSGHKCP-CKQQC   45 (75)
Q Consensus        19 L~CP~C~aKLGsf~wv~G~kCs-CG~~v   45 (75)
                      -+||.|++.|=.++= .-..|+ ||..+
T Consensus        24 ~~CP~Cg~pLf~lk~-g~~~Cp~Cg~~~   50 (112)
T PRK00420         24 KHCPVCGLPLFELKD-GEVVCPVHGKVY   50 (112)
T ss_pred             CCCCCCCCcceecCC-CceECCCCCCee
Confidence            679999998866655 567886 99854


No 15 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=76.51  E-value=1.4  Score=29.87  Aligned_cols=18  Identities=28%  Similarity=0.761  Sum_probs=13.6

Q ss_pred             ccceeeCCCCCCccceee
Q psy10712         15 LKDKLKCPNCSTNLGAFD   32 (75)
Q Consensus        15 ~~GKL~CP~C~aKLGsf~   32 (75)
                      .+|++.||+|++.|=.++
T Consensus       120 ~~~~f~Cp~Cg~~l~~~d  137 (147)
T smart00531      120 MDGTFTCPRCGEELEEDD  137 (147)
T ss_pred             CCCcEECCCCCCEEEEcC
Confidence            368899999998885543


No 16 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=76.00  E-value=1.8  Score=22.84  Aligned_cols=13  Identities=23%  Similarity=0.670  Sum_probs=10.4

Q ss_pred             cceeeCCCCCCcc
Q psy10712         16 KDKLKCPNCSTNL   28 (75)
Q Consensus        16 ~GKL~CP~C~aKL   28 (75)
                      .+++.||+|+..+
T Consensus        23 ~~~v~C~~C~~~~   35 (38)
T TIGR02098        23 GGKVRCGKCGHVW   35 (38)
T ss_pred             CCEEECCCCCCEE
Confidence            4589999999865


No 17 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=75.59  E-value=1.3  Score=21.96  Aligned_cols=21  Identities=33%  Similarity=1.007  Sum_probs=13.4

Q ss_pred             eCCCCCCccceeecCCCCCCC-CCCc
Q psy10712         20 KCPNCSTNLGAFDYVSGHKCP-CKQQ   44 (75)
Q Consensus        20 ~CP~C~aKLGsf~wv~G~kCs-CG~~   44 (75)
                      .||+|+++|=.    ...-|+ ||+-
T Consensus         1 ~Cp~CG~~~~~----~~~fC~~CG~~   22 (23)
T PF13240_consen    1 YCPNCGAEIED----DAKFCPNCGTP   22 (23)
T ss_pred             CCcccCCCCCC----cCcchhhhCCc
Confidence            48999988831    345565 7653


No 18 
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=73.87  E-value=1.7  Score=25.89  Aligned_cols=14  Identities=29%  Similarity=0.947  Sum_probs=11.7

Q ss_pred             ccccceeeCCCCCC
Q psy10712         13 NFLKDKLKCPNCST   26 (75)
Q Consensus        13 ~~~~GKL~CP~C~a   26 (75)
                      +..+|.|.||+|+.
T Consensus        48 ~i~eg~L~Cp~c~r   61 (68)
T PF03966_consen   48 EIVEGELICPECGR   61 (68)
T ss_dssp             ETTTTEEEETTTTE
T ss_pred             cccCCEEEcCCCCC
Confidence            45789999999974


No 19 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=72.72  E-value=1.3  Score=24.09  Aligned_cols=24  Identities=33%  Similarity=0.704  Sum_probs=15.8

Q ss_pred             eeCCCCCCccceeecCCC-CCC-CCCCc
Q psy10712         19 LKCPNCSTNLGAFDYVSG-HKC-PCKQQ   44 (75)
Q Consensus        19 L~CP~C~aKLGsf~wv~G-~kC-sCG~~   44 (75)
                      +.|+.|+++  .|....| .-| +||.-
T Consensus         9 ~~C~~C~~~--~~~~~dG~~yC~~cG~~   34 (36)
T PF11781_consen    9 EPCPVCGSR--WFYSDDGFYYCDRCGHQ   34 (36)
T ss_pred             CcCCCCCCe--EeEccCCEEEhhhCceE
Confidence            569999999  4544444 357 77753


No 20 
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=71.76  E-value=3.4  Score=26.37  Aligned_cols=34  Identities=24%  Similarity=0.664  Sum_probs=25.4

Q ss_pred             cccceeeCCCCCCccceeecC-------CCCCCC-CCCcccc
Q psy10712         14 FLKDKLKCPNCSTNLGAFDYV-------SGHKCP-CKQQCVP   47 (75)
Q Consensus        14 ~~~GKL~CP~C~aKLGsf~wv-------~G~kCs-CG~~v~P   47 (75)
                      ...++=.||+|+.+|.-++-|       ..-+|. |++-+.+
T Consensus        29 i~~~rS~C~~C~~~L~~~~lIPi~S~l~lrGrCr~C~~~I~~   70 (92)
T PF06750_consen   29 IIFPRSHCPHCGHPLSWWDLIPILSYLLLRGRCRYCGAPIPP   70 (92)
T ss_pred             ccCCCCcCcCCCCcCcccccchHHHHHHhCCCCcccCCCCCh
Confidence            345678999999999876643       477886 8877654


No 21 
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=71.71  E-value=4.2  Score=26.77  Aligned_cols=37  Identities=16%  Similarity=0.500  Sum_probs=23.9

Q ss_pred             cccceeeCCCCCCccceeecCCCCCCC-CCCcccceEEEEcC
Q psy10712         14 FLKDKLKCPNCSTNLGAFDYVSGHKCP-CKQQCVPFIHLVKS   54 (75)
Q Consensus        14 ~~~GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v~Paf~i~kS   54 (75)
                      +..++..|+.|+...-.-.+ .-..|+ ||..   .+.|...
T Consensus        66 ~~p~~~~C~~Cg~~~~~~~~-~~~~CP~Cgs~---~~~i~~G  103 (114)
T PRK03681         66 EQEAECWCETCQQYVTLLTQ-RVRRCPQCHGD---MLRIVAD  103 (114)
T ss_pred             eeCcEEEcccCCCeeecCCc-cCCcCcCcCCC---CcEEccC
Confidence            46789999999975443333 236798 9954   4555443


No 22 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=70.78  E-value=4.6  Score=26.52  Aligned_cols=36  Identities=17%  Similarity=0.466  Sum_probs=23.1

Q ss_pred             cccceeeCCCCCCccceeecCCCCCCC-CCCcccceEEEEcC
Q psy10712         14 FLKDKLKCPNCSTNLGAFDYVSGHKCP-CKQQCVPFIHLVKS   54 (75)
Q Consensus        14 ~~~GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v~Paf~i~kS   54 (75)
                      +..++..|+.|+.....-.+  ...|+ ||..   .+.|...
T Consensus        66 ~vp~~~~C~~Cg~~~~~~~~--~~~CP~Cgs~---~~~i~~G  102 (113)
T PRK12380         66 YKPAQAWCWDCSQVVEIHQH--DAQCPHCHGE---RLRVDTG  102 (113)
T ss_pred             eeCcEEEcccCCCEEecCCc--CccCcCCCCC---CcEEccC
Confidence            36789999999964433222  34598 9953   5555544


No 23 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=70.73  E-value=2.7  Score=22.52  Aligned_cols=24  Identities=21%  Similarity=0.720  Sum_probs=11.8

Q ss_pred             CCCCCCccceeecCCCCCCC-CCCcc
Q psy10712         21 CPNCSTNLGAFDYVSGHKCP-CKQQC   45 (75)
Q Consensus        21 CP~C~aKLGsf~wv~G~kCs-CG~~v   45 (75)
                      |..|++.+- +..-...+|. ||..|
T Consensus         3 C~~Cg~~~~-~~~~~~irC~~CG~RI   27 (32)
T PF03604_consen    3 CGECGAEVE-LKPGDPIRCPECGHRI   27 (32)
T ss_dssp             ESSSSSSE--BSTSSTSSBSSSS-SE
T ss_pred             CCcCCCeeE-cCCCCcEECCcCCCeE
Confidence            556666655 2232456665 66554


No 24 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=70.44  E-value=2.5  Score=23.91  Aligned_cols=13  Identities=31%  Similarity=0.905  Sum_probs=10.8

Q ss_pred             cceeeCCCCCCcc
Q psy10712         16 KDKLKCPNCSTNL   28 (75)
Q Consensus        16 ~GKL~CP~C~aKL   28 (75)
                      .+.+.||+|+.|+
T Consensus        17 ~~~irC~~CG~rI   29 (44)
T smart00659       17 KDVVRCRECGYRI   29 (44)
T ss_pred             CCceECCCCCceE
Confidence            4679999999886


No 25 
>PRK11823 DNA repair protein RadA; Provisional
Probab=70.38  E-value=2.8  Score=33.15  Aligned_cols=25  Identities=20%  Similarity=0.567  Sum_probs=20.7

Q ss_pred             ceeeCCCCCCccceeecCCCCCCC-CCCcc
Q psy10712         17 DKLKCPNCSTNLGAFDYVSGHKCP-CKQQC   45 (75)
Q Consensus        17 GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v   45 (75)
                      -.-.|.+|+..-..|-|    ||+ |++|=
T Consensus         6 ~~y~C~~Cg~~~~~~~g----~Cp~C~~w~   31 (446)
T PRK11823          6 TAYVCQECGAESPKWLG----RCPECGAWN   31 (446)
T ss_pred             CeEECCcCCCCCcccCe----eCcCCCCcc
Confidence            34679999999888777    796 99996


No 26 
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=69.16  E-value=2  Score=22.17  Aligned_cols=10  Identities=40%  Similarity=1.062  Sum_probs=5.4

Q ss_pred             eCCCCCCccc
Q psy10712         20 KCPNCSTNLG   29 (75)
Q Consensus        20 ~CP~C~aKLG   29 (75)
                      .||.|+++|=
T Consensus         1 ~CP~C~s~l~   10 (28)
T PF03119_consen    1 TCPVCGSKLV   10 (28)
T ss_dssp             B-TTT--BEE
T ss_pred             CcCCCCCEeE
Confidence            4899998885


No 27 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=66.49  E-value=3.1  Score=24.29  Aligned_cols=25  Identities=24%  Similarity=0.583  Sum_probs=19.3

Q ss_pred             eeCCCCCCccce-eecCCCCCCC-CCCc
Q psy10712         19 LKCPNCSTNLGA-FDYVSGHKCP-CKQQ   44 (75)
Q Consensus        19 L~CP~C~aKLGs-f~wv~G~kCs-CG~~   44 (75)
                      -.||.|+.+... .+. ....|+ ||..
T Consensus        29 q~C~~CG~~~~~~~~~-r~~~C~~Cg~~   55 (69)
T PF07282_consen   29 QTCPRCGHRNKKRRSG-RVFTCPNCGFE   55 (69)
T ss_pred             cCccCccccccccccc-ceEEcCCCCCE
Confidence            359999999987 555 578888 8874


No 28 
>PF08996 zf-DNA_Pol:  DNA Polymerase alpha zinc finger;  InterPro: IPR015088 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNA Polymerase alpha zinc finger domain adopts an alpha-helix-like structure, followed by three turns, all of which involve proline. The resulting motif is a helix-turn-helix motif, in contrast to other zinc finger domains, which show anti-parallel sheet and helix conformation. Zinc binding occurs due to the presence of four cysteine residues positioned to bind the metal centre in a tetrahedral coordination geometry. The function of this domain is uncertain: it has been proposed that the zinc finger motif may be an essential part of the DNA binding domain [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0001882 nucleoside binding, 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication; PDB: 3FLO_D 1N5G_A 1K0P_A 1K18_A.
Probab=66.33  E-value=1.6  Score=30.69  Aligned_cols=32  Identities=44%  Similarity=0.989  Sum_probs=15.8

Q ss_pred             cceeeCCCCCCcc---ceee-------cCCCCCCC-CCCcccce
Q psy10712         16 KDKLKCPNCSTNL---GAFD-------YVSGHKCP-CKQQCVPF   48 (75)
Q Consensus        16 ~GKL~CP~C~aKL---Gsf~-------wv~G~kCs-CG~~v~Pa   48 (75)
                      .=++.||+|+...   |.|.       + +|..|+ |++.+.|+
T Consensus        16 ~l~~~C~~C~~~~~f~g~~~~~~~~~~~-~~~~C~~C~~~~~~~   58 (188)
T PF08996_consen   16 PLKLTCPSCGTEFEFPGVFEEDGDDVSP-SGLQCPNCSTPLSPA   58 (188)
T ss_dssp             -EEEE-TTT--EEEE-SSS--SSEEEET-TEEEETTT--B--HH
T ss_pred             ceEeECCCCCCCccccccccCCcccccc-CcCcCCCCCCcCCHH
Confidence            3468999998764   3333       5 688897 99866544


No 29 
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=66.05  E-value=4.3  Score=22.59  Aligned_cols=31  Identities=16%  Similarity=0.357  Sum_probs=23.5

Q ss_pred             eeCCCCCCccceeecCCCCCCC-CCCcccceEEE
Q psy10712         19 LKCPNCSTNLGAFDYVSGHKCP-CKQQCVPFIHL   51 (75)
Q Consensus        19 L~CP~C~aKLGsf~wv~G~kCs-CG~~v~Paf~i   51 (75)
                      -.|+.|+.++|.|..  ...|. ||..+-..-.-
T Consensus         3 ~~C~~C~~~F~~~~r--k~~Cr~Cg~~~C~~C~~   34 (57)
T cd00065           3 SSCMGCGKPFTLTRR--RHHCRNCGRIFCSKCSS   34 (57)
T ss_pred             CcCcccCccccCCcc--ccccCcCcCCcChHHcC
Confidence            368999999999887  67785 99887654433


No 30 
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=65.55  E-value=3.6  Score=32.03  Aligned_cols=22  Identities=27%  Similarity=0.611  Sum_probs=17.9

Q ss_pred             eCCCCCCccceeecCCCCCCC-CCCcc
Q psy10712         20 KCPNCSTNLGAFDYVSGHKCP-CKQQC   45 (75)
Q Consensus        20 ~CP~C~aKLGsf~wv~G~kCs-CG~~v   45 (75)
                      .|.+|+..-..|-|    ||+ ||+|=
T Consensus         2 ~c~~cg~~~~~~~g----~cp~c~~w~   24 (372)
T cd01121           2 VCSECGYVSPKWLG----KCPECGEWN   24 (372)
T ss_pred             CCCCCCCCCCCccE----ECcCCCCce
Confidence            48999998777666    786 99996


No 31 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=65.44  E-value=5.9  Score=26.02  Aligned_cols=36  Identities=17%  Similarity=0.488  Sum_probs=22.8

Q ss_pred             cccceeeCCCCCCccceeecCCCCCCC-CCCcccceEEEEcC
Q psy10712         14 FLKDKLKCPNCSTNLGAFDYVSGHKCP-CKQQCVPFIHLVKS   54 (75)
Q Consensus        14 ~~~GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v~Paf~i~kS   54 (75)
                      +...+..|++|+..... .. ....|+ ||..   .+.|...
T Consensus        66 ~~p~~~~C~~Cg~~~~~-~~-~~~~CP~Cgs~---~~~i~~G  102 (115)
T TIGR00100        66 DEPVECECEDCSEEVSP-EI-DLYRCPKCHGI---MLQVRAG  102 (115)
T ss_pred             eeCcEEEcccCCCEEec-CC-cCccCcCCcCC---CcEEecC
Confidence            35788999999955433 22 256796 9964   3444443


No 32 
>PF14599 zinc_ribbon_6:  Zinc-ribbon; PDB: 2K2D_A.
Probab=63.37  E-value=4  Score=24.74  Aligned_cols=31  Identities=29%  Similarity=0.695  Sum_probs=13.9

Q ss_pred             ccceeeCCCCCCccc-eeecCCCCCCC-CCCccc
Q psy10712         15 LKDKLKCPNCSTNLG-AFDYVSGHKCP-CKQQCV   46 (75)
Q Consensus        15 ~~GKL~CP~C~aKLG-sf~wv~G~kCs-CG~~v~   46 (75)
                      ....|.|--|++|== .|-| =|.||+ ||.+-|
T Consensus        27 ~~v~IlCNDC~~~s~v~fH~-lg~KC~~C~SYNT   59 (61)
T PF14599_consen   27 KKVWILCNDCNAKSEVPFHF-LGHKCSHCGSYNT   59 (61)
T ss_dssp             -EEEEEESSS--EEEEE--T-T----TTTS---E
T ss_pred             CEEEEECCCCCCccceeeeH-hhhcCCCCCCccc
Confidence            356799977998754 5777 499997 998743


No 33 
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=61.92  E-value=4.8  Score=32.00  Aligned_cols=25  Identities=28%  Similarity=0.764  Sum_probs=20.3

Q ss_pred             ceeeCCCCCCccceeecCCCCCCC-CCCcc
Q psy10712         17 DKLKCPNCSTNLGAFDYVSGHKCP-CKQQC   45 (75)
Q Consensus        17 GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v   45 (75)
                      -.-.|.+|+..=-.|-|    ||+ |++|=
T Consensus         6 ~~y~C~~Cg~~~~~~~g----~Cp~C~~w~   31 (454)
T TIGR00416         6 SKFVCQHCGADSPKWQG----KCPACHAWN   31 (454)
T ss_pred             CeEECCcCCCCCccccE----ECcCCCCcc
Confidence            34789999999777766    896 99995


No 34 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=61.24  E-value=4.7  Score=27.98  Aligned_cols=12  Identities=25%  Similarity=0.697  Sum_probs=9.6

Q ss_pred             ccceeeCCCCCC
Q psy10712         15 LKDKLKCPNCST   26 (75)
Q Consensus        15 ~~GKL~CP~C~a   26 (75)
                      .+|+++||.|+-
T Consensus        41 KdG~v~CPvC~~   52 (131)
T COG1645          41 KDGEVFCPVCGY   52 (131)
T ss_pred             eCCeEECCCCCc
Confidence            578888888874


No 35 
>PRK05638 threonine synthase; Validated
Probab=58.93  E-value=6.7  Score=30.66  Aligned_cols=28  Identities=25%  Similarity=0.597  Sum_probs=21.2

Q ss_pred             eeeCCCCCCccceeecCCCCCCCCCCcccce
Q psy10712         18 KLKCPNCSTNLGAFDYVSGHKCPCKQQCVPF   48 (75)
Q Consensus        18 KL~CP~C~aKLGsf~wv~G~kCsCG~~v~Pa   48 (75)
                      ||.|++|+..... ++ . ..|.||..+...
T Consensus         1 ~l~C~~Cg~~~~~-~~-~-~~C~c~~~l~~~   28 (442)
T PRK05638          1 KMKCPKCGREYNS-YI-P-PFCICGELLEII   28 (442)
T ss_pred             CeEeCCCCCCCCC-CC-c-eecCCCCcEEEE
Confidence            7899999999873 45 3 779999776444


No 36 
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=58.13  E-value=4.4  Score=21.94  Aligned_cols=17  Identities=35%  Similarity=0.778  Sum_probs=13.6

Q ss_pred             eCCCCCCccceeecCCCC
Q psy10712         20 KCPNCSTNLGAFDYVSGH   37 (75)
Q Consensus        20 ~CP~C~aKLGsf~wv~G~   37 (75)
                      +||+|+..|-.... .+.
T Consensus         1 ~CP~C~~~l~~~~~-~~~   17 (41)
T PF13453_consen    1 KCPRCGTELEPVRL-GDV   17 (41)
T ss_pred             CcCCCCcccceEEE-CCE
Confidence            59999999988877 554


No 37 
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=57.20  E-value=14  Score=24.31  Aligned_cols=36  Identities=19%  Similarity=0.450  Sum_probs=22.2

Q ss_pred             ccceeeCCCCCCccceeecCCCCCCC-CCCcccceEEEEcC
Q psy10712         15 LKDKLKCPNCSTNLGAFDYVSGHKCP-CKQQCVPFIHLVKS   54 (75)
Q Consensus        15 ~~GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v~Paf~i~kS   54 (75)
                      ...+..|+.|+... ......-.+|+ ||..   .+.|...
T Consensus        68 vp~~~~C~~Cg~~~-~~~~~~~~~CP~Cgs~---~~~i~~G  104 (117)
T PRK00564         68 EKVELECKDCSHVF-KPNALDYGVCEKCHSK---NVIITQG  104 (117)
T ss_pred             cCCEEEhhhCCCcc-ccCCccCCcCcCCCCC---ceEEecC
Confidence            57889999999543 33220234697 9964   4555543


No 38 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=56.75  E-value=2.2  Score=24.77  Aligned_cols=34  Identities=32%  Similarity=0.693  Sum_probs=24.4

Q ss_pred             eCCCCCCccceee---cCCCCCCC-CCCcccceEEEEc
Q psy10712         20 KCPNCSTNLGAFD---YVSGHKCP-CKQQCVPFIHLVK   53 (75)
Q Consensus        20 ~CP~C~aKLGsf~---wv~G~kCs-CG~~v~Paf~i~k   53 (75)
                      .|+-|+.|+|-|.   ...|.-|. |-..++|.+...+
T Consensus         1 ~C~iCg~kigl~~~~k~~DG~iC~~C~~Kl~~~~~~~~   38 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDGYICKDCLKKLSGFFSDVK   38 (51)
T ss_pred             CCCccccccccccceeccCccchHHHHHHhcCcccchh
Confidence            3888999999887   65677784 7777766664433


No 39 
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated
Probab=56.56  E-value=5.7  Score=24.22  Aligned_cols=17  Identities=18%  Similarity=0.466  Sum_probs=14.3

Q ss_pred             eCCCCCCccceeecCCCC
Q psy10712         20 KCPNCSTNLGAFDYVSGH   37 (75)
Q Consensus        20 ~CP~C~aKLGsf~wv~G~   37 (75)
                      .||+|++..=+.+| .|.
T Consensus        17 ~CP~Cgs~~~T~~W-~G~   33 (61)
T PRK08351         17 RCPVCGSRDLSDEW-FDL   33 (61)
T ss_pred             cCCCCcCCcccccc-ccE
Confidence            59999999888999 563


No 40 
>PF06044 DRP:  Dam-replacing family;  InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements. The replacement of Dam-methylase by DRP allows phase variation through slippage-like mechanisms in several pathogenic isolates of Neisseria meningitidis [].; PDB: 4ESJ_A.
Probab=56.45  E-value=3.1  Score=31.76  Aligned_cols=31  Identities=32%  Similarity=1.034  Sum_probs=12.8

Q ss_pred             ccccceeeCCCCCCc-cceeec---CCCCCCC-CCC
Q psy10712         13 NFLKDKLKCPNCSTN-LGAFDY---VSGHKCP-CKQ   43 (75)
Q Consensus        13 ~~~~GKL~CP~C~aK-LGsf~w---v~G~kCs-CG~   43 (75)
                      .|+....+||+|+++ |-.|.=   |....|. |+.
T Consensus        26 ~Wv~~n~yCP~Cg~~~L~~f~NN~PVaDF~C~~C~e   61 (254)
T PF06044_consen   26 DWVAENMYCPNCGSKPLSKFENNRPVADFYCPNCNE   61 (254)
T ss_dssp             HHHHHH---TTT--SS-EE--------EEE-TTT--
T ss_pred             HHHHHCCcCCCCCChhHhhccCCCccceeECCCCch
Confidence            588999999999999 777743   1233453 665


No 41 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=56.15  E-value=6.8  Score=22.62  Aligned_cols=25  Identities=24%  Similarity=0.586  Sum_probs=13.1

Q ss_pred             eeeCCCCCCccceeecCCCCCCC-CCC
Q psy10712         18 KLKCPNCSTNLGAFDYVSGHKCP-CKQ   43 (75)
Q Consensus        18 KL~CP~C~aKLGsf~wv~G~kCs-CG~   43 (75)
                      +-.||+|++.+=.-.- ....|. ||.
T Consensus        20 ~~fCP~Cg~~~m~~~~-~r~~C~~Cgy   45 (50)
T PRK00432         20 NKFCPRCGSGFMAEHL-DRWHCGKCGY   45 (50)
T ss_pred             cCcCcCCCcchheccC-CcEECCCcCC
Confidence            3489999873111122 345564 553


No 42 
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=55.85  E-value=8.6  Score=25.86  Aligned_cols=38  Identities=18%  Similarity=0.362  Sum_probs=23.2

Q ss_pred             eeCCCCCCccceeecCCCCCCC-CCCcc---cceEEEEcCccc
Q psy10712         19 LKCPNCSTNLGAFDYVSGHKCP-CKQQC---VPFIHLVKSKID   57 (75)
Q Consensus        19 L~CP~C~aKLGsf~wv~G~kCs-CG~~v---~Paf~i~kSkVD   57 (75)
                      ..||+|+.||=..+= ....|. |+..+   .|-+.|+-.=.|
T Consensus        35 ~aC~~C~kkv~~~~~-~~~~C~~C~~~~~~~~~ry~l~~~i~D   76 (166)
T cd04476          35 PACPGCNKKVVEEGN-GTYRCEKCNKSVPNPEYRYILSLNVAD   76 (166)
T ss_pred             ccccccCcccEeCCC-CcEECCCCCCcCCCccEEEEEEEEEEe
Confidence            469999999854431 346775 88764   444555444333


No 43 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=55.12  E-value=9.9  Score=34.92  Aligned_cols=27  Identities=30%  Similarity=0.894  Sum_probs=18.6

Q ss_pred             ceeeCCCCCCccceeecCCCCCCC-CCCcccceE
Q psy10712         17 DKLKCPNCSTNLGAFDYVSGHKCP-CKQQCVPFI   49 (75)
Q Consensus        17 GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v~Paf   49 (75)
                      +...||+|++..-.      ..|+ ||+...|.+
T Consensus       666 ~~rkCPkCG~~t~~------~fCP~CGs~te~vy  693 (1337)
T PRK14714        666 GRRRCPSCGTETYE------NRCPDCGTHTEPVY  693 (1337)
T ss_pred             EEEECCCCCCcccc------ccCcccCCcCCCce
Confidence            56899999986421      2677 888776554


No 44 
>PRK11827 hypothetical protein; Provisional
Probab=53.95  E-value=7.6  Score=23.54  Aligned_cols=15  Identities=27%  Similarity=0.882  Sum_probs=11.7

Q ss_pred             ceeeCCCCCCccceee
Q psy10712         17 DKLKCPNCSTNLGAFD   32 (75)
Q Consensus        17 GKL~CP~C~aKLGsf~   32 (75)
                      .-|.||.|+.+| .|+
T Consensus         7 eILaCP~ckg~L-~~~   21 (60)
T PRK11827          7 EIIACPVCNGKL-WYN   21 (60)
T ss_pred             hheECCCCCCcC-eEc
Confidence            348999999998 454


No 45 
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit. This model represents the large subunit, DP2, of a two subunit novel Archaeal replicative DNA polymerase first characterized for Pyrococcus furiosus. Structure of DP2 appears to be organized as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit.
Probab=53.72  E-value=11  Score=33.88  Aligned_cols=49  Identities=18%  Similarity=0.467  Sum_probs=33.7

Q ss_pred             chhhhHHHhcCccccceeeCCCCCCccceeecCCCCCCC-CCCcccceEEEEcCccc
Q psy10712          2 SDWMRTAVEEGNFLKDKLKCPNCSTNLGAFDYVSGHKCP-CKQQCVPFIHLVKSKID   57 (75)
Q Consensus         2 m~WM~~~i~~~~~~~GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v~Paf~i~kSkVD   57 (75)
                      |+-|.+ +..  +..-+.-|.+|++|-=.---  .-+|. ||..|.+  .+|+.-|.
T Consensus       999 PDl~GN-LRa--FsrQ~fRC~kC~~kYRR~PL--~G~C~kCGg~lil--TV~~GsV~ 1048 (1095)
T TIGR00354       999 PDIIGN-LRA--FSRQEVRCTKCNTKYRRIPL--VGKCLKCGNNLTL--TVSKGSVM 1048 (1095)
T ss_pred             hHhhhh-Hhh--hhccceeecccCCccccCCC--CCcccccCCeEEE--EEecchhH
Confidence            444444 333  35677899999999887777  35896 9999955  45565553


No 46 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=53.67  E-value=6.5  Score=20.52  Aligned_cols=13  Identities=23%  Similarity=0.805  Sum_probs=9.5

Q ss_pred             cceeeCCCCCCcc
Q psy10712         16 KDKLKCPNCSTNL   28 (75)
Q Consensus        16 ~GKL~CP~C~aKL   28 (75)
                      ...+.||.|++.+
T Consensus        24 ~~~~~CP~Cg~~~   36 (41)
T smart00834       24 DPLATCPECGGDV   36 (41)
T ss_pred             CCCCCCCCCCCcc
Confidence            4467899999853


No 47 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=53.37  E-value=7  Score=21.29  Aligned_cols=18  Identities=33%  Similarity=0.577  Sum_probs=12.6

Q ss_pred             ccceeeCCCCCCccceee
Q psy10712         15 LKDKLKCPNCSTNLGAFD   32 (75)
Q Consensus        15 ~~GKL~CP~C~aKLGsf~   32 (75)
                      ..|.+.|++|+.-|....
T Consensus        16 ~~g~~vC~~CG~Vl~e~~   33 (43)
T PF08271_consen   16 ERGELVCPNCGLVLEENI   33 (43)
T ss_dssp             TTTEEEETTT-BBEE-TT
T ss_pred             CCCeEECCCCCCEeeccc
Confidence            578999999988776443


No 48 
>cd01411 SIR2H SIR2H: Uncharacterized prokaryotic Sir2 homologs from several gram positive bacterial species and Fusobacteria; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=52.26  E-value=19  Score=25.82  Aligned_cols=39  Identities=18%  Similarity=0.356  Sum_probs=27.4

Q ss_pred             cceeeCCCCCCccceeecC---CCCCCC-CCCcccceEEEEcCccc
Q psy10712         16 KDKLKCPNCSTNLGAFDYV---SGHKCP-CKQQCVPFIHLVKSKID   57 (75)
Q Consensus        16 ~GKL~CP~C~aKLGsf~wv---~G~kCs-CG~~v~Paf~i~kSkVD   57 (75)
                      -.++.|.+|+..   |+|.   ..-.|+ ||..+.|.+-+.-..++
T Consensus       116 ~~~~~C~~C~~~---~~~~~~~~~p~C~~Cgg~lrP~vv~fge~~~  158 (225)
T cd01411         116 LYRIYCTVCGKT---VDWEEYLKSPYHAKCGGVIRPDIVLYEEMLN  158 (225)
T ss_pred             cCeeEeCCCCCc---cchhhcCCCCCCCCCCCEeCCCEEEcCCCCC
Confidence            346789999654   4431   246796 99999999987665554


No 49 
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=52.24  E-value=8.5  Score=31.23  Aligned_cols=30  Identities=20%  Similarity=0.628  Sum_probs=23.8

Q ss_pred             ccceeeCCCCCCccceeecCCCCCCC-CCCcc
Q psy10712         15 LKDKLKCPNCSTNLGAFDYVSGHKCP-CKQQC   45 (75)
Q Consensus        15 ~~GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v   45 (75)
                      ..-+-.||.|+.++=|=-= +|.+|. ||+-.
T Consensus       347 ~~~~p~Cp~Cg~~m~S~G~-~g~rC~kCg~~~  377 (421)
T COG1571         347 ERVNPVCPRCGGRMKSAGR-NGFRCKKCGTRA  377 (421)
T ss_pred             EEcCCCCCccCCchhhcCC-CCcccccccccC
Confidence            3445689999999977666 589998 99875


No 50 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=52.08  E-value=9.8  Score=32.08  Aligned_cols=27  Identities=26%  Similarity=0.629  Sum_probs=16.1

Q ss_pred             cceeeCCCCCCccceeecCCCCCCC-CCCcccce
Q psy10712         16 KDKLKCPNCSTNLGAFDYVSGHKCP-CKQQCVPF   48 (75)
Q Consensus        16 ~GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v~Pa   48 (75)
                      ++--.||+|+++|..      ..|+ ||+-+.+.
T Consensus        13 ~~akFC~~CG~~l~~------~~Cp~CG~~~~~~   40 (645)
T PRK14559         13 NNNRFCQKCGTSLTH------KPCPQCGTEVPVD   40 (645)
T ss_pred             CCCccccccCCCCCC------CcCCCCCCCCCcc
Confidence            455578888888742      3453 66655443


No 51 
>PRK00241 nudC NADH pyrophosphatase; Reviewed
Probab=51.41  E-value=7.6  Score=28.68  Aligned_cols=35  Identities=20%  Similarity=0.546  Sum_probs=25.0

Q ss_pred             ccccceeeCCCCCCccceeecCCCCCCC-CCCcccc
Q psy10712         13 NFLKDKLKCPNCSTNLGAFDYVSGHKCP-CKQQCVP   47 (75)
Q Consensus        13 ~~~~GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v~P   47 (75)
                      .|....-.||.|++++-...--....|+ ||...-|
T Consensus        94 ~w~~~~~fC~~CG~~~~~~~~~~~~~C~~c~~~~yp  129 (256)
T PRK00241         94 EFYRSHRFCGYCGHPMHPSKTEWAMLCPHCRERYYP  129 (256)
T ss_pred             HHhhcCccccccCCCCeecCCceeEECCCCCCEECC
Confidence            4667778999999998655432356786 9977644


No 52 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=50.48  E-value=7.7  Score=26.21  Aligned_cols=31  Identities=29%  Similarity=0.725  Sum_probs=23.7

Q ss_pred             eCCCCCCccceeecCCCCCCC-CCCcccceEEEEcC
Q psy10712         20 KCPNCSTNLGAFDYVSGHKCP-CKQQCVPFIHLVKS   54 (75)
Q Consensus        20 ~CP~C~aKLGsf~wv~G~kCs-CG~~v~Paf~i~kS   54 (75)
                      .||.|++|+=+.    -..|+ ||-.++-+-+|.||
T Consensus         3 ~CPrC~skvC~L----P~~CpiCgLtLVss~HLARS   34 (112)
T TIGR00622         3 FCPQCRAKVCEL----PVECPICGLTLILSTHLARS   34 (112)
T ss_pred             cCCCCCCCccCC----CCcCCcCCCEEeccchHHHh
Confidence            599999998554    57897 99888666666655


No 53 
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=49.97  E-value=7.8  Score=24.10  Aligned_cols=20  Identities=25%  Similarity=0.463  Sum_probs=15.8

Q ss_pred             ceeeCCCCCCccceeecCCCC
Q psy10712         17 DKLKCPNCSTNLGAFDYVSGH   37 (75)
Q Consensus        17 GKL~CP~C~aKLGsf~wv~G~   37 (75)
                      +.-.||.|++.==+++| .|+
T Consensus        17 d~e~CP~Cgs~~~te~W-~G~   36 (64)
T COG2093          17 DTEICPVCGSTDLTEEW-FGL   36 (64)
T ss_pred             CCccCCCCCCcccchhh-ccE
Confidence            34569999999669999 674


No 54 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=49.78  E-value=8.7  Score=32.96  Aligned_cols=31  Identities=26%  Similarity=0.477  Sum_probs=19.9

Q ss_pred             eeCCCCCCccceeecCCCCCCC-CCCcccceE
Q psy10712         19 LKCPNCSTNLGAFDYVSGHKCP-CKQQCVPFI   49 (75)
Q Consensus        19 L~CP~C~aKLGsf~wv~G~kCs-CG~~v~Paf   49 (75)
                      ..||+|...|--..--..++|. ||.-..+.+
T Consensus       445 ~~Cp~Cd~~lt~H~~~~~L~CH~Cg~~~~~p~  476 (730)
T COG1198         445 AECPNCDSPLTLHKATGQLRCHYCGYQEPIPQ  476 (730)
T ss_pred             ccCCCCCcceEEecCCCeeEeCCCCCCCCCCC
Confidence            5678888877655554567775 777644333


No 55 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=49.41  E-value=10  Score=21.28  Aligned_cols=11  Identities=27%  Similarity=0.755  Sum_probs=8.7

Q ss_pred             ccceeeCCCCC
Q psy10712         15 LKDKLKCPNCS   25 (75)
Q Consensus        15 ~~GKL~CP~C~   25 (75)
                      .+|++.||.|+
T Consensus        31 k~g~~~Cv~C~   41 (41)
T PF06677_consen   31 KDGKIYCVSCG   41 (41)
T ss_pred             cCCCEECCCCC
Confidence            47888999885


No 56 
>COG5629 Predicted metal-binding protein [Function unknown]
Probab=49.10  E-value=6.4  Score=30.89  Aligned_cols=39  Identities=26%  Similarity=0.269  Sum_probs=25.7

Q ss_pred             cceeeCCCCCCcccee---------ecCCCCCCCCCCcccceEEEEcC
Q psy10712         16 KDKLKCPNCSTNLGAF---------DYVSGHKCPCKQQCVPFIHLVKS   54 (75)
Q Consensus        16 ~GKL~CP~C~aKLGsf---------~wv~G~kCsCG~~v~Paf~i~kS   54 (75)
                      +.||+|-+|+|+||-=         .|--..-|+=.+.+.|.+-|.-|
T Consensus       167 NfklhCsfCnA~lGlpn~~s~~kl~r~~k~~I~~g~tKihP~~dia~s  214 (321)
T COG5629         167 NFKLHCSFCNARLGLPNDSSIRKLFRYNKEVIPNGCTKIHPHEDLAYS  214 (321)
T ss_pred             CcceeeehhhhhhCCCCchhhhhhhhcchheecCCCcccCchHHHHHH
Confidence            5689999999999843         34224556644567776655433


No 57 
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the KOG1088|consensus
Probab=48.94  E-value=13  Score=25.77  Aligned_cols=16  Identities=19%  Similarity=0.613  Sum_probs=13.1

Q ss_pred             ccccceeeCCCCCCcc
Q psy10712         13 NFLKDKLKCPNCSTNL   28 (75)
Q Consensus        13 ~~~~GKL~CP~C~aKL   28 (75)
                      ...+|+|.||+|+...
T Consensus        93 ~v~EG~l~CpetG~vf  108 (124)
T KOG1088|consen   93 DVIEGELVCPETGRVF  108 (124)
T ss_pred             hhccceEecCCCCcEe
Confidence            3568999999998764


No 59 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=48.52  E-value=18  Score=24.46  Aligned_cols=13  Identities=38%  Similarity=0.802  Sum_probs=10.1

Q ss_pred             ccceeeCCCCCCc
Q psy10712         15 LKDKLKCPNCSTN   27 (75)
Q Consensus        15 ~~GKL~CP~C~aK   27 (75)
                      ...+..|++|+..
T Consensus        67 ~p~~~~C~~CG~~   79 (135)
T PRK03824         67 EEAVLKCRNCGNE   79 (135)
T ss_pred             cceEEECCCCCCE
Confidence            4578999999944


No 60 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=48.11  E-value=11  Score=19.13  Aligned_cols=10  Identities=40%  Similarity=1.075  Sum_probs=7.8

Q ss_pred             cceeeCCCCC
Q psy10712         16 KDKLKCPNCS   25 (75)
Q Consensus        16 ~GKL~CP~C~   25 (75)
                      .-...||||+
T Consensus        14 ~v~f~CPnCG   23 (24)
T PF07754_consen   14 AVPFPCPNCG   23 (24)
T ss_pred             CceEeCCCCC
Confidence            4467899997


No 61 
>KOG3092|consensus
Probab=47.41  E-value=9.4  Score=28.59  Aligned_cols=12  Identities=42%  Similarity=0.886  Sum_probs=9.8

Q ss_pred             ccceeeCCCCCC
Q psy10712         15 LKDKLKCPNCST   26 (75)
Q Consensus        15 ~~GKL~CP~C~a   26 (75)
                      ..=||+||+|..
T Consensus       131 ~~VklYCP~C~d  142 (216)
T KOG3092|consen  131 STVKLYCPSCED  142 (216)
T ss_pred             ceEEEeCCCccc
Confidence            467999999963


No 62 
>PRK08329 threonine synthase; Validated
Probab=47.17  E-value=13  Score=28.09  Aligned_cols=28  Identities=18%  Similarity=0.600  Sum_probs=20.8

Q ss_pred             eeeCCCCCCccceeecCCCCCCCCCCcccce
Q psy10712         18 KLKCPNCSTNLGAFDYVSGHKCPCKQQCVPF   48 (75)
Q Consensus        18 KL~CP~C~aKLGsf~wv~G~kCsCG~~v~Pa   48 (75)
                      +|.|++|+..... ++ . ..|.||..+...
T Consensus         1 ~l~C~~Cg~~~~~-~~-~-~~C~c~~~l~~~   28 (347)
T PRK08329          1 MLRCTKCGRTYEE-KF-K-LRCDCGGTLLVE   28 (347)
T ss_pred             CcCcCCCCCCcCC-CC-c-eecCCCCcEEEE
Confidence            4789999999874 45 3 789999765444


No 63 
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=47.03  E-value=11  Score=22.71  Aligned_cols=9  Identities=33%  Similarity=1.117  Sum_probs=7.4

Q ss_pred             eeCCCCCCc
Q psy10712         19 LKCPNCSTN   27 (75)
Q Consensus        19 L~CP~C~aK   27 (75)
                      |.||.|+.|
T Consensus         5 i~CP~CgnK   13 (55)
T PF14205_consen    5 ILCPICGNK   13 (55)
T ss_pred             EECCCCCCc
Confidence            789999865


No 64 
>PRK04023 DNA polymerase II large subunit; Validated
Probab=47.01  E-value=16  Score=33.06  Aligned_cols=49  Identities=18%  Similarity=0.560  Sum_probs=33.4

Q ss_pred             chhhhHHHhcCccccceeeCCCCCCccceeecCCCCCCC-CCCcccceEEEEcCccc
Q psy10712          2 SDWMRTAVEEGNFLKDKLKCPNCSTNLGAFDYVSGHKCP-CKQQCVPFIHLVKSKID   57 (75)
Q Consensus         2 m~WM~~~i~~~~~~~GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v~Paf~i~kSkVD   57 (75)
                      |+-|.+ +..  +..-+.-|.+|++|-=.-=-  .-+|. ||..|.+  .+|+.-|.
T Consensus      1024 PDl~GN-LRa--FsrQ~fRC~kC~~kYRR~PL--~G~C~kCGg~lil--TVh~GsV~ 1073 (1121)
T PRK04023       1024 PDLIGN-LRA--FSRQEFRCTKCGAKYRRPPL--SGKCPKCGGNLIL--TVHKGSVE 1073 (1121)
T ss_pred             hhhhhh-hhh--hcccceeecccCcccccCCC--CCcCccCCCeEEE--EEecchHH
Confidence            444444 333  35677899999999877777  35885 9999955  45555553


No 65 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=46.82  E-value=16  Score=33.63  Aligned_cols=39  Identities=18%  Similarity=0.554  Sum_probs=29.6

Q ss_pred             cccceeeCCCCCCccceeecCCCCCCC-CCCcccceEEEEcCcc
Q psy10712         14 FLKDKLKCPNCSTNLGAFDYVSGHKCP-CKQQCVPFIHLVKSKI   56 (75)
Q Consensus        14 ~~~GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v~Paf~i~kSkV   56 (75)
                      +..-+.-|.+|++|-=.-=-  .-+|. ||..|.+.  +|+.-|
T Consensus      1249 FsrQ~~RC~kC~~kyRR~PL--~G~C~kCGg~iilT--v~~Gsv 1288 (1337)
T PRK14714       1249 FSRQEFRCLKCGTKYRRMPL--AGKCRKCGGRIILT--VHEGSV 1288 (1337)
T ss_pred             hhccceeecccCcccccCCC--CCcccccCCeEEEE--EecchH
Confidence            45678899999999887777  35896 99999554  555555


No 66 
>PF03226 Yippee-Mis18:  Yippee zinc-binding/DNA-binding /Mis18, centromere assembly;  InterPro: IPR004910 This entry represents the Yippee-like (YPEL) family of putative zinc-binding proteins which is highly conserved among eukaryotes. The first protein in this family to be characterised, the Yippee protein from Drosophila, was identified by yeast interaction trap screen as a protein that physically interacts with moth hemolin []. It was subsequently found to be a member of a highly conserved family of proteins found in diverse eukaryotes including plants, animals and fungi []. Mammals contain five members of this family, YPEL1 to YPEL5, while other organisms tend to contain only two or three members. The mammalian proteins all appear to localise in the nucleus. YPEL1-4 are located in an unknown structure located on or close to the mitotic apparatus in the mitotic phase, whereas in the interphase they are located in the nuclei and nucleoli. In contrast, YPEL5 is localised to the centrosome and nucleus during interphase and at the mitotic spindle during mitosis, suggesting a function distinct from that of YPEL1-4. The localisation of the YPEL proteins suggests a novel, thopugh still unknown, function involved in cell division.
Probab=46.69  E-value=9.5  Score=23.68  Aligned_cols=15  Identities=40%  Similarity=0.680  Sum_probs=12.6

Q ss_pred             cceeeCCCCCCccce
Q psy10712         16 KDKLKCPNCSTNLGA   30 (75)
Q Consensus        16 ~GKL~CP~C~aKLGs   30 (75)
                      --.|.|.+|++.||-
T Consensus        55 ~~~l~C~~C~~~lGw   69 (96)
T PF03226_consen   55 VRDLFCSGCNTILGW   69 (96)
T ss_pred             EEEeEcccCChhHCc
Confidence            346999999999993


No 67 
>PF11648 RIG-I_C-RD:  C-terminal domain of RIG-I;  InterPro: IPR021673  This family of proteins represents the regulatory domain RD of RIG-I, a protein which initiates a signalling cascade that provides essential antiviral protection for the host. The RD domain binds viral RNA, activating the RIG-I ATPase by RNA-dependent dimerisation. The structure of RD contains a zinc-binding domain and is thought to confer ligand specificity []. ; GO: 0016817 hydrolase activity, acting on acid anhydrides; PDB: 2RQB_A 3GA3_A 2W4R_D 3EQT_A 2RQA_A 2RMJ_A 3NCU_A 2QFD_C 2QFB_D 3TMI_A ....
Probab=46.42  E-value=8.2  Score=25.72  Aligned_cols=26  Identities=27%  Similarity=0.597  Sum_probs=19.4

Q ss_pred             ccceeeCCCCCCccceeecCCCCCCC
Q psy10712         15 LKDKLKCPNCSTNLGAFDYVSGHKCP   40 (75)
Q Consensus        15 ~~GKL~CP~C~aKLGsf~wv~G~kCs   40 (75)
                      ..|+|.|-+|+..+|..-=..|...+
T Consensus        57 ~~~~I~C~~C~~~wG~~m~yk~~~LP   82 (123)
T PF11648_consen   57 PNGKIHCKNCGQDWGIMMKYKGVELP   82 (123)
T ss_dssp             EEEEEEETSTSBEEEEEEEETTEEEE
T ss_pred             eCCEEEcCCCChHhhhheEECCcccc
Confidence            57999999999999965433565543


No 68 
>PF14353 CpXC:  CpXC protein
Probab=46.34  E-value=20  Score=23.22  Aligned_cols=13  Identities=23%  Similarity=0.769  Sum_probs=8.0

Q ss_pred             cceeeCCCCCCcc
Q psy10712         16 KDKLKCPNCSTNL   28 (75)
Q Consensus        16 ~GKL~CP~C~aKL   28 (75)
                      -....||+|+.+.
T Consensus        36 l~~~~CP~Cg~~~   48 (128)
T PF14353_consen   36 LFSFTCPSCGHKF   48 (128)
T ss_pred             cCEEECCCCCCce
Confidence            3456677777654


No 69 
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=45.62  E-value=9.3  Score=21.37  Aligned_cols=9  Identities=33%  Similarity=1.331  Sum_probs=6.7

Q ss_pred             eCCCCCCcc
Q psy10712         20 KCPNCSTNL   28 (75)
Q Consensus        20 ~CP~C~aKL   28 (75)
                      .||.|+++.
T Consensus         1 ~CP~Cg~~a    9 (47)
T PF04606_consen    1 RCPHCGSKA    9 (47)
T ss_pred             CcCCCCCee
Confidence            488888764


No 70 
>PRK12495 hypothetical protein; Provisional
Probab=45.02  E-value=14  Score=27.83  Aligned_cols=40  Identities=23%  Similarity=0.469  Sum_probs=27.9

Q ss_pred             hhhHHHhcCccccceeeCCCCCCccceeecCCCCCCC-CCCccc
Q psy10712          4 WMRTAVEEGNFLKDKLKCPNCSTNLGAFDYVSGHKCP-CKQQCV   46 (75)
Q Consensus         4 WM~~~i~~~~~~~GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v~   46 (75)
                      =|...|.++. ...-.+|+.|+.-|=.+..+  ..|. |+..|.
T Consensus        29 ~ma~lL~~ga-tmsa~hC~~CG~PIpa~pG~--~~Cp~CQ~~~~   69 (226)
T PRK12495         29 RMSELLLQGA-TMTNAHCDECGDPIFRHDGQ--EFCPTCQQPVT   69 (226)
T ss_pred             HHHHHHHhhc-ccchhhcccccCcccCCCCe--eECCCCCCccc
Confidence            3566666543 56778899999999766442  5574 998764


No 71 
>cd01412 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E. coli CobB; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. CobB is a bacterial sirtuin that deacetylates acetyl-CoA synthetase at an active site lysine to stimulate its enzymatic activity.
Probab=44.85  E-value=26  Score=24.72  Aligned_cols=41  Identities=15%  Similarity=0.303  Sum_probs=27.8

Q ss_pred             cceeeCCCCCCccce---eecCCCCCCC-CCCcccceEEEEcCcc
Q psy10712         16 KDKLKCPNCSTNLGA---FDYVSGHKCP-CKQQCVPFIHLVKSKI   56 (75)
Q Consensus        16 ~GKL~CP~C~aKLGs---f~wv~G~kCs-CG~~v~Paf~i~kSkV   56 (75)
                      -..+.|.+|+.+.-.   .+-....+|+ ||..+.|.+-+.-..+
T Consensus       107 ~~~~~C~~C~~~~~~~~~~~~~~~p~C~~Cgg~lrp~Vv~fge~~  151 (224)
T cd01412         107 LFRVRCSSCGYVGENNEEIPEEELPRCPKCGGLLRPGVVWFGESL  151 (224)
T ss_pred             cCccccCCCCCCCCcchhhhccCCCCCCCCCCccCCceEECCCCC
Confidence            456889999987521   1111246896 9999999997665544


No 72 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=44.84  E-value=12  Score=22.03  Aligned_cols=13  Identities=23%  Similarity=0.984  Sum_probs=10.6

Q ss_pred             cceeeCCCCCCcc
Q psy10712         16 KDKLKCPNCSTNL   28 (75)
Q Consensus        16 ~GKL~CP~C~aKL   28 (75)
                      ..-+-||.|+.|+
T Consensus        22 ~~~irCp~Cg~rI   34 (49)
T COG1996          22 TRGIRCPYCGSRI   34 (49)
T ss_pred             cCceeCCCCCcEE
Confidence            4558899999986


No 73 
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=44.71  E-value=15  Score=21.82  Aligned_cols=14  Identities=36%  Similarity=0.992  Sum_probs=10.1

Q ss_pred             ccccceeeCCCCCC
Q psy10712         13 NFLKDKLKCPNCST   26 (75)
Q Consensus        13 ~~~~GKL~CP~C~a   26 (75)
                      ...+..|.||+|++
T Consensus        19 ~~~~leIKCpRC~t   32 (51)
T PF10122_consen   19 EVIELEIKCPRCKT   32 (51)
T ss_pred             CccEEEEECCCCCc
Confidence            34567888998864


No 74 
>PF13790 DUF4182:  Domain of unknown function (DUF4182)
Probab=44.15  E-value=14  Score=20.82  Aligned_cols=17  Identities=18%  Similarity=0.716  Sum_probs=14.8

Q ss_pred             ceeeCCCCCCccceeec
Q psy10712         17 DKLKCPNCSTNLGAFDY   33 (75)
Q Consensus        17 GKL~CP~C~aKLGsf~w   33 (75)
                      |.|.|..|++-++.|.=
T Consensus         2 GtIvCq~C~~~Id~~e~   18 (38)
T PF13790_consen    2 GTIVCQHCNETIDHFET   18 (38)
T ss_pred             CEEEeccccceeeeecC
Confidence            77999999999999863


No 75 
>PRK06835 DNA replication protein DnaC; Validated
Probab=44.14  E-value=14  Score=28.31  Aligned_cols=25  Identities=40%  Similarity=1.007  Sum_probs=19.3

Q ss_pred             cceeeCCCCCCccceeecCCCCCCCCCCc
Q psy10712         16 KDKLKCPNCSTNLGAFDYVSGHKCPCKQQ   44 (75)
Q Consensus        16 ~GKL~CP~C~aKLGsf~wv~G~kCsCG~~   44 (75)
                      +-+-.||+|+-. |-+   .|.+|+|-..
T Consensus        96 ~~~y~Cp~C~dt-G~i---~~~~C~C~~q  120 (329)
T PRK06835         96 EMKYTCPKCKDT-GFI---NGKKCSCYKQ  120 (329)
T ss_pred             CCCCCCCCCCCC-CCc---CCccccchhH
Confidence            455679999988 644   5789999865


No 76 
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=43.99  E-value=14  Score=29.73  Aligned_cols=25  Identities=32%  Similarity=0.711  Sum_probs=13.5

Q ss_pred             eeCCCCCCccceeecCCCCCCC-CCC
Q psy10712         19 LKCPNCSTNLGAFDYVSGHKCP-CKQ   43 (75)
Q Consensus        19 L~CP~C~aKLGsf~wv~G~kCs-CG~   43 (75)
                      +.||+|+..|--..--+-.+|. ||.
T Consensus       223 ~~C~~C~~~l~~h~~~~~l~Ch~Cg~  248 (505)
T TIGR00595       223 LCCPNCDVSLTYHKKEGKLRCHYCGY  248 (505)
T ss_pred             cCCCCCCCceEEecCCCeEEcCCCcC
Confidence            3488888777543322334454 443


No 77 
>PRK14873 primosome assembly protein PriA; Provisional
Probab=43.46  E-value=19  Score=30.38  Aligned_cols=26  Identities=23%  Similarity=0.617  Sum_probs=13.2

Q ss_pred             eeCCCCCCccceeecCCCCCCC-CCCc
Q psy10712         19 LKCPNCSTNLGAFDYVSGHKCP-CKQQ   44 (75)
Q Consensus        19 L~CP~C~aKLGsf~wv~G~kCs-CG~~   44 (75)
                      +.||+|+..|.-..--.-.+|. ||.-
T Consensus       393 ~~C~~C~~~L~~h~~~~~l~Ch~CG~~  419 (665)
T PRK14873        393 ARCRHCTGPLGLPSAGGTPRCRWCGRA  419 (665)
T ss_pred             eECCCCCCceeEecCCCeeECCCCcCC
Confidence            5566666666432221235565 6653


No 78 
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=43.44  E-value=11  Score=20.50  Aligned_cols=12  Identities=50%  Similarity=1.201  Sum_probs=5.4

Q ss_pred             eCCCCCCcccee
Q psy10712         20 KCPNCSTNLGAF   31 (75)
Q Consensus        20 ~CP~C~aKLGsf   31 (75)
                      .||+|+.+--.|
T Consensus         2 ~Cp~Cg~~~a~~   13 (39)
T PF01096_consen    2 KCPKCGHNEAVF   13 (39)
T ss_dssp             --SSS-SSEEEE
T ss_pred             CCcCCCCCeEEE
Confidence            577777665444


No 79 
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=42.99  E-value=14  Score=20.05  Aligned_cols=14  Identities=29%  Similarity=0.871  Sum_probs=10.4

Q ss_pred             eeeCCCCCCcccee
Q psy10712         18 KLKCPNCSTNLGAF   31 (75)
Q Consensus        18 KL~CP~C~aKLGsf   31 (75)
                      .+.||.|++--+-+
T Consensus         5 ~v~CP~C~s~~~v~   18 (36)
T PF03811_consen    5 DVHCPRCQSTEGVK   18 (36)
T ss_pred             eeeCCCCCCCCcce
Confidence            48999999876433


No 80 
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=42.89  E-value=6.1  Score=22.94  Aligned_cols=35  Identities=20%  Similarity=0.663  Sum_probs=15.5

Q ss_pred             chhhhHHHhcCccccceeeCCCCCCccceeecCCCCCCC-CCCccc
Q psy10712          2 SDWMRTAVEEGNFLKDKLKCPNCSTNLGAFDYVSGHKCP-CKQQCV   46 (75)
Q Consensus         2 m~WM~~~i~~~~~~~GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v~   46 (75)
                      |.|+.+.        ..-.|+.|+.+.+-|..  -..|. ||..|-
T Consensus         1 ~~W~~d~--------~~~~C~~C~~~F~~~~r--rhhCr~CG~~vC   36 (69)
T PF01363_consen    1 PHWVPDS--------EASNCMICGKKFSLFRR--RHHCRNCGRVVC   36 (69)
T ss_dssp             --SSSGG--------G-SB-TTT--B-BSSS---EEE-TTT--EEE
T ss_pred             CCcCCCC--------CCCcCcCcCCcCCCcee--eEccCCCCCEEC
Confidence            5677751        22469999999876655  56675 887663


No 81 
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=42.66  E-value=15  Score=19.97  Aligned_cols=17  Identities=24%  Similarity=0.671  Sum_probs=9.4

Q ss_pred             CCCC-CCCcccceEEEEc
Q psy10712         37 HKCP-CKQQCVPFIHLVK   53 (75)
Q Consensus        37 ~kCs-CG~~v~Paf~i~k   53 (75)
                      .+|+ |++++.|-.+|..
T Consensus         3 ~rC~~C~aylNp~~~~~~   20 (40)
T PF04810_consen    3 VRCRRCRAYLNPFCQFDD   20 (40)
T ss_dssp             -B-TTT--BS-TTSEEET
T ss_pred             cccCCCCCEECCcceEcC
Confidence            4675 8888888888875


No 82 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=42.46  E-value=11  Score=20.78  Aligned_cols=11  Identities=27%  Similarity=0.830  Sum_probs=8.9

Q ss_pred             cceeeCCCCCC
Q psy10712         16 KDKLKCPNCST   26 (75)
Q Consensus        16 ~GKL~CP~C~a   26 (75)
                      +..+.||.|++
T Consensus        24 ~~~~~CP~Cg~   34 (52)
T TIGR02605        24 DPLATCPECGG   34 (52)
T ss_pred             CCCCCCCCCCC
Confidence            45678999998


No 83 
>PF10005 DUF2248:  Uncharacterized protein conserved in bacteria (DUF2248);  InterPro: IPR011201 This is a family of uncharacterised bacterial proteins.
Probab=42.09  E-value=17  Score=28.85  Aligned_cols=22  Identities=27%  Similarity=0.945  Sum_probs=17.7

Q ss_pred             eCCCCCCccceeecCCCCCC-CCCCcc
Q psy10712         20 KCPNCSTNLGAFDYVSGHKC-PCKQQC   45 (75)
Q Consensus        20 ~CP~C~aKLGsf~wv~G~kC-sCG~~v   45 (75)
                      .||+|+..| .  | ....| +||.-+
T Consensus         1 ~C~~Cg~~v-~--F-eNt~C~~Cg~~L   23 (343)
T PF10005_consen    1 SCPNCGQPV-F--F-ENTRCLSCGSAL   23 (343)
T ss_pred             CCCCCCCcc-e--e-CCCccccCCccc
Confidence            499999998 2  3 67899 899977


No 84 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=41.78  E-value=11  Score=20.29  Aligned_cols=9  Identities=44%  Similarity=1.124  Sum_probs=3.7

Q ss_pred             eCCCCCCcc
Q psy10712         20 KCPNCSTNL   28 (75)
Q Consensus        20 ~CP~C~aKL   28 (75)
                      .||+|+..|
T Consensus         2 fC~~CG~~l   10 (34)
T PF14803_consen    2 FCPQCGGPL   10 (34)
T ss_dssp             B-TTT--B-
T ss_pred             ccccccChh
Confidence            478888776


No 85 
>PTZ00396 Casein kinase II subunit beta; Provisional
Probab=41.57  E-value=12  Score=28.28  Aligned_cols=12  Identities=33%  Similarity=0.877  Sum_probs=9.8

Q ss_pred             ccceeeCCCCCC
Q psy10712         15 LKDKLKCPNCST   26 (75)
Q Consensus        15 ~~GKL~CP~C~a   26 (75)
                      ..=||+||+|+.
T Consensus       145 ~~VKlyCP~C~D  156 (251)
T PTZ00396        145 SRVKVYCPRCQE  156 (251)
T ss_pred             CceeEeCCCchh
Confidence            567999999974


No 86 
>PF01214 CK_II_beta:  Casein kinase II regulatory subunit;  InterPro: IPR000704 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Casein kinase, a ubiquitous, well-conserved protein kinase involved in cell metabolism and differentiation, is characterised by its preference for Ser or Thr in acidic stretches of amino acids. The enzyme is a tetramer of 2 alpha- and 2 beta-subunits [, ]. However, some species (e.g., mammals) possess 2 related forms of the alpha-subunit (alpha and alpha'), while others (e.g., fungi) possess 2 related beta-subunits (beta and beta') []. The alpha-subunit is the catalytic unit and contains regions characteristic of serine/threonine protein kinases. The beta-subunit is believed to be regulatory, possessing an N-terminal auto-phosphorylation site, an internal acidic domain, and a potential metal-binding motif []. The beta subunit is a highly conserved protein of about 25kDa that contains, in its central section, a cysteine-rich motif, CX(n)C, that could be involved in binding a metal such as zinc []. The mammalian beta-subunit gene promoter shares common features with those of other mammalian protein kinases and is closely related to the promoter of the regulatory subunit of cAMP-dependent protein kinase [].; GO: 0019887 protein kinase regulator activity, 0005956 protein kinase CK2 complex; PDB: 2R6M_B 1RQF_K 1DS5_G 1QF8_B 3EED_A 4DGL_A 1JWH_D.
Probab=40.61  E-value=13  Score=26.58  Aligned_cols=11  Identities=45%  Similarity=0.945  Sum_probs=9.1

Q ss_pred             ccceeeCCCCC
Q psy10712         15 LKDKLKCPNCS   25 (75)
Q Consensus        15 ~~GKL~CP~C~   25 (75)
                      ..=||.||+|+
T Consensus       124 ~~vKlyCP~C~  134 (184)
T PF01214_consen  124 STVKLYCPRCK  134 (184)
T ss_dssp             -BBEEEETTTT
T ss_pred             cceeEECCCCc
Confidence            56799999998


No 87 
>COG3877 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=39.55  E-value=15  Score=25.32  Aligned_cols=30  Identities=27%  Similarity=0.657  Sum_probs=23.1

Q ss_pred             eeCCCCCCccceeecCCCCCCC-CCCcccceEEEE
Q psy10712         19 LKCPNCSTNLGAFDYVSGHKCP-CKQQCVPFIHLV   52 (75)
Q Consensus        19 L~CP~C~aKLGsf~wv~G~kCs-CG~~v~Paf~i~   52 (75)
                      ..||-|+.++    -|+..+|+ |++-|.-.|.+.
T Consensus         7 ~~cPvcg~~~----iVTeL~c~~~etTVrg~F~~s   37 (122)
T COG3877           7 NRCPVCGRKL----IVTELKCSNCETTVRGNFKMS   37 (122)
T ss_pred             CCCCcccccc----eeEEEecCCCCceEecceecc
Confidence            4589998887    56788997 999887777654


No 88 
>PTZ00409 Sir2 (Silent Information Regulator) protein; Provisional
Probab=39.37  E-value=29  Score=25.94  Aligned_cols=42  Identities=19%  Similarity=0.434  Sum_probs=27.2

Q ss_pred             cceeeCCCCCCcccee--------ecCC--CCCCCCCCcccceEEEEcCccc
Q psy10712         16 KDKLKCPNCSTNLGAF--------DYVS--GHKCPCKQQCVPFIHLVKSKID   57 (75)
Q Consensus        16 ~GKL~CP~C~aKLGsf--------~wv~--G~kCsCG~~v~Paf~i~kSkVD   57 (75)
                      -.++.|.+|+.+.-.-        .+..  ..+|+||..+.|.+-+.--.++
T Consensus       135 l~~~~C~~C~~~~~~~~~~~~~~~~~~~~~~P~C~Cgg~lrP~VV~FGE~lp  186 (271)
T PTZ00409        135 VFEARCCTCRKTIQLNKIMLQKTSHFMHQLPPECPCGGIFKPNVILFGEVIP  186 (271)
T ss_pred             cCcceeCCCCCCcccCHHHHhhhhhhccCCCCCCCCCCcccCcEEEeCCcCC
Confidence            3568899998763200        0001  2579999999999887655444


No 89 
>TIGR03844 cysteate_syn cysteate synthase. Members of this family are cysteate synthase, an enzyme of alternate pathway to sulfopyruvate, a precursor of coenzyme M.
Probab=38.66  E-value=27  Score=27.36  Aligned_cols=28  Identities=29%  Similarity=0.470  Sum_probs=19.6

Q ss_pred             eeeCCCCCCccceeecCCCCCCC-CCCcccce
Q psy10712         18 KLKCPNCSTNLGAFDYVSGHKCP-CKQQCVPF   48 (75)
Q Consensus        18 KL~CP~C~aKLGsf~wv~G~kCs-CG~~v~Pa   48 (75)
                      +|.|++|+....  +. .-.+|+ |+..+...
T Consensus         2 ~l~C~~Cg~~~~--~~-~~~~C~~c~g~l~~~   30 (398)
T TIGR03844         2 TLRCPGCGEVLP--DH-YTLSCPLDCGLLRAE   30 (398)
T ss_pred             EEEeCCCCCccC--Cc-cccCCCCCCCceEEe
Confidence            589999999986  44 247896 87654433


No 90 
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional
Probab=38.49  E-value=14  Score=26.56  Aligned_cols=23  Identities=26%  Similarity=0.749  Sum_probs=16.8

Q ss_pred             eeCCCCCCccceeecCCCCCCCCCC
Q psy10712         19 LKCPNCSTNLGAFDYVSGHKCPCKQ   43 (75)
Q Consensus        19 L~CP~C~aKLGsf~wv~G~kCsCG~   43 (75)
                      +.||.|++.| ...= .+..|..|.
T Consensus         3 ~~CP~C~~~l-~~~~-~~~~C~~~h   25 (272)
T PRK11088          3 YQCPLCHQPL-TLEE-NSWICPQNH   25 (272)
T ss_pred             ccCCCCCcch-hcCC-CEEEcCCCC
Confidence            6799999999 3333 567888765


No 91 
>PF08772 NOB1_Zn_bind:  Nin one binding (NOB1) Zn-ribbon like;  InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1. ; PDB: 2CON_A.
Probab=37.86  E-value=13  Score=23.27  Aligned_cols=12  Identities=33%  Similarity=0.802  Sum_probs=5.9

Q ss_pred             cceeeCCCCCCc
Q psy10712         16 KDKLKCPNCSTN   27 (75)
Q Consensus        16 ~GKL~CP~C~aK   27 (75)
                      ..|+-||+|+.+
T Consensus        22 ~~k~FCp~CGn~   33 (73)
T PF08772_consen   22 MTKQFCPKCGNA   33 (73)
T ss_dssp             SS--S-SSS--S
T ss_pred             CCceeCcccCCC
Confidence            578999999876


No 92 
>PF01396 zf-C4_Topoisom:  Topoisomerase DNA binding C4 zinc finger;  InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks []. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [, ]. DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA []. Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.  This entry represents the zinc-finger domain found in type IA topoisomerases, including bacterial and archaeal topoisomerase I and III enzymes, and in eukaryotic topoisomerase III enzymes. Escherichia coli topoisomerase I proteins contain five copies of a zinc-ribbon-like domain at their C terminus, two of which have lost their cysteine residues and are therefore probably not able to bind zinc []. This domain is still considered to be a member of the zinc-ribbon superfamily despite not being able to bind zinc. More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change, 0005694 chromosome
Probab=37.52  E-value=15  Score=19.90  Aligned_cols=9  Identities=56%  Similarity=1.368  Sum_probs=6.9

Q ss_pred             eCCCCCCcc
Q psy10712         20 KCPNCSTNL   28 (75)
Q Consensus        20 ~CP~C~aKL   28 (75)
                      .||.|++.|
T Consensus         3 ~CP~Cg~~l   11 (39)
T PF01396_consen    3 KCPKCGGPL   11 (39)
T ss_pred             CCCCCCcee
Confidence            599998654


No 93 
>COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=37.52  E-value=17  Score=22.84  Aligned_cols=11  Identities=36%  Similarity=1.204  Sum_probs=7.3

Q ss_pred             ceeeCCCCCCc
Q psy10712         17 DKLKCPNCSTN   27 (75)
Q Consensus        17 GKL~CP~C~aK   27 (75)
                      ++-.||+|+.+
T Consensus         3 ~~~kCpKCgn~   13 (68)
T COG3478           3 NAFKCPKCGNT   13 (68)
T ss_pred             ccccCCCcCCc
Confidence            34459999764


No 94 
>PRK09401 reverse gyrase; Reviewed
Probab=37.45  E-value=14  Score=33.04  Aligned_cols=26  Identities=31%  Similarity=0.736  Sum_probs=22.0

Q ss_pred             eeeCCCCCCccceeecCCCCCCC-CCC
Q psy10712         18 KLKCPNCSTNLGAFDYVSGHKCP-CKQ   43 (75)
Q Consensus        18 KL~CP~C~aKLGsf~wv~G~kCs-CG~   43 (75)
                      +-.||||+..+-+..-..|.-|. |=.
T Consensus         7 ~~~cpnc~g~i~~~rl~~g~~c~~cl~   33 (1176)
T PRK09401          7 KNSCPNCGGDISDERLEKGLPCEKCLP   33 (1176)
T ss_pred             cccCCCCCCcCcHhHHhcCCcChhhCC
Confidence            34699999999999998899996 754


No 95 
>PTZ00408 NAD-dependent deacetylase; Provisional
Probab=37.25  E-value=25  Score=25.76  Aligned_cols=36  Identities=22%  Similarity=0.503  Sum_probs=24.0

Q ss_pred             cceeeCCCCCCccceeecC-----CCCCCC-CC--CcccceEEEEcC
Q psy10712         16 KDKLKCPNCSTNLGAFDYV-----SGHKCP-CK--QQCVPFIHLVKS   54 (75)
Q Consensus        16 ~GKL~CP~C~aKLGsf~wv-----~G~kCs-CG--~~v~Paf~i~kS   54 (75)
                      --++.|.+|+.+   |+|.     .-.+|+ ||  ..+.|.|-+.--
T Consensus       115 ~~~~~C~~C~~~---~~~~~~~~~~~p~C~~Cg~~g~lrP~vV~FGE  158 (242)
T PTZ00408        115 LLKVRCTATGHV---FDWTEDVVHGSSRCKCCGCVGTLRPHIVWFGE  158 (242)
T ss_pred             cceEEECCCCcc---cCchhhhhcCCCccccCCCCCCCCCCEEEcCC
Confidence            345789999875   5551     115685 77  789998877443


No 96 
>PF13695 zf-3CxxC:  Zinc-binding domain
Probab=35.59  E-value=45  Score=21.11  Aligned_cols=36  Identities=19%  Similarity=0.655  Sum_probs=25.4

Q ss_pred             ccceeeCCCCCCccceee-cC--------------CCCCCC-CCCcccceEE
Q psy10712         15 LKDKLKCPNCSTNLGAFD-YV--------------SGHKCP-CKQQCVPFIH   50 (75)
Q Consensus        15 ~~GKL~CP~C~aKLGsf~-wv--------------~G~kCs-CG~~v~Paf~   50 (75)
                      ..|++.|++|+..=+|=+ ||              -|.+|. |+....|-|.
T Consensus         2 ~~grF~C~~C~~~W~S~~v~i~f~~~~~g~v~~rv~~Q~C~~C~~~~~P~~~   53 (98)
T PF13695_consen    2 AFGRFQCSKCSRGWTSAKVWILFHMYRGGQVNMRVFGQRCKKCNPLERPYFS   53 (98)
T ss_pred             cEEEEECCCCCCCCccCEEEEEEEEcCCCeEEEEEECCCCCCCCCCCCccCc
Confidence            468889999965544311 11              288995 9999999996


No 97 
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=35.14  E-value=17  Score=18.94  Aligned_cols=13  Identities=31%  Similarity=0.953  Sum_probs=8.3

Q ss_pred             cceeeCCCCCCcc
Q psy10712         16 KDKLKCPNCSTNL   28 (75)
Q Consensus        16 ~GKL~CP~C~aKL   28 (75)
                      .+|-.||+|+.+.
T Consensus        11 ~~kY~Cp~C~~~~   23 (30)
T PF04438_consen   11 PAKYRCPRCGARY   23 (30)
T ss_dssp             EESEE-TTT--EE
T ss_pred             CCEEECCCcCCce
Confidence            6788999999874


No 98 
>PRK06450 threonine synthase; Validated
Probab=35.11  E-value=31  Score=26.28  Aligned_cols=29  Identities=24%  Similarity=0.508  Sum_probs=20.6

Q ss_pred             eeeCCCCCCccceeecCCCCCCC-CCCcccceE
Q psy10712         18 KLKCPNCSTNLGAFDYVSGHKCP-CKQQCVPFI   49 (75)
Q Consensus        18 KL~CP~C~aKLGsf~wv~G~kCs-CG~~v~Paf   49 (75)
                      +|.|+.|+..... .+  -.+|+ ||..+...+
T Consensus         3 ~~~C~~Cg~~~~~-~~--~~~C~~cg~~l~~~~   32 (338)
T PRK06450          3 KEVCMKCGKERES-IY--EIRCKKCGGPFEILI   32 (338)
T ss_pred             eeEECCcCCcCCC-cc--cccCCcCCCEeEEee
Confidence            4899999998765 44  36896 997664443


No 99 
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=34.78  E-value=17  Score=20.03  Aligned_cols=15  Identities=27%  Similarity=0.623  Sum_probs=10.3

Q ss_pred             CccccceeeCCCCCC
Q psy10712         12 GNFLKDKLKCPNCST   26 (75)
Q Consensus        12 ~~~~~GKL~CP~C~a   26 (75)
                      ||...|...||.|+-
T Consensus         7 gq~~~~~~~C~~CgM   21 (41)
T PF13878_consen    7 GQKSFGATTCPTCGM   21 (41)
T ss_pred             CCCccCCcCCCCCCC
Confidence            454557788888863


No 100
>PHA00626 hypothetical protein
Probab=34.51  E-value=17  Score=22.26  Aligned_cols=44  Identities=16%  Similarity=0.291  Sum_probs=25.7

Q ss_pred             eeCCCCCCc----cce-eecCCCCCCC-CCCcccceEEEEcCccceeecc
Q psy10712         19 LKCPNCSTN----LGA-FDYVSGHKCP-CKQQCVPFIHLVKSKIDIQYAN   62 (75)
Q Consensus        19 L~CP~C~aK----LGs-f~wv~G~kCs-CG~~v~Paf~i~kSkVD~~~~~   62 (75)
                      +.||+|++.    -|. ..|.+-.+|. ||...+---.=.+.|-+.+.+.
T Consensus         1 m~CP~CGS~~Ivrcg~cr~~snrYkCkdCGY~ft~~~~~~~~~~~~~~~~   50 (59)
T PHA00626          1 MSCPKCGSGNIAKEKTMRGWSDDYVCCDCGYNDSKDAFGERGKNEFVRIN   50 (59)
T ss_pred             CCCCCCCCceeeeeceecccCcceEcCCCCCeechhhhhhccccceEEec
Confidence            369999984    232 2344567786 9987765433344454544443


No 101
>PF13005 zf-IS66:  zinc-finger binding domain of transposase IS66 ;  InterPro: IPR024474 This entry represents a predicted helix-turn-helix domain from insertion element IS66 transposases [].
Probab=34.19  E-value=19  Score=19.48  Aligned_cols=10  Identities=40%  Similarity=1.182  Sum_probs=7.5

Q ss_pred             eCCCCCCccc
Q psy10712         20 KCPNCSTNLG   29 (75)
Q Consensus        20 ~CP~C~aKLG   29 (75)
                      .||.|++.|.
T Consensus         4 ~C~~Cg~~l~   13 (47)
T PF13005_consen    4 ACPDCGGELK   13 (47)
T ss_pred             cCCCCCceee
Confidence            5888888776


No 102
>PRK00481 NAD-dependent deacetylase; Provisional
Probab=34.18  E-value=38  Score=24.32  Aligned_cols=39  Identities=21%  Similarity=0.524  Sum_probs=27.1

Q ss_pred             cceeeCCCCCCccceeecC-----CCCCCC-CCCcccceEEEEcCccc
Q psy10712         16 KDKLKCPNCSTNLGAFDYV-----SGHKCP-CKQQCVPFIHLVKSKID   57 (75)
Q Consensus        16 ~GKL~CP~C~aKLGsf~wv-----~G~kCs-CG~~v~Paf~i~kSkVD   57 (75)
                      -.++.|.+|+..   |.+-     .-.+|+ ||..+.|.+-+.-..++
T Consensus       120 ~~~~~C~~C~~~---~~~~~~~~~~~p~C~~Cgg~lrP~Vv~fge~~~  164 (242)
T PRK00481        120 LLRARCTKCGQT---YDLDEYLKPEPPRCPKCGGILRPDVVLFGEMLP  164 (242)
T ss_pred             cCceeeCCCCCC---cChhhhccCCCCCCCCCCCccCCCeEECCCCCC
Confidence            456889999654   3321     123597 99999999987766553


No 103
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=33.99  E-value=32  Score=24.45  Aligned_cols=38  Identities=21%  Similarity=0.313  Sum_probs=25.6

Q ss_pred             ceeeCCCCCCccceeecC--------CCCCCC-CCCcccceEEEEcCc
Q psy10712         17 DKLKCPNCSTNLGAFDYV--------SGHKCP-CKQQCVPFIHLVKSK   55 (75)
Q Consensus        17 GKL~CP~C~aKLGsf~wv--------~G~kCs-CG~~v~Paf~i~kSk   55 (75)
                      -++.|++|+...- ++.+        ...+|+ ||..+.|.+-+.--.
T Consensus        94 ~~~~C~~C~~~~~-~~~~~~~~~~~~~~p~C~~Cgg~lrP~VV~FgE~  140 (206)
T cd01410          94 FIEVCKSCGPEYV-RDDVVETRGDKETGRRCHACGGILKDTIVDFGER  140 (206)
T ss_pred             CcccCCCCCCccc-hHHHHHHhhcCCCCCcCCCCcCccCCcEEECCCC
Confidence            4678999996532 1111        236796 999999998776543


No 104
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=33.55  E-value=26  Score=21.38  Aligned_cols=12  Identities=42%  Similarity=0.897  Sum_probs=9.8

Q ss_pred             cceeeCCCCCCc
Q psy10712         16 KDKLKCPNCSTN   27 (75)
Q Consensus        16 ~GKL~CP~C~aK   27 (75)
                      .-+..||+|++-
T Consensus        23 ~~~F~CPnCG~~   34 (59)
T PRK14890         23 AVKFLCPNCGEV   34 (59)
T ss_pred             cCEeeCCCCCCe
Confidence            457899999876


No 105
>COG3809 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=33.55  E-value=17  Score=23.73  Aligned_cols=39  Identities=31%  Similarity=0.575  Sum_probs=28.0

Q ss_pred             eeCCCCCCccceeecCCCC---CCC-CCCcccceEEEEcCccceeeccC
Q psy10712         19 LKCPNCSTNLGAFDYVSGH---KCP-CKQQCVPFIHLVKSKIDIQYANR   63 (75)
Q Consensus        19 L~CP~C~aKLGsf~wv~G~---kCs-CG~~v~Paf~i~kSkVD~~~~~~   63 (75)
                      +.||+|++-|=.-.= +|.   .|+ |+     .++|.+.-+|.+....
T Consensus         2 llCP~C~v~l~~~~r-s~vEiD~CPrCr-----GVWLDrGELdKli~r~   44 (88)
T COG3809           2 LLCPICGVELVMSVR-SGVEIDYCPRCR-----GVWLDRGELDKLIERS   44 (88)
T ss_pred             cccCcCCceeeeeee-cCceeeeCCccc-----cEeecchhHHHHHHHh
Confidence            579999998865444 443   565 54     6789999998876544


No 106
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=33.37  E-value=14  Score=20.28  Aligned_cols=28  Identities=21%  Similarity=0.611  Sum_probs=18.8

Q ss_pred             ceeeCCCCCCccceeecCCCCCCC-CCCcc
Q psy10712         17 DKLKCPNCSTNLGAFDYVSGHKCP-CKQQC   45 (75)
Q Consensus        17 GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v   45 (75)
                      .--.|-.|+..|-.+.- +|.+|+ |+..+
T Consensus        10 ~~~~C~~C~~~i~g~~~-~g~~C~~C~~~~   38 (53)
T PF00130_consen   10 KPTYCDVCGKFIWGLGK-QGYRCSWCGLVC   38 (53)
T ss_dssp             STEB-TTSSSBECSSSS-CEEEETTTT-EE
T ss_pred             CCCCCcccCcccCCCCC-CeEEECCCCChH
Confidence            34578889999944444 899997 77643


No 107
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=33.28  E-value=22  Score=19.15  Aligned_cols=12  Identities=33%  Similarity=1.024  Sum_probs=8.3

Q ss_pred             eeeCCCCCCccc
Q psy10712         18 KLKCPNCSTNLG   29 (75)
Q Consensus        18 KL~CP~C~aKLG   29 (75)
                      .+.||+|+-.+.
T Consensus         4 ~~~C~nC~R~v~   15 (33)
T PF08209_consen    4 YVECPNCGRPVA   15 (33)
T ss_dssp             EEE-TTTSSEEE
T ss_pred             eEECCCCcCCcc
Confidence            478999987764


No 108
>PHA02325 hypothetical protein
Probab=33.23  E-value=18  Score=22.80  Aligned_cols=14  Identities=29%  Similarity=0.892  Sum_probs=11.0

Q ss_pred             eCCCCCCcc--ceeec
Q psy10712         20 KCPNCSTNL--GAFDY   33 (75)
Q Consensus        20 ~CP~C~aKL--Gsf~w   33 (75)
                      .||+|+|+-  |.-.|
T Consensus         5 ~CPkC~A~WldgqhYW   20 (72)
T PHA02325          5 ICPKCGARWLDGQHYW   20 (72)
T ss_pred             ccCccCCEeEcceeee
Confidence            599999984  66667


No 109
>PRK05580 primosome assembly protein PriA; Validated
Probab=33.03  E-value=25  Score=29.26  Aligned_cols=11  Identities=36%  Similarity=1.111  Sum_probs=8.0

Q ss_pred             eeCCCCCCccc
Q psy10712         19 LKCPNCSTNLG   29 (75)
Q Consensus        19 L~CP~C~aKLG   29 (75)
                      +.||+|+..|-
T Consensus       391 ~~C~~C~~~l~  401 (679)
T PRK05580        391 AECPHCDASLT  401 (679)
T ss_pred             cCCCCCCCcee
Confidence            56888887774


No 110
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=32.47  E-value=31  Score=19.59  Aligned_cols=13  Identities=38%  Similarity=0.907  Sum_probs=10.0

Q ss_pred             cceeeCCCCCCcc
Q psy10712         16 KDKLKCPNCSTNL   28 (75)
Q Consensus        16 ~GKL~CP~C~aKL   28 (75)
                      +.-+.||+|+.-|
T Consensus        44 ~~i~~Cp~CgRiL   56 (56)
T PF02591_consen   44 DEIVFCPNCGRIL   56 (56)
T ss_pred             CCeEECcCCCccC
Confidence            5679999998643


No 111
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=32.42  E-value=20  Score=22.06  Aligned_cols=17  Identities=18%  Similarity=0.446  Sum_probs=13.9

Q ss_pred             eCCCCCCccceeecCCCC
Q psy10712         20 KCPNCSTNLGAFDYVSGH   37 (75)
Q Consensus        20 ~CP~C~aKLGsf~wv~G~   37 (75)
                      .||.|++.==|-|| .|+
T Consensus        19 ~Cp~Cgs~~~S~~w-~G~   35 (64)
T PRK06393         19 TCPVHGDEKTTTEW-FGF   35 (64)
T ss_pred             cCCCCCCCcCCcCc-ceE
Confidence            79999998667888 665


No 112
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=32.25  E-value=49  Score=24.07  Aligned_cols=38  Identities=16%  Similarity=0.441  Sum_probs=26.2

Q ss_pred             cceeeCCCCCCccceeecC---------CCCCCC-CCCcccceEEEEcCcc
Q psy10712         16 KDKLKCPNCSTNLGAFDYV---------SGHKCP-CKQQCVPFIHLVKSKI   56 (75)
Q Consensus        16 ~GKL~CP~C~aKLGsf~wv---------~G~kCs-CG~~v~Paf~i~kSkV   56 (75)
                      -.++.|.+|+.+   |++.         ...+|+ ||..+.|.+-+.---+
T Consensus       117 ~~~~~C~~C~~~---~~~~~~~~~~~~~~~p~Cp~Cgg~lrP~Vv~FgE~~  164 (244)
T PRK14138        117 VEEYYCVRCGKR---YTVEDVIEKLEKSDVPRCDDCSGLIRPNIVFFGEAL  164 (244)
T ss_pred             cCeeEECCCCCc---ccHHHHHHHHhcCCCCCCCCCCCeECCCEEECCCcC
Confidence            345779999975   4431         236795 9999999887764433


No 113
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=31.65  E-value=16  Score=23.87  Aligned_cols=35  Identities=20%  Similarity=0.496  Sum_probs=24.6

Q ss_pred             ceeeCCCCCCccceeecCCCCCCC-CCCcccceEEEE
Q psy10712         17 DKLKCPNCSTNLGAFDYVSGHKCP-CKQQCVPFIHLV   52 (75)
Q Consensus        17 GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v~Paf~i~   52 (75)
                      +.-.|..|...+|-+.- .|..|. |...|...-.+.
T Consensus        53 ~~~~C~~C~~~fg~l~~-~~~~C~~C~~~VC~~C~~~   88 (118)
T PF02318_consen   53 GERHCARCGKPFGFLFN-RGRVCVDCKHRVCKKCGVY   88 (118)
T ss_dssp             CCSB-TTTS-BCSCTST-TCEEETTTTEEEETTSEEE
T ss_pred             CCcchhhhCCcccccCC-CCCcCCcCCccccCccCCc
Confidence            55589999999996655 799996 888876655444


No 114
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=31.65  E-value=26  Score=20.70  Aligned_cols=14  Identities=21%  Similarity=0.684  Sum_probs=10.1

Q ss_pred             ceeeCCCCCCccce
Q psy10712         17 DKLKCPNCSTNLGA   30 (75)
Q Consensus        17 GKL~CP~C~aKLGs   30 (75)
                      --+.||.|++.|=-
T Consensus        21 eiV~Cp~CGaeleV   34 (54)
T TIGR01206        21 ELVICDECGAELEV   34 (54)
T ss_pred             CEEeCCCCCCEEEE
Confidence            35689999987643


No 115
>cd01408 SIRT1 SIRT1: Eukaryotic group (class1) which includes human sirtuins SIRT1-3 and yeast Hst1-4; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The nuclear SIRT1 has been shown to target the p53 tumor suppressor protein for deacetylation to suppress DNA damage, and the cytoplasmic SIRT2 homolog has been shown to target alpha-tubulin for deacetylation for the maintenance of cell integrity.
Probab=31.07  E-value=33  Score=24.79  Aligned_cols=38  Identities=21%  Similarity=0.427  Sum_probs=26.4

Q ss_pred             cceeeCCCCCCccceeecC---------CCCCCC-CCCcccceEEEEcCcc
Q psy10712         16 KDKLKCPNCSTNLGAFDYV---------SGHKCP-CKQQCVPFIHLVKSKI   56 (75)
Q Consensus        16 ~GKL~CP~C~aKLGsf~wv---------~G~kCs-CG~~v~Paf~i~kSkV   56 (75)
                      -.++.|.+|+..   |++-         ...+|+ ||..+.|.+-+.--.+
T Consensus       114 l~~~~C~~C~~~---~~~~~~~~~~~~~~~p~C~~Cgg~lrP~Vv~FGE~l  161 (235)
T cd01408         114 FATAHCIKCKHK---YPGDWMREDIFNQEVPKCPRCGGLVKPDIVFFGESL  161 (235)
T ss_pred             CCccccccCCCc---CCHHHHHHHHhCCCCccCCCCCCCccCcEEECCCCC
Confidence            356789999984   4430         135796 9999999987765443


No 116
>PRK06418 transcription elongation factor NusA-like protein; Validated
Probab=30.90  E-value=12  Score=26.64  Aligned_cols=16  Identities=38%  Similarity=0.800  Sum_probs=11.9

Q ss_pred             eeeCCCCCCcc--ceeec
Q psy10712         18 KLKCPNCSTNL--GAFDY   33 (75)
Q Consensus        18 KL~CP~C~aKL--Gsf~w   33 (75)
                      -|.||+|..+|  |.+.+
T Consensus        13 ~ilC~~c~~~~~~G~v~~   30 (166)
T PRK06418         13 GLLCPRCQSLLDSGEVTE   30 (166)
T ss_pred             CccChhHHhHhhcCceEE
Confidence            58899999998  44444


No 117
>PRK14715 DNA polymerase II large subunit; Provisional
Probab=30.85  E-value=41  Score=31.65  Aligned_cols=39  Identities=21%  Similarity=0.715  Sum_probs=29.0

Q ss_pred             cccceeeCCCCCCccceeecCCCCCCC-CCCcccceEEEEcCccc
Q psy10712         14 FLKDKLKCPNCSTNLGAFDYVSGHKCP-CKQQCVPFIHLVKSKID   57 (75)
Q Consensus        14 ~~~GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v~Paf~i~kSkVD   57 (75)
                      +...+.-| +|++|-=.---  .-+|. ||..+.  ..+++.-|.
T Consensus      1538 FsrQ~~RC-kC~~kyRR~PL--~G~C~kCGg~~i--lTV~kGsv~ 1577 (1627)
T PRK14715       1538 FSRQEFRC-KCGAKYRRVPL--KGKCPKCGSKLI--LTVSKGAVE 1577 (1627)
T ss_pred             hhccceee-cCCCccccCCC--CCcCcccCCeEE--EEEecchHH
Confidence            35667899 99999887777  35796 999995  455666554


No 118
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=30.38  E-value=24  Score=19.23  Aligned_cols=11  Identities=36%  Similarity=1.186  Sum_probs=9.0

Q ss_pred             cceeeCCCCCC
Q psy10712         16 KDKLKCPNCST   26 (75)
Q Consensus        16 ~GKL~CP~C~a   26 (75)
                      ...+.||+|++
T Consensus        24 ~~~~~CP~Cg~   34 (42)
T PF09723_consen   24 DDPVPCPECGS   34 (42)
T ss_pred             CCCCcCCCCCC
Confidence            45688999998


No 119
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=30.26  E-value=31  Score=17.88  Aligned_cols=25  Identities=32%  Similarity=0.774  Sum_probs=18.4

Q ss_pred             eeCCCCCCccceeecCCCCCCC-CCCcc
Q psy10712         19 LKCPNCSTNLGAFDYVSGHKCP-CKQQC   45 (75)
Q Consensus        19 L~CP~C~aKLGsf~wv~G~kCs-CG~~v   45 (75)
                      ..|--|+..|..+.  +|.+|+ |+..+
T Consensus        12 ~~C~~C~~~i~~~~--~~~~C~~C~~~~   37 (49)
T smart00109       12 TKCCVCRKSIWGSF--QGLRCSWCKVKC   37 (49)
T ss_pred             CCccccccccCcCC--CCcCCCCCCchH
Confidence            46877999987653  689998 76544


No 120
>PRK07218 replication factor A; Provisional
Probab=30.24  E-value=30  Score=27.78  Aligned_cols=18  Identities=22%  Similarity=0.772  Sum_probs=14.6

Q ss_pred             eCCCCCCccceeecCCCCCCC-CCC
Q psy10712         20 KCPNCSTNLGAFDYVSGHKCP-CKQ   43 (75)
Q Consensus        20 ~CP~C~aKLGsf~wv~G~kCs-CG~   43 (75)
                      .||.|+-+|..      .+|+ ||.
T Consensus       299 rCP~C~r~v~~------~~C~~hG~  317 (423)
T PRK07218        299 RCPECGRVIQK------GQCRSHGA  317 (423)
T ss_pred             cCcCccccccC------CcCCCCCC
Confidence            59999999943      4797 886


No 121
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
Probab=30.06  E-value=55  Score=23.35  Aligned_cols=39  Identities=23%  Similarity=0.531  Sum_probs=27.5

Q ss_pred             cceeeCCCCCCccceeecC--------CCCCCC-CCCcccceEEEEcCccc
Q psy10712         16 KDKLKCPNCSTNLGAFDYV--------SGHKCP-CKQQCVPFIHLVKSKID   57 (75)
Q Consensus        16 ~GKL~CP~C~aKLGsf~wv--------~G~kCs-CG~~v~Paf~i~kSkVD   57 (75)
                      -.++.|.+|+..   |.|.        .-.+|+ ||..+.|.+-+.-..++
T Consensus       111 l~~~~C~~C~~~---~~~~~~~~~~~~~~p~C~~Cgg~lrP~Vv~fgE~lp  158 (222)
T cd01413         111 LQTAYCVNCGSK---YDLEEVKYAKKHEVPRCPKCGGIIRPDVVLFGEPLP  158 (222)
T ss_pred             cCcceECCCCCC---cchhHHHHhccCCCCcCCCCCCccCCCEEECCCCCC
Confidence            456889999864   4441        135796 99999998887665555


No 122
>PF02943 FeThRed_B:  Ferredoxin thioredoxin reductase catalytic beta chain;  InterPro: IPR004209 Ferredoxin thioredoxin reductase is a [4FE-4S] protein present in organisms performing oxygenic photosynthesis, and plays an important role in the ferredoxin/thioredoxin regulatory chain. It converts an electron signal (photoreduced ferredoxin) to a thiol signal (reduced thioredoxin), regulating enzymes by reduction of specific disulphide groups. It catalyses the light-dependent activation of several photosynthetis enzymes. Ferredoxin thioredoxin reductase is a heterodimer of subunit alpha and subunit beta. Subunit alpha is the variable subunit, and beta is the catalytic chain [].  The structure of the beta subunit has been determined and found to fold around the FeS cluster [].; GO: 0008937 ferredoxin-NAD(P) reductase activity, 0055114 oxidation-reduction process; PDB: 2PUK_E 2PVD_A 2PVG_A 2PUO_A 2PU9_A 1DJ7_A 2PVO_A.
Probab=29.87  E-value=22  Score=23.72  Aligned_cols=33  Identities=24%  Similarity=0.430  Sum_probs=15.3

Q ss_pred             cceeeCCCCCCccc------eeecCCCCC-----------CCCCCcccceE
Q psy10712         16 KDKLKCPNCSTNLG------AFDYVSGHK-----------CPCKQQCVPFI   49 (75)
Q Consensus        16 ~GKL~CP~C~aKLG------sf~wv~G~k-----------CsCG~~v~Paf   49 (75)
                      -|+-+|| |...-|      .-+||---.           |.||-+++|.+
T Consensus        42 yG~~~CP-Cr~~~~~~ee~~d~~iiCPC~~~r~~~~~~G~ChC~Lf~~~e~   91 (108)
T PF02943_consen   42 YGYPYCP-CRLASGKEEEVKDRDIICPCVPYREDDIEYGHCHCGLFVSPEY   91 (108)
T ss_dssp             HSS-B-S-SC--S-HHHHHHH-TTBSS-HHHHHH-------TTSSSB-TTS
T ss_pred             hCCCCCC-CCCCCCchhhhccCCeecCCHHHHhhccccccceEeeeECccc
Confidence            3566666 665555      234544444           89999998876


No 123
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]
Probab=29.17  E-value=32  Score=26.54  Aligned_cols=46  Identities=17%  Similarity=0.314  Sum_probs=28.2

Q ss_pred             cccceeeCCCCCCccceeecCCCCCCC-CCCcc----cceEEEEcCcccee
Q psy10712         14 FLKDKLKCPNCSTNLGAFDYVSGHKCP-CKQQC----VPFIHLVKSKIDIQ   59 (75)
Q Consensus        14 ~~~GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v----~Paf~i~kSkVD~~   59 (75)
                      |...--.||+|+.|.=...==-..+|+ ||...    .|++=+--.|-|++
T Consensus       107 w~~~~RFCg~CG~~~~~~~~g~~~~C~~cg~~~fPR~dP~vIv~v~~~~~i  157 (279)
T COG2816         107 WYRSHRFCGRCGTKTYPREGGWARVCPKCGHEHFPRIDPCVIVAVIRGDEI  157 (279)
T ss_pred             HHhhCcCCCCCCCcCccccCceeeeCCCCCCccCCCCCCeEEEEEecCCce
Confidence            555556799999987433221146776 88765    45555555555553


No 124
>PRK06260 threonine synthase; Validated
Probab=29.00  E-value=47  Score=25.53  Aligned_cols=30  Identities=20%  Similarity=0.352  Sum_probs=19.9

Q ss_pred             eeeCCCCCCccceeecCCCCCC-CCCCcccceE
Q psy10712         18 KLKCPNCSTNLGAFDYVSGHKC-PCKQQCVPFI   49 (75)
Q Consensus        18 KL~CP~C~aKLGsf~wv~G~kC-sCG~~v~Paf   49 (75)
                      +|.|++|+.....=.+  -.+| .||..+...+
T Consensus         3 ~~~C~~cg~~~~~~~~--~~~Cp~cg~~l~~~y   33 (397)
T PRK06260          3 WLKCIECGKEYDPDEI--IYTCPECGGLLEVIY   33 (397)
T ss_pred             EEEECCCCCCCCCCCc--cccCCCCCCeEEEEe
Confidence            4889999998753323  2578 4987654443


No 125
>PF10955 DUF2757:  Protein of unknown function (DUF2757);  InterPro: IPR020115 This entry contains proteins with no known function.
Probab=28.90  E-value=30  Score=21.91  Aligned_cols=16  Identities=31%  Similarity=0.812  Sum_probs=13.8

Q ss_pred             eeeCCCCCCccceeec
Q psy10712         18 KLKCPNCSTNLGAFDY   33 (75)
Q Consensus        18 KL~CP~C~aKLGsf~w   33 (75)
                      .-.|-.|+.|||+.+-
T Consensus         4 ~Y~CRHCg~~IG~i~~   19 (76)
T PF10955_consen    4 HYYCRHCGTKIGTIDA   19 (76)
T ss_pred             EEEecCCCCEEEEeec
Confidence            3579899999999987


No 126
>PF08600 Rsm1:  Rsm1-like;  InterPro: IPR013909 This entry contains Nuclear-interacting partner of ALK (NIPA) and NIPA like proteins, as well as mRNA export factor Rsm1, all of which contain a C3HC-type zinc finger. The domain represented in this entry is found C-terminal to the zinc-finger like domain IPR012935 from INTERPRO. Rsm1 is involved in mRNA export from the nucleus []. NIPA is an essential component of an SCF-type E3 ligase complex, SCF(NIPA), a complex that controls mitotic entry by mediating ubiquitination and subsequent degradation of cyclin B1 (CCNB1). Its cell-cycle-dependent phosphorylation regulates the assembly of the SCF(NIPA) complex, restricting CCNB1 ubiquitination activity to interphase. Its inactivation results in nuclear accumulation of CCNB1 in interphase and premature mitotic entry [].
Probab=28.50  E-value=37  Score=21.43  Aligned_cols=21  Identities=24%  Similarity=0.564  Sum_probs=17.9

Q ss_pred             cceeeCCCCCCccceeecCCCC
Q psy10712         16 KDKLKCPNCSTNLGAFDYVSGH   37 (75)
Q Consensus        16 ~GKL~CP~C~aKLGsf~wv~G~   37 (75)
                      .+-|.|--|.-|||=|++ ...
T Consensus        17 ~~~~~C~~C~Rr~GLW~f-~~~   37 (91)
T PF08600_consen   17 LGLLSCSYCFRRLGLWMF-KSK   37 (91)
T ss_pred             cCeEEccccCcEeeeeec-ccC
Confidence            468999999999999999 443


No 127
>COG1933 Archaeal DNA polymerase II, large subunit [DNA replication, recombination, and repair]
Probab=28.34  E-value=35  Score=26.19  Aligned_cols=39  Identities=23%  Similarity=0.640  Sum_probs=30.0

Q ss_pred             ccceeeCCCCCCccceeecCCCCCCC-CCCcccceEEEEcCccc
Q psy10712         15 LKDKLKCPNCSTNLGAFDYVSGHKCP-CKQQCVPFIHLVKSKID   57 (75)
Q Consensus        15 ~~GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v~Paf~i~kSkVD   57 (75)
                      .--+..|-+|++|+|.--- + .+|. ||..+  ..-+++.+|-
T Consensus       164 ~rq~~rc~~c~~k~rr~pl-~-g~c~kcg~~~--~ltv~~g~v~  203 (253)
T COG1933         164 TRQEFRCVKCNTKFRRPPL-D-GKCPICGGKI--VLTVSKGAIE  203 (253)
T ss_pred             hhheeehHhhhhhhcCCCc-c-ccccccCCeE--EEEEeccHHH
Confidence            4556889999999999988 3 5787 99955  6666776653


No 128
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=28.33  E-value=29  Score=21.14  Aligned_cols=8  Identities=50%  Similarity=1.514  Sum_probs=6.2

Q ss_pred             eCCCCCCc
Q psy10712         20 KCPNCSTN   27 (75)
Q Consensus        20 ~CP~C~aK   27 (75)
                      .||||+.+
T Consensus         2 ~C~KCg~~    9 (64)
T PF09855_consen    2 KCPKCGNE    9 (64)
T ss_pred             CCCCCCCc
Confidence            48999875


No 129
>PF10272 Tmpp129:  Putative transmembrane protein precursor;  InterPro: IPR018801  This entry consists of proteins conserved from worms to humans. They are purported to be transmembrane protein-precursors but their function is unknown. 
Probab=28.14  E-value=23  Score=28.01  Aligned_cols=17  Identities=29%  Similarity=0.841  Sum_probs=14.9

Q ss_pred             CccccceeeCCCCCCcc
Q psy10712         12 GNFLKDKLKCPNCSTNL   28 (75)
Q Consensus        12 ~~~~~GKL~CP~C~aKL   28 (75)
                      ..|+.||-.||-|.+|.
T Consensus       334 ~~Wl~~~~~CPtCRa~F  350 (358)
T PF10272_consen  334 ETWLSGKCPCPTCRAKF  350 (358)
T ss_pred             hhhhcCCCCCCCCcccc
Confidence            46999999999999974


No 130
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=27.94  E-value=48  Score=18.14  Aligned_cols=27  Identities=30%  Similarity=0.640  Sum_probs=12.9

Q ss_pred             eeCCC--CCCccceeecCCC--CCCC-CCCcc
Q psy10712         19 LKCPN--CSTNLGAFDYVSG--HKCP-CKQQC   45 (75)
Q Consensus        19 L~CP~--C~aKLGsf~wv~G--~kCs-CG~~v   45 (75)
                      ..||+  |+.-+-.-+=...  ++|+ |+...
T Consensus        19 ~~Cp~~~C~~~~~~~~~~~~~~~~C~~C~~~f   50 (64)
T PF01485_consen   19 RWCPNPDCEYIIEKDDGCNSPIVTCPSCGTEF   50 (64)
T ss_dssp             C--TTSST---ECS-SSTTS--CCTTSCCSEE
T ss_pred             cCCCCCCCcccEEecCCCCCCeeECCCCCCcC
Confidence            48988  9887754444223  6888 88643


No 131
>COG5041 SKB2 Casein kinase II, beta subunit [Signal transduction mechanisms / Cell division and chromosome partitioning / Transcription]
Probab=27.56  E-value=27  Score=26.50  Aligned_cols=12  Identities=42%  Similarity=0.886  Sum_probs=9.9

Q ss_pred             ccceeeCCCCCC
Q psy10712         15 LKDKLKCPNCST   26 (75)
Q Consensus        15 ~~GKL~CP~C~a   26 (75)
                      ..-||+||+|..
T Consensus       146 ~~vkLyCpsC~d  157 (242)
T COG5041         146 SSVKLYCPSCED  157 (242)
T ss_pred             ceeEEecCchhh
Confidence            567999999964


No 132
>cd01407 SIR2-fam SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose. Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer.
Probab=27.30  E-value=78  Score=22.30  Aligned_cols=41  Identities=17%  Similarity=0.436  Sum_probs=27.9

Q ss_pred             cceeeCCCCCCccceee-------cCCCCCCC-CCCcccceEEEEcCccc
Q psy10712         16 KDKLKCPNCSTNLGAFD-------YVSGHKCP-CKQQCVPFIHLVKSKID   57 (75)
Q Consensus        16 ~GKL~CP~C~aKLGsf~-------wv~G~kCs-CG~~v~Paf~i~kSkVD   57 (75)
                      -.++.|.+|+... .++       =....+|+ ||..+.|.+-+.-.-++
T Consensus       107 ~~~~~C~~C~~~~-~~~~~~~~~~~~~~p~C~~Cg~~lrP~Vv~fgE~~p  155 (218)
T cd01407         107 LFRVRCTKCGKEY-PRDELQADIDREEVPRCPKCGGLLRPDVVFFGESLP  155 (218)
T ss_pred             cCcceeCCCcCCC-cHHHHhHhhccCCCCcCCCCCCccCCCeEECCCCCc
Confidence            4568899998764 111       01346897 99999999987655443


No 133
>PRK07591 threonine synthase; Validated
Probab=27.02  E-value=50  Score=25.81  Aligned_cols=29  Identities=24%  Similarity=0.379  Sum_probs=21.5

Q ss_pred             eeeCCCCCCccceeecCCCCCCC-CCCcccceE
Q psy10712         18 KLKCPNCSTNLGAFDYVSGHKCP-CKQQCVPFI   49 (75)
Q Consensus        18 KL~CP~C~aKLGsf~wv~G~kCs-CG~~v~Paf   49 (75)
                      +|.|+.|+.....- . . .+|+ ||..+-..+
T Consensus        18 ~l~C~~Cg~~~~~~-~-~-~~C~~cg~~l~~~y   47 (421)
T PRK07591         18 ALKCRECGAEYPLG-P-I-HVCEECFGPLEVAY   47 (421)
T ss_pred             EEEeCCCCCcCCCC-C-C-ccCCCCCCeEEEEe
Confidence            69999999988742 4 3 7895 998775443


No 134
>PF06054 CoiA:  Competence protein CoiA-like family;  InterPro: IPR010330 Competence is the ability of a cell to take up exogenous DNA from its environment, resulting in transformation. It is widespread among bacteria and is probably an important mechanism for the horizontal transfer of genes. Cells that take up DNA inevitably acquire the nucleotides the DNA consists of, and, because nucleotides are needed for DNA and RNA synthesis and are expensive to synthesise, these may make a significant contribution to the cell's energy budget []. The lateral gene transfer caused by competence also contributes to the genetic diversity that makes evolution possible.  DNA usually becomes available by the death and lysis of other cells. Competent bacteria use components of extracellular filaments called type 4 pili to create pores in their membranes and pull DNA through the pores into the cytoplasm. This process, including the development of competence and the expression of the uptake machinery, is regulated in response to cell-cell signalling and/or nutritional conditions []. Many of the members of this family are described as transcription factors. CoiA falls within a competence-specific operon in Streptococcus. CoiA is an uncharacterised protein.
Probab=26.95  E-value=35  Score=26.54  Aligned_cols=13  Identities=38%  Similarity=0.907  Sum_probs=11.7

Q ss_pred             cceeeCCCCCCcc
Q psy10712         16 KDKLKCPNCSTNL   28 (75)
Q Consensus        16 ~GKL~CP~C~aKL   28 (75)
                      +++..||.|+.+|
T Consensus        28 ~~~~~CP~C~~~v   40 (375)
T PF06054_consen   28 KGKYFCPGCGEPV   40 (375)
T ss_pred             CCcEECCCCCCee
Confidence            7899999999877


No 135
>PRK06386 replication factor A; Reviewed
Probab=26.50  E-value=49  Score=26.13  Aligned_cols=26  Identities=23%  Similarity=0.476  Sum_probs=17.9

Q ss_pred             eCCCCCCccceeecCCCCCCC-CCCcccceEEEEc
Q psy10712         20 KCPNCSTNLGAFDYVSGHKCP-CKQQCVPFIHLVK   53 (75)
Q Consensus        20 ~CP~C~aKLGsf~wv~G~kCs-CG~~v~Paf~i~k   53 (75)
                      .||.|+-+|=  +    .+|+ ||.  .|.....+
T Consensus       238 rCP~C~R~l~--~----g~C~~HG~--v~~~~dlr  264 (358)
T PRK06386        238 KCSVCNKIIE--D----GVCKDHPD--APVYLDIF  264 (358)
T ss_pred             cCcCCCeEcc--C----CcCCCCCC--CCCeeEEE
Confidence            5999999995  2    3897 997  44444433


No 136
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=26.47  E-value=63  Score=17.72  Aligned_cols=29  Identities=24%  Similarity=0.501  Sum_probs=17.5

Q ss_pred             cceeeCC--CCCCccceee--cCCCCCC-CCCCc
Q psy10712         16 KDKLKCP--NCSTNLGAFD--YVSGHKC-PCKQQ   44 (75)
Q Consensus        16 ~GKL~CP--~C~aKLGsf~--wv~G~kC-sCG~~   44 (75)
                      .....||  +|+.-+-.-+  -....+| .||..
T Consensus        16 ~~~~~CP~~~C~~~~~~~~~~~~~~v~C~~C~~~   49 (64)
T smart00647       16 PDLKWCPAPDCSAAIIVTEEEGCNRVTCPKCGFS   49 (64)
T ss_pred             CCccCCCCCCCcceEEecCCCCCCeeECCCCCCe
Confidence            3455798  7877665542  2245778 67753


No 137
>PF08646 Rep_fac-A_C:  Replication factor-A C terminal domain;  InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. It also plays an essential role in several cellular processes in DNA metabolism including replication, recombination and repair of DNA []. Replication factor-A protein is also known as Replication protein A 70 kDa DNA-binding subunit.  This entry is found at the C terminus of Replication factor A.; PDB: 1L1O_F 3U50_C.
Probab=26.32  E-value=30  Score=22.75  Aligned_cols=25  Identities=24%  Similarity=0.752  Sum_probs=14.6

Q ss_pred             eeCC--CCCCccceeecCCC-CCC-CCCCcc
Q psy10712         19 LKCP--NCSTNLGAFDYVSG-HKC-PCKQQC   45 (75)
Q Consensus        19 L~CP--~C~aKLGsf~wv~G-~kC-sCG~~v   45 (75)
                      ..||  .|+.||=.- = .| ..| +|++-+
T Consensus        19 ~aC~~~~C~kKv~~~-~-~~~y~C~~C~~~~   47 (146)
T PF08646_consen   19 PACPNEKCNKKVTEN-G-DGSYRCEKCNKTV   47 (146)
T ss_dssp             EE-TSTTTS-B-EEE-T-TTEEEETTTTEEE
T ss_pred             CCCCCccCCCEeecC-C-CcEEECCCCCCcC
Confidence            5799  999997544 2 22 478 588774


No 138
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=26.11  E-value=33  Score=16.87  Aligned_cols=12  Identities=42%  Similarity=0.894  Sum_probs=8.9

Q ss_pred             ceeeCCCCCCcc
Q psy10712         17 DKLKCPNCSTNL   28 (75)
Q Consensus        17 GKL~CP~C~aKL   28 (75)
                      +...||.|+..+
T Consensus        34 ~~~~Cp~C~~~~   45 (45)
T cd00162          34 GKNTCPLCRTPI   45 (45)
T ss_pred             CcCCCCCCCCcC
Confidence            467799998754


No 139
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=25.99  E-value=41  Score=26.56  Aligned_cols=15  Identities=40%  Similarity=0.860  Sum_probs=10.1

Q ss_pred             cceeeCCCCCCccce
Q psy10712         16 KDKLKCPNCSTNLGA   30 (75)
Q Consensus        16 ~GKL~CP~C~aKLGs   30 (75)
                      ..+-.||.|+++|=+
T Consensus        31 g~~a~CpRCg~~L~~   45 (403)
T TIGR00155        31 GQKAACPRCGTTLTV   45 (403)
T ss_pred             CCeeECCCCCCCCcC
Confidence            345678888888743


No 140
>PRK08402 replication factor A; Reviewed
Probab=25.82  E-value=45  Score=26.13  Aligned_cols=10  Identities=30%  Similarity=0.976  Sum_probs=8.9

Q ss_pred             eeCCCCCCcc
Q psy10712         19 LKCPNCSTNL   28 (75)
Q Consensus        19 L~CP~C~aKL   28 (75)
                      -.||+|+-||
T Consensus       213 ~aCp~CnKkv  222 (355)
T PRK08402        213 DACPECRRKV  222 (355)
T ss_pred             ecCCCCCeEE
Confidence            4699999999


No 141
>TIGR01374 soxD sarcosine oxidase, delta subunit family, heterotetrameric form. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) form
Probab=25.78  E-value=32  Score=22.16  Aligned_cols=44  Identities=20%  Similarity=0.438  Sum_probs=23.7

Q ss_pred             eeCCCCCCc-cceeecCCCCCCCCCCcc-cc---eEEEEcCccceeeccCCCCCC
Q psy10712         19 LKCPNCSTN-LGAFDYVSGHKCPCKQQC-VP---FIHLVKSKIDIQYANRSPENT   68 (75)
Q Consensus        19 L~CP~C~aK-LGsf~wv~G~kCsCG~~v-~P---af~i~kSkVD~~~~~~~~~~t   68 (75)
                      |.||.|+.| .--|.. .|.     .-+ .|   +=.=.+.-.|+++++.||.|.
T Consensus         2 I~CP~CG~R~~~EF~y-~G~-----A~~~rP~~~~~~sd~~W~~Ylf~R~Np~G~   50 (84)
T TIGR01374         2 IPCPYCGPRPEEEFTY-GGD-----AHIVRPADPAAASDEEWEDYLFLRDNPKGL   50 (84)
T ss_pred             ccCCCCCCccHhhEec-cce-----ecccCCCCCCcCCHHHHHHhccccCCCCcc
Confidence            789999865 234555 332     111 22   111123446678888888764


No 142
>PF09814 HECT_2:  HECT-like Ubiquitin-conjugating enzyme (E2)-binding;  InterPro: IPR019193 This entry consists of E3 ubiquitin-protein ligases which accept ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfer it to substrates, generally promoting their degradation by the proteasome [].
Probab=25.76  E-value=66  Score=23.93  Aligned_cols=32  Identities=25%  Similarity=0.465  Sum_probs=24.7

Q ss_pred             ceeeCCCCCCccceeecCCCCCCCCCCcccceEEEEcCccceee
Q psy10712         17 DKLKCPNCSTNLGAFDYVSGHKCPCKQQCVPFIHLVKSKIDIQY   60 (75)
Q Consensus        17 GKL~CP~C~aKLGsf~wv~G~kCsCG~~v~Paf~i~kSkVD~~~   60 (75)
                      ..+.|.+|++-||.            ..-.-++.|.|..|....
T Consensus       192 ~~v~C~~C~~~LG~------------~~~~~~~rL~K~~l~~~~  223 (354)
T PF09814_consen  192 RIVRCKRCSSQLGE------------KFSDNTVRLYKWALSLQP  223 (354)
T ss_pred             cEEEeCCCCceeCC------------CccCCeEEEEeeeEEEec
Confidence            57999999999998            222457888888887654


No 143
>PRK08197 threonine synthase; Validated
Probab=25.31  E-value=49  Score=25.43  Aligned_cols=26  Identities=23%  Similarity=0.608  Sum_probs=18.7

Q ss_pred             eeeCCCCCCccceeecCCCCCCCCCCcc
Q psy10712         18 KLKCPNCSTNLGAFDYVSGHKCPCKQQC   45 (75)
Q Consensus        18 KL~CP~C~aKLGsf~wv~G~kCsCG~~v   45 (75)
                      +|.|++|+.....-.+  -..|.||..+
T Consensus         7 ~~~C~~Cg~~~~~~~~--~~~C~cg~~l   32 (394)
T PRK08197          7 HLECSKCGETYDADQV--HNLCKCGKPL   32 (394)
T ss_pred             EEEECCCCCCCCCCCc--ceecCCCCee
Confidence            5999999988764333  2568998654


No 144
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=25.23  E-value=39  Score=20.78  Aligned_cols=11  Identities=45%  Similarity=1.053  Sum_probs=8.7

Q ss_pred             ccceeeCCCCC
Q psy10712         15 LKDKLKCPNCS   25 (75)
Q Consensus        15 ~~GKL~CP~C~   25 (75)
                      .--+..||||+
T Consensus        24 ~~v~F~CPnCG   34 (61)
T COG2888          24 TAVKFPCPNCG   34 (61)
T ss_pred             ceeEeeCCCCC
Confidence            34578899999


No 145
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=25.21  E-value=36  Score=18.37  Aligned_cols=11  Identities=27%  Similarity=0.827  Sum_probs=6.6

Q ss_pred             eeeCCCCCCcc
Q psy10712         18 KLKCPNCSTNL   28 (75)
Q Consensus        18 KL~CP~C~aKL   28 (75)
                      -+.|++|+-++
T Consensus        21 ~isC~~CGPr~   31 (35)
T PF07503_consen   21 FISCTNCGPRY   31 (35)
T ss_dssp             T--BTTCC-SC
T ss_pred             CccCCCCCCCE
Confidence            47899999876


No 146
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=25.17  E-value=36  Score=20.38  Aligned_cols=12  Identities=33%  Similarity=0.930  Sum_probs=6.7

Q ss_pred             eeeCCCCCCccc
Q psy10712         18 KLKCPNCSTNLG   29 (75)
Q Consensus        18 KL~CP~C~aKLG   29 (75)
                      ++.||.|+..+-
T Consensus         2 ~v~CP~C~k~~~   13 (57)
T PF03884_consen    2 TVKCPICGKPVE   13 (57)
T ss_dssp             EEE-TTT--EEE
T ss_pred             cccCCCCCCeec
Confidence            578999998763


No 147
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=25.04  E-value=55  Score=27.03  Aligned_cols=25  Identities=24%  Similarity=0.670  Sum_probs=19.1

Q ss_pred             ceeeCCCCCCccceeecCCCCCCC-CCCcc
Q psy10712         17 DKLKCPNCSTNLGAFDYVSGHKCP-CKQQC   45 (75)
Q Consensus        17 GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v   45 (75)
                      -...|-+|+..  +=.|.  -||+ ||.|=
T Consensus         6 t~f~C~~CG~~--s~KW~--GkCp~Cg~Wn   31 (456)
T COG1066           6 TAFVCQECGYV--SPKWL--GKCPACGAWN   31 (456)
T ss_pred             cEEEcccCCCC--Ccccc--ccCCCCCCcc
Confidence            45789999987  56683  5786 99995


No 148
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=24.97  E-value=35  Score=20.77  Aligned_cols=10  Identities=50%  Similarity=1.082  Sum_probs=7.5

Q ss_pred             eeCCCCCCcc
Q psy10712         19 LKCPNCSTNL   28 (75)
Q Consensus        19 L~CP~C~aKL   28 (75)
                      -.||||+.-|
T Consensus        42 ~~CPNCgGel   51 (57)
T PF06906_consen   42 GVCPNCGGEL   51 (57)
T ss_pred             CcCcCCCCcc
Confidence            4699998654


No 149
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=24.79  E-value=26  Score=24.14  Aligned_cols=16  Identities=25%  Similarity=0.588  Sum_probs=12.1

Q ss_pred             cccceeeCCCCCCccc
Q psy10712         14 FLKDKLKCPNCSTNLG   29 (75)
Q Consensus        14 ~~~GKL~CP~C~aKLG   29 (75)
                      .+.|.--||.|++..+
T Consensus        73 eL~g~PgCP~CGn~~~   88 (131)
T PF15616_consen   73 ELIGAPGCPHCGNQYA   88 (131)
T ss_pred             HhcCCCCCCCCcChhc
Confidence            3567788999999753


No 150
>PHA02942 putative transposase; Provisional
Probab=24.79  E-value=36  Score=26.61  Aligned_cols=25  Identities=20%  Similarity=0.677  Sum_probs=15.6

Q ss_pred             eeCCCCCCccceeecCCCCCC-CCCCc
Q psy10712         19 LKCPNCSTNLGAFDYVSGHKC-PCKQQ   44 (75)
Q Consensus        19 L~CP~C~aKLGsf~wv~G~kC-sCG~~   44 (75)
                      -.||.|+.+....+= .-..| +||..
T Consensus       326 q~Cs~CG~~~~~l~~-r~f~C~~CG~~  351 (383)
T PHA02942        326 VSCPKCGHKMVEIAH-RYFHCPSCGYE  351 (383)
T ss_pred             ccCCCCCCccCcCCC-CEEECCCCCCE
Confidence            459999988653221 12478 58874


No 151
>TIGR02443 conserved hypothetical metal-binding protein. Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N-terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various Proteobacteria.
Probab=24.79  E-value=34  Score=20.83  Aligned_cols=9  Identities=44%  Similarity=1.143  Sum_probs=6.9

Q ss_pred             eeCCCCCCc
Q psy10712         19 LKCPNCSTN   27 (75)
Q Consensus        19 L~CP~C~aK   27 (75)
                      -.||+|++-
T Consensus        10 A~CP~C~~~   18 (59)
T TIGR02443        10 AVCPACSAQ   18 (59)
T ss_pred             ccCCCCcCc
Confidence            369999874


No 152
>KOG2807|consensus
Probab=24.73  E-value=27  Score=28.13  Aligned_cols=36  Identities=28%  Similarity=0.617  Sum_probs=27.6

Q ss_pred             cceeeCCCCCCccceeecCCCCCCC-CCCcccceEEEEcCc
Q psy10712         16 KDKLKCPNCSTNLGAFDYVSGHKCP-CKQQCVPFIHLVKSK   55 (75)
Q Consensus        16 ~GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v~Paf~i~kSk   55 (75)
                      -|-..||.|+||+=+.    ...|+ |+.-++-+-||.||-
T Consensus       274 ~~Gy~CP~CkakvCsL----P~eCpiC~ltLVss~hLARSy  310 (378)
T KOG2807|consen  274 GGGYFCPQCKAKVCSL----PIECPICSLTLVSSPHLARSY  310 (378)
T ss_pred             cCceeCCcccCeeecC----CccCCccceeEecchHHHHHH
Confidence            3557899999999765    46786 888887777777664


No 153
>COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis]
Probab=24.58  E-value=38  Score=24.87  Aligned_cols=25  Identities=28%  Similarity=0.632  Sum_probs=18.5

Q ss_pred             eeCCCCCCccceeecCCCCCCC-CCCcc
Q psy10712         19 LKCPNCSTNLGAFDYVSGHKCP-CKQQC   45 (75)
Q Consensus        19 L~CP~C~aKLGsf~wv~G~kCs-CG~~v   45 (75)
                      -.|++|.+-|=. .| .-++|+ ||.--
T Consensus       150 A~CsrC~~~L~~-~~-~~l~Cp~Cg~tE  175 (188)
T COG1096         150 ARCSRCRAPLVK-KG-NMLKCPNCGNTE  175 (188)
T ss_pred             EEccCCCcceEE-cC-cEEECCCCCCEE
Confidence            358888888854 88 688886 88643


No 154
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=24.32  E-value=39  Score=18.35  Aligned_cols=24  Identities=25%  Similarity=0.515  Sum_probs=14.4

Q ss_pred             eCCCCCCccceeecCC--CCCCC-CCC
Q psy10712         20 KCPNCSTNLGAFDYVS--GHKCP-CKQ   43 (75)
Q Consensus        20 ~CP~C~aKLGsf~wv~--G~kCs-CG~   43 (75)
                      .||+|+.-|=.=.+-.  -..|+ ||.
T Consensus         2 FCp~Cg~~l~~~~~~~~~~~vC~~Cg~   28 (52)
T smart00661        2 FCPKCGNMLIPKEGKEKRRFVCRKCGY   28 (52)
T ss_pred             CCCCCCCccccccCCCCCEEECCcCCC
Confidence            5999998773322311  14586 885


No 155
>PRK09521 exosome complex RNA-binding protein Csl4; Provisional
Probab=24.29  E-value=41  Score=23.40  Aligned_cols=27  Identities=30%  Similarity=0.597  Sum_probs=21.1

Q ss_pred             ceee--CCCCCCccceeecCCCCCCC-CCCc
Q psy10712         17 DKLK--CPNCSTNLGAFDYVSGHKCP-CKQQ   44 (75)
Q Consensus        17 GKL~--CP~C~aKLGsf~wv~G~kCs-CG~~   44 (75)
                      |+|.  |++|+..+=-.+| +.++|. ||..
T Consensus       146 Gvv~a~~~~~g~~~~~~~~-~~~~c~~~~~~  175 (189)
T PRK09521        146 GVIYAMCSRCRTPLVKKGE-NELKCPNCGNI  175 (189)
T ss_pred             eEEEEEccccCCceEECCC-CEEECCCCCCE
Confidence            4443  7889998888888 889996 8863


No 156
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis]
Probab=24.25  E-value=52  Score=26.53  Aligned_cols=26  Identities=31%  Similarity=0.844  Sum_probs=21.3

Q ss_pred             eeeCCCCCCccceeecCCCCCCC-CCCc
Q psy10712         18 KLKCPNCSTNLGAFDYVSGHKCP-CKQQ   44 (75)
Q Consensus        18 KL~CP~C~aKLGsf~wv~G~kCs-CG~~   44 (75)
                      -++|+.|+..+++|.= --.+|+ ||..
T Consensus       240 ~~~c~~cg~~~~~~~~-~~~~c~~Cg~~  266 (380)
T COG1867         240 IYHCSRCGEIVGSFRE-VDEKCPHCGGK  266 (380)
T ss_pred             EEEcccccceeccccc-ccccCCccccc
Confidence            4789999988888888 488997 8863


No 157
>KOG0801|consensus
Probab=24.22  E-value=42  Score=24.81  Aligned_cols=16  Identities=44%  Similarity=0.928  Sum_probs=12.3

Q ss_pred             eecCCCCCCC-CCCcccc
Q psy10712         31 FDYVSGHKCP-CKQQCVP   47 (75)
Q Consensus        31 f~wv~G~kCs-CG~~v~P   47 (75)
                      +++ +|+||+ |.+.|.|
T Consensus       134 ~~~-~g~KCPvC~K~V~s  150 (205)
T KOG0801|consen  134 MDH-SGMKCPVCHKVVPS  150 (205)
T ss_pred             ecc-CCccCCccccccCC
Confidence            344 799998 9888866


No 158
>COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=24.04  E-value=45  Score=27.80  Aligned_cols=26  Identities=27%  Similarity=0.678  Sum_probs=17.3

Q ss_pred             eeCCCCCCccceeecCCCCCC-CCCCcccceE
Q psy10712         19 LKCPNCSTNLGAFDYVSGHKC-PCKQQCVPFI   49 (75)
Q Consensus        19 L~CP~C~aKLGsf~wv~G~kC-sCG~~v~Paf   49 (75)
                      -.||+|+..-.     .|-|| .||.-..|.=
T Consensus       143 g~cp~cg~~~a-----rGD~Ce~Cg~~~~P~~  169 (558)
T COG0143         143 GTCPKCGGEDA-----RGDQCENCGRTLDPTE  169 (558)
T ss_pred             ccCCCcCcccc-----CcchhhhccCcCCchh
Confidence            34666664432     48889 4999888854


No 159
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]
Probab=23.99  E-value=46  Score=26.97  Aligned_cols=26  Identities=23%  Similarity=0.709  Sum_probs=21.8

Q ss_pred             cceeeCCCCCCccceeecCCCCCC-CCCCcc
Q psy10712         16 KDKLKCPNCSTNLGAFDYVSGHKC-PCKQQC   45 (75)
Q Consensus        16 ~GKL~CP~C~aKLGsf~wv~G~kC-sCG~~v   45 (75)
                      +-.--|-||+-+-=+|-|    +| ||..|-
T Consensus       352 ~~~YRC~~CGF~a~~l~W----~CPsC~~W~  378 (389)
T COG2956         352 KPRYRCQNCGFTAHTLYW----HCPSCRAWE  378 (389)
T ss_pred             cCCceecccCCcceeeee----eCCCccccc
Confidence            455679999999999999    68 499986


No 160
>PF14169 YdjO:  Cold-inducible protein YdjO
Probab=23.72  E-value=32  Score=20.86  Aligned_cols=22  Identities=27%  Similarity=0.871  Sum_probs=13.7

Q ss_pred             hhhhHHHhcCccccceeeCCCCCCcc
Q psy10712          3 DWMRTAVEEGNFLKDKLKCPNCSTNL   28 (75)
Q Consensus         3 ~WM~~~i~~~~~~~GKL~CP~C~aKL   28 (75)
                      -||...+.    .+..-.||-|++..
T Consensus        28 gWmR~nFs----~~~~p~CPlC~s~M   49 (59)
T PF14169_consen   28 GWMRDNFS----FEEEPVCPLCKSPM   49 (59)
T ss_pred             cccccccc----cCCCccCCCcCCcc
Confidence            37876443    24446788888754


No 161
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=23.63  E-value=37  Score=21.11  Aligned_cols=10  Identities=30%  Similarity=0.952  Sum_probs=7.9

Q ss_pred             eeCCCCCCcc
Q psy10712         19 LKCPNCSTNL   28 (75)
Q Consensus        19 L~CP~C~aKL   28 (75)
                      +.||.|+++-
T Consensus         2 m~CP~Cg~~a   11 (72)
T PRK09678          2 FHCPLCQHAA   11 (72)
T ss_pred             ccCCCCCCcc
Confidence            5799998765


No 162
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=23.51  E-value=39  Score=20.32  Aligned_cols=10  Identities=30%  Similarity=0.992  Sum_probs=7.8

Q ss_pred             eCCCCCCccc
Q psy10712         20 KCPNCSTNLG   29 (75)
Q Consensus        20 ~CP~C~aKLG   29 (75)
                      +||+|+..+-
T Consensus         5 HC~~CG~~Ip   14 (59)
T PF09889_consen    5 HCPVCGKPIP   14 (59)
T ss_pred             cCCcCCCcCC
Confidence            6888887765


No 163
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family. Restriction alleviation proteins provide a countermeasure to host cell restriction enzyme defense against foreign DNA such as phage or plasmids. This family consists of homologs to the phage antirestriction protein Lar, and most members belong to phage genomes or prophage regions of bacterial genomes.
Probab=23.42  E-value=41  Score=19.01  Aligned_cols=26  Identities=19%  Similarity=0.446  Sum_probs=15.2

Q ss_pred             eCCCCCCccceee----cCC---CCCCC-CCCcc
Q psy10712         20 KCPNCSTNLGAFD----YVS---GHKCP-CKQQC   45 (75)
Q Consensus        20 ~CP~C~aKLGsf~----wv~---G~kCs-CG~~v   45 (75)
                      -||.|+.+-=.|.    ...   ...|+ ||.-.
T Consensus         3 PCPfCGg~~~~~~~~~~~~~~~~~~~C~~Cga~~   36 (53)
T TIGR03655         3 PCPFCGGADVYLRRGFDPLDLSHYFECSTCGASG   36 (53)
T ss_pred             CCCCCCCcceeeEeccCCCCCEEEEECCCCCCCc
Confidence            5999998765442    211   22576 77753


No 164
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=23.39  E-value=34  Score=20.00  Aligned_cols=10  Identities=30%  Similarity=1.188  Sum_probs=6.3

Q ss_pred             eeCCCCCCcc
Q psy10712         19 LKCPNCSTNL   28 (75)
Q Consensus        19 L~CP~C~aKL   28 (75)
                      +.||.|+..+
T Consensus         1 i~CPyCge~~   10 (52)
T PF14255_consen    1 IQCPYCGEPI   10 (52)
T ss_pred             CCCCCCCCee
Confidence            3577777654


No 165
>cd00029 C1 Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).
Probab=23.38  E-value=34  Score=18.01  Aligned_cols=26  Identities=27%  Similarity=0.727  Sum_probs=19.0

Q ss_pred             eeCCCCCCccceeecCCCCCCC-CCCcc
Q psy10712         19 LKCPNCSTNLGAFDYVSGHKCP-CKQQC   45 (75)
Q Consensus        19 L~CP~C~aKLGsf~wv~G~kCs-CG~~v   45 (75)
                      ..|--|+..|...-- +|.+|+ |+.-+
T Consensus        12 ~~C~~C~~~i~~~~~-~~~~C~~C~~~~   38 (50)
T cd00029          12 TFCDVCRKSIWGLFK-QGLRCSWCKVKC   38 (50)
T ss_pred             CChhhcchhhhcccc-ceeEcCCCCCch
Confidence            457779999877633 789997 76554


No 166
>cd00246 RabGEF Nucleotide exchange factor for Rab-like small GTPases (RabGEF), Mss4 type; RabGEF positely regulates the function of  Rab GTPase by promoting exchange of GDP for GTP; members of the Rab subfamily of Ras GTPases are important in vesicular transport;
Probab=23.32  E-value=43  Score=22.44  Aligned_cols=11  Identities=18%  Similarity=0.800  Sum_probs=8.3

Q ss_pred             eeeCCCCCCcc
Q psy10712         18 KLKCPNCSTNL   28 (75)
Q Consensus        18 KL~CP~C~aKL   28 (75)
                      ++.||.|++++
T Consensus         2 ~v~C~~C~S~V   12 (103)
T cd00246           2 AVLCQRCGSRV   12 (103)
T ss_pred             ceECCCCCCEE
Confidence            47788888776


No 167
>PF09151 DUF1936:  Domain of unknown function (DUF1936);  InterPro: IPR015234 This domain is found in a set of hypothetical archaeal proteins. Its exact function has not, as yet, been defined. ; PDB: 2QH1_B 1PVM_B.
Probab=23.23  E-value=43  Score=18.46  Aligned_cols=9  Identities=33%  Similarity=1.043  Sum_probs=4.8

Q ss_pred             eeCCCCCCc
Q psy10712         19 LKCPNCSTN   27 (75)
Q Consensus        19 L~CP~C~aK   27 (75)
                      -.||+|+.-
T Consensus         2 hlcpkcgvg   10 (36)
T PF09151_consen    2 HLCPKCGVG   10 (36)
T ss_dssp             -B-TTTSSS
T ss_pred             ccCCccCce
Confidence            358888753


No 168
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=23.17  E-value=50  Score=23.71  Aligned_cols=13  Identities=46%  Similarity=0.892  Sum_probs=10.1

Q ss_pred             eeCCCCCCcccee
Q psy10712         19 LKCPNCSTNLGAF   31 (75)
Q Consensus        19 L~CP~C~aKLGsf   31 (75)
                      ..||+|++.+...
T Consensus        40 ~~Cp~C~~~IrG~   52 (158)
T PF10083_consen   40 TSCPNCSTPIRGD   52 (158)
T ss_pred             HHCcCCCCCCCCc
Confidence            5699999998543


No 169
>PRK12366 replication factor A; Reviewed
Probab=23.16  E-value=52  Score=27.47  Aligned_cols=29  Identities=24%  Similarity=0.456  Sum_probs=18.0

Q ss_pred             eeCCCCCCccceeecCCCCCCC-CCCcccceEE
Q psy10712         19 LKCPNCSTNLGAFDYVSGHKCP-CKQQCVPFIH   50 (75)
Q Consensus        19 L~CP~C~aKLGsf~wv~G~kCs-CG~~v~Paf~   50 (75)
                      -.||.|+-|| .-.= ....|. ||+- .|-..
T Consensus       533 ~aCp~CnkKv-~~~~-g~~~C~~c~~~-~p~~~  562 (637)
T PRK12366        533 YLCPNCRKRV-EEVD-GEYICEFCGEV-EPNEL  562 (637)
T ss_pred             ecccccCeEe-EcCC-CcEECCCCCCC-CCcEE
Confidence            3599999999 2211 123685 8887 55443


No 170
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=23.13  E-value=41  Score=17.89  Aligned_cols=10  Identities=30%  Similarity=1.036  Sum_probs=7.3

Q ss_pred             eeCCCCCCcc
Q psy10712         19 LKCPNCSTNL   28 (75)
Q Consensus        19 L~CP~C~aKL   28 (75)
                      ..||.|++.-
T Consensus         3 ~~Cp~Cg~~~   12 (47)
T PF14690_consen    3 PRCPHCGSPS   12 (47)
T ss_pred             ccCCCcCCCc
Confidence            4689998664


No 171
>PF09526 DUF2387:  Probable metal-binding protein (DUF2387);  InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various proteobacteria.
Probab=22.86  E-value=39  Score=20.87  Aligned_cols=27  Identities=22%  Similarity=0.448  Sum_probs=14.6

Q ss_pred             eeCCCCCCcc--cee--ecCCCCCC-CCCCcc
Q psy10712         19 LKCPNCSTNL--GAF--DYVSGHKC-PCKQQC   45 (75)
Q Consensus        19 L~CP~C~aKL--Gsf--~wv~G~kC-sCG~~v   45 (75)
                      -.||+|++-=  =-|  |=+.=..| +||..-
T Consensus         9 a~CP~C~~~D~i~~~~e~~ve~vECV~CGy~e   40 (71)
T PF09526_consen    9 AVCPKCQAMDTIMMWRENGVEYVECVECGYTE   40 (71)
T ss_pred             ccCCCCcCccEEEEEEeCCceEEEecCCCCee
Confidence            3599999742  212  11122567 588754


No 172
>COG1905 NuoE NADH:ubiquinone oxidoreductase 24 kD subunit [Energy production and conversion]
Probab=22.66  E-value=52  Score=23.37  Aligned_cols=24  Identities=25%  Similarity=0.588  Sum_probs=19.7

Q ss_pred             ccceeecCCCCCC--CCCCcccceEEEEc
Q psy10712         27 NLGAFDYVSGHKC--PCKQQCVPFIHLVK   53 (75)
Q Consensus        27 KLGsf~wv~G~kC--sCG~~v~Paf~i~k   53 (75)
                      .=|.|+| .+..|  .|+.  .|.++|+.
T Consensus       113 ~DG~ftl-~~v~ClGaC~~--AP~vmind  138 (160)
T COG1905         113 ADGKFTL-EPVECLGACGQ--APVVMIND  138 (160)
T ss_pred             CCCeEEE-eeeeeeccccc--CCEEEECC
Confidence            3468999 79999  5988  89999875


No 173
>PF12387 Peptidase_C74:  Pestivirus NS2 peptidase;  InterPro: IPR022120  The pestivirus NS2 peptidase is responsible for single cleavage between NS2 and NS3 of the Bovine viral diarrhea virus 1 polyprotein, a cleavage that is correlated with cytopathogenicity []. The peptidase is activated by its interaction with 'J-domain protein interacting with viral protein' - Jiv. ; GO: 0003968 RNA-directed RNA polymerase activity, 0004197 cysteine-type endopeptidase activity, 0004252 serine-type endopeptidase activity, 0016817 hydrolase activity, acting on acid anhydrides, 0017111 nucleoside-triphosphatase activity, 0070008 serine-type exopeptidase activity
Probab=22.46  E-value=54  Score=24.30  Aligned_cols=28  Identities=29%  Similarity=0.818  Sum_probs=21.3

Q ss_pred             ccceeeCCCCCCccceeecCCCCCCC-CCCcccc
Q psy10712         15 LKDKLKCPNCSTNLGAFDYVSGHKCP-CKQQCVP   47 (75)
Q Consensus        15 ~~GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v~P   47 (75)
                      ...-+.|--|..|    +| .|..|+ ||..=.|
T Consensus       159 ~~hcilCtvCe~r----~w-~g~~CPKCGr~G~p  187 (200)
T PF12387_consen  159 SKHCILCTVCEGR----EW-KGGNCPKCGRHGKP  187 (200)
T ss_pred             CCceEEEeeeecC----cc-CCCCCCcccCCCCC
Confidence            4566888889887    58 899998 8887444


No 174
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=22.29  E-value=37  Score=22.88  Aligned_cols=32  Identities=25%  Similarity=0.674  Sum_probs=22.4

Q ss_pred             cccceeeCCCCCC----ccceeec-CCCCCCC-CCCcc
Q psy10712         14 FLKDKLKCPNCST----NLGAFDY-VSGHKCP-CKQQC   45 (75)
Q Consensus        14 ~~~GKL~CP~C~a----KLGsf~w-v~G~kCs-CG~~v   45 (75)
                      +..++++||-|.+    |+|.+.= .+..+|. |+.-.
T Consensus        26 ~~~~~~~cP~C~s~~~~k~g~~~~~~qRyrC~~C~~tf   63 (129)
T COG3677          26 MQITKVNCPRCKSSNVVKIGGIRRGHQRYKCKSCGSTF   63 (129)
T ss_pred             hhcccCcCCCCCccceeeECCccccccccccCCcCcce
Confidence            4689999999986    4454433 4778885 88743


No 175
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=22.13  E-value=41  Score=23.58  Aligned_cols=31  Identities=23%  Similarity=0.590  Sum_probs=18.4

Q ss_pred             eeeCCCCCCccceeecCCCCCCC-CCCc----ccceEEEEc
Q psy10712         18 KLKCPNCSTNLGAFDYVSGHKCP-CKQQ----CVPFIHLVK   53 (75)
Q Consensus        18 KL~CP~C~aKLGsf~wv~G~kCs-CG~~----v~Paf~i~k   53 (75)
                      .-.||.|+.    +.- .-..|+ ||.-    +.-|+-|.+
T Consensus       309 S~~C~~cg~----~~~-r~~~C~~cg~~~~rD~naa~Ni~~  344 (364)
T COG0675         309 SKTCPCCGH----LSG-RLFKCPRCGFVHDRDVNAALNIAR  344 (364)
T ss_pred             cccccccCC----ccc-eeEECCCCCCeehhhHHHHHHHHH
Confidence            356999998    332 335787 8853    444444443


No 176
>PRK14701 reverse gyrase; Provisional
Probab=21.50  E-value=39  Score=31.54  Aligned_cols=24  Identities=25%  Similarity=0.631  Sum_probs=20.5

Q ss_pred             eeCCCCCCccceeecCCCCCCC-CC
Q psy10712         19 LKCPNCSTNLGAFDYVSGHKCP-CK   42 (75)
Q Consensus        19 L~CP~C~aKLGsf~wv~G~kCs-CG   42 (75)
                      -.||||+..+-+..-..|.-|. |=
T Consensus         7 ~~cpnc~g~~~~~rl~~g~~c~~cl   31 (1638)
T PRK14701          7 EMCPNCGGDITDERLAEKGVCEKCL   31 (1638)
T ss_pred             ccCCCCCCccchhHHhcCCCchhhc
Confidence            4699999999999887889886 74


No 177
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=21.39  E-value=57  Score=17.71  Aligned_cols=12  Identities=33%  Similarity=1.035  Sum_probs=8.2

Q ss_pred             eCCCCCCcccee
Q psy10712         20 KCPNCSTNLGAF   31 (75)
Q Consensus        20 ~CP~C~aKLGsf   31 (75)
                      .||+|+.+--.|
T Consensus         2 ~Cp~C~~~~a~~   13 (40)
T smart00440        2 PCPKCGNREATF   13 (40)
T ss_pred             cCCCCCCCeEEE
Confidence            588888665554


No 178
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=21.19  E-value=41  Score=21.32  Aligned_cols=19  Identities=26%  Similarity=0.565  Sum_probs=14.1

Q ss_pred             ccceeeCCCCCCccceeec
Q psy10712         15 LKDKLKCPNCSTNLGAFDY   33 (75)
Q Consensus        15 ~~GKL~CP~C~aKLGsf~w   33 (75)
                      .+=+-.|++|+..++..+=
T Consensus         5 Lk~~~~C~~CG~d~~~~~a   23 (86)
T PF06170_consen    5 LKVAPRCPHCGLDYSHARA   23 (86)
T ss_pred             ccCCCcccccCCccccCCc
Confidence            3445579999999987764


No 179
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=21.03  E-value=51  Score=19.65  Aligned_cols=12  Identities=33%  Similarity=0.598  Sum_probs=8.5

Q ss_pred             ceeeCCCCCCcc
Q psy10712         17 DKLKCPNCSTNL   28 (75)
Q Consensus        17 GKL~CP~C~aKL   28 (75)
                      =|..||.|++.+
T Consensus        16 Lk~~CP~CG~~t   27 (56)
T PRK13130         16 LKEICPVCGGKT   27 (56)
T ss_pred             ccccCcCCCCCC
Confidence            367788888764


No 180
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=21.00  E-value=44  Score=22.96  Aligned_cols=8  Identities=38%  Similarity=1.015  Sum_probs=4.2

Q ss_pred             CCCCCCcc
Q psy10712         21 CPNCSTNL   28 (75)
Q Consensus        21 CP~C~aKL   28 (75)
                      ||+|+.|.
T Consensus       112 Cp~c~~r~  119 (158)
T TIGR00373       112 CPNMCVRF  119 (158)
T ss_pred             CCCCCcEe
Confidence            55555544


No 181
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=20.92  E-value=46  Score=16.35  Aligned_cols=11  Identities=27%  Similarity=0.981  Sum_probs=7.9

Q ss_pred             eeCCCCCCccc
Q psy10712         19 LKCPNCSTNLG   29 (75)
Q Consensus        19 L~CP~C~aKLG   29 (75)
                      +.||.|+-+.+
T Consensus         3 ~~C~~CgR~F~   13 (25)
T PF13913_consen    3 VPCPICGRKFN   13 (25)
T ss_pred             CcCCCCCCEEC
Confidence            46888887654


No 182
>PF04475 DUF555:  Protein of unknown function (DUF555);  InterPro: IPR007564 This is a family of uncharacterised, hypothetical archaeal proteins.
Probab=20.56  E-value=50  Score=22.17  Aligned_cols=13  Identities=31%  Similarity=0.823  Sum_probs=9.0

Q ss_pred             cceeeCCCCCCcc
Q psy10712         16 KDKLKCPNCSTNL   28 (75)
Q Consensus        16 ~GKL~CP~C~aKL   28 (75)
                      -|-..||+|+..|
T Consensus        45 vG~~~cP~Cge~~   57 (102)
T PF04475_consen   45 VGDTICPKCGEEL   57 (102)
T ss_pred             cCcccCCCCCCcc
Confidence            3667788887665


No 183
>PRK12496 hypothetical protein; Provisional
Probab=20.50  E-value=45  Score=23.18  Aligned_cols=10  Identities=20%  Similarity=0.657  Sum_probs=7.5

Q ss_pred             eCCCCCCccc
Q psy10712         20 KCPNCSTNLG   29 (75)
Q Consensus        20 ~CP~C~aKLG   29 (75)
                      .||.|+++|=
T Consensus       145 ~C~~CG~~~~  154 (164)
T PRK12496        145 VCEICGSPVK  154 (164)
T ss_pred             cCCCCCChhh
Confidence            4888888763


No 184
>TIGR01054 rgy reverse gyrase. Generally, these gyrases are encoded as a single polypeptide. An exception was found in Methanopyrus kandleri, where enzyme is split within the topoisomerase domain, yielding a heterodimer of gene products designated RgyB and RgyA.
Probab=20.49  E-value=47  Score=29.83  Aligned_cols=25  Identities=28%  Similarity=0.705  Sum_probs=20.7

Q ss_pred             eeCCCCCCccceeecCCCCCCC-CCC
Q psy10712         19 LKCPNCSTNLGAFDYVSGHKCP-CKQ   43 (75)
Q Consensus        19 L~CP~C~aKLGsf~wv~G~kCs-CG~   43 (75)
                      -.||||+..+-++.-..|.-|. |-.
T Consensus         8 ~~CPnCgg~i~~~rl~~~~~c~~Clp   33 (1171)
T TIGR01054         8 NLCPNCGGEISSERLEKGLPCARCLP   33 (1171)
T ss_pred             CCCCCCCCccchhHhhcCCCccccCc
Confidence            4699999999998887788886 754


No 185
>PRK11788 tetratricopeptide repeat protein; Provisional
Probab=20.45  E-value=87  Score=22.56  Aligned_cols=27  Identities=30%  Similarity=0.774  Sum_probs=18.7

Q ss_pred             cceeeCCCCCCccceeecCCCCCCC-CCCccc
Q psy10712         16 KDKLKCPNCSTNLGAFDYVSGHKCP-CKQQCV   46 (75)
Q Consensus        16 ~GKL~CP~C~aKLGsf~wv~G~kCs-CG~~v~   46 (75)
                      +-.-.|.+|+..-=.|-|    .|+ ||+|=|
T Consensus       352 ~p~~~c~~cg~~~~~~~~----~c~~c~~~~~  379 (389)
T PRK11788        352 KPRYRCRNCGFTARTLYW----HCPSCKAWET  379 (389)
T ss_pred             CCCEECCCCCCCCcccee----ECcCCCCccC
Confidence            334569889887666666    575 888853


No 186
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=20.19  E-value=41  Score=17.74  Aligned_cols=13  Identities=38%  Similarity=0.820  Sum_probs=10.1

Q ss_pred             eeCCCCCCcccee
Q psy10712         19 LKCPNCSTNLGAF   31 (75)
Q Consensus        19 L~CP~C~aKLGsf   31 (75)
                      -.||.|++.-..|
T Consensus        19 ~~CP~Cg~~~~~F   31 (34)
T cd00729          19 EKCPICGAPKEKF   31 (34)
T ss_pred             CcCcCCCCchHHc
Confidence            3799999976655


Done!