Query         psy10732
Match_columns 58
No_of_seqs    103 out of 176
Neff          5.3 
Searched_HMMs 46136
Date          Fri Aug 16 17:08:43 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10732.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10732hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF09138 Urm1:  Urm1 (Ubiquitin  99.9 2.6E-26 5.6E-31  140.0   3.2   57    2-58      1-57  (96)
  2 KOG4146|consensus               99.8 2.2E-20 4.8E-25  114.4   5.8   58    1-58      5-62  (101)
  3 cd01764 Urm1 Urm1-like ubuitin  99.5 3.9E-14 8.4E-19   85.1   5.0   54    3-57      1-54  (94)
  4 COG5131 URM1 Ubiquitin-like pr  99.0   1E-09 2.3E-14   67.0   4.4   55    1-58      1-57  (96)
  5 PLN02799 Molybdopterin synthas  92.9    0.31 6.7E-06   27.5   4.2   41    1-45      2-42  (82)
  6 cd00754 MoaD Ubiquitin domain   91.8    0.45 9.8E-06   26.2   4.0   39    3-45      1-39  (80)
  7 TIGR01682 moaD molybdopterin c  89.9    0.85 1.9E-05   25.6   4.0   40    3-45      1-40  (80)
  8 TIGR01687 moaD_arch MoaD famil  88.3    0.97 2.1E-05   25.6   3.5   38    3-45      1-38  (88)
  9 PF12053 DUF3534:  Domain of un  76.3     2.6 5.7E-05   27.4   2.3   36    1-47      1-36  (145)
 10 PRK11130 moaD molybdopterin sy  72.2     9.8 0.00021   21.4   3.8   38    3-45      2-39  (81)
 11 PF04110 APG12:  Ubiquitin-like  69.7      17 0.00036   21.7   4.6   45    3-54      4-49  (87)
 12 cd00196 UBQ Ubiquitin-like pro  64.9      12 0.00025   17.4   2.8   25   18-45      7-31  (69)
 13 COG2372 CopC Uncharacterized p  64.8     4.6  0.0001   25.9   1.5   18    2-19     48-65  (127)
 14 PF14451 Ub-Mut7C:  Mut7-C ubiq  64.2      11 0.00023   22.0   2.9   39    2-41      3-42  (81)
 15 cd04438 DEP_dishevelled DEP (D  59.7     9.1  0.0002   22.4   2.1   34   15-51     16-51  (84)
 16 PF05372 Delta_lysin:  Delta ly  56.9     9.2  0.0002   18.1   1.4   14   32-45      7-20  (25)
 17 KOG1654|consensus               56.4      25 0.00054   22.3   3.7   41    1-46     29-69  (116)
 18 PHA02141 hypothetical protein   56.3     7.3 0.00016   23.9   1.3   15   32-46      3-17  (105)
 19 PF02597 ThiS:  ThiS family;  I  56.1      25 0.00054   18.8   3.4   34    6-45      2-35  (77)
 20 PRK09184 acyl carrier protein;  56.0     3.4 7.4E-05   24.3  -0.2   36   11-46     48-88  (89)
 21 PF00733 Asn_synthase:  Asparag  53.9     8.5 0.00018   24.4   1.4   12    2-13     19-30  (255)
 22 PF07912 ERp29_N:  ERp29, N-ter  51.1     9.7 0.00021   24.4   1.3   24   20-44     95-118 (126)
 23 COG4134 ABC-type uncharacteriz  48.7      27 0.00058   26.2   3.4   38    8-45    140-179 (384)
 24 smart00666 PB1 PB1 domain. Pho  46.9      48   0.001   18.0   4.6   33    2-46      3-35  (81)
 25 PF09379 FERM_N:  FERM N-termin  46.5      47   0.001   17.9   3.7   32   19-53      7-38  (80)
 26 PF04424 DUF544:  Protein of un  46.2      15 0.00033   22.5   1.6   28   23-50     10-37  (121)
 27 cd01612 APG12_C Ubiquitin-like  45.5      56  0.0012   19.1   3.9   30   22-54     19-49  (87)
 28 cd01611 GABARAP Ubiquitin doma  45.4      70  0.0015   19.6   5.4   48    2-54     26-74  (112)
 29 cd01812 BAG1_N Ubiquitin-like   45.1      47   0.001   17.4   4.7   32    1-44      1-32  (71)
 30 PRK14561 hypothetical protein;  44.8      14 0.00031   24.0   1.4   15    1-15      1-15  (194)
 31 PTZ00380 microtubule-associate  44.2      81  0.0018   19.9   5.0   46    1-54     28-73  (121)
 32 cd05992 PB1 The PB1 domain is   43.9      53  0.0011   17.7   4.2   35    2-47      2-36  (81)
 33 PRK14752 delta-hemolysin; Prov  42.2      20 0.00044   18.9   1.5   15   32-46     25-39  (44)
 34 PF07549 Sec_GG:  SecD/SecF GG   41.9     6.4 0.00014   18.8  -0.5   13    2-14     10-22  (31)
 35 COG0830 UreF Urease accessory   41.5      19 0.00042   24.8   1.7   29    6-45     24-52  (229)
 36 PRK13291 metal-dependent hydro  40.8      12 0.00027   23.9   0.6   23   24-46     49-71  (173)
 37 PRK00468 hypothetical protein;  40.5      26 0.00057   20.1   1.9   21   34-54      1-21  (75)
 38 PRK07117 acyl carrier protein;  38.4     4.9 0.00011   23.1  -1.4   27   19-45     51-79  (79)
 39 PF11976 Rad60-SLD:  Ubiquitin-  38.1      65  0.0014   17.1   3.3   38    1-49      1-38  (72)
 40 cd01805 RAD23_N Ubiquitin-like  36.4      72  0.0016   17.1   4.6   34    1-45      1-34  (77)
 41 PF02084 Bindin:  Bindin;  Inte  36.3      30 0.00065   24.4   2.0   27   21-47    116-145 (238)
 42 PRK02821 hypothetical protein;  35.5      47   0.001   19.2   2.5   21   34-54      2-22  (77)
 43 PF09364 XFP_N:  XFP N-terminal  35.5      12 0.00027   27.8  -0.0   37   16-56    297-335 (379)
 44 KOG0626|consensus               35.3      35 0.00075   26.5   2.3   22   31-54    391-412 (524)
 45 PRK12449 acyl carrier protein;  35.2      34 0.00074   18.7   1.8   26   20-45     52-79  (80)
 46 PRK10738 hypothetical protein;  35.1      50  0.0011   20.5   2.7   39    1-39      1-42  (134)
 47 PRK01064 hypothetical protein;  34.6      37  0.0008   19.7   1.9   21   34-54      1-21  (78)
 48 KOG4027|consensus               34.2      35 0.00075   23.2   2.0   23   21-43    115-139 (187)
 49 PF13085 Fer2_3:  2Fe-2S iron-s  33.7      78  0.0017   19.4   3.4   23   20-45     20-42  (110)
 50 smart00049 DEP Domain found in  33.4      45 0.00097   18.1   2.1   16   31-46     20-35  (77)
 51 PF08825 E2_bind:  E2 binding d  33.2      35 0.00076   19.9   1.7   15   30-44      5-19  (84)
 52 PF03164 Mon1:  Trafficking pro  32.6      35 0.00075   25.0   1.9   21   33-57    392-412 (415)
 53 cd04450 DEP_RGS7-like DEP (Dis  32.5      64  0.0014   18.5   2.7   38    9-51     11-49  (88)
 54 PF09358 UBA_e1_C:  Ubiquitin-a  32.4      38 0.00083   20.9   1.9   15   31-45     42-56  (125)
 55 PF01372 Melittin:  Melittin;    32.2      35 0.00075   16.3   1.3   11   34-44     13-23  (26)
 56 PF12646 DUF3783:  Domain of un  31.1      91   0.002   16.7   3.2   18   27-44     36-53  (58)
 57 PF05193 Peptidase_M16_C:  Pept  30.7      34 0.00073   19.9   1.4   26   32-57      2-27  (184)
 58 COG0278 Glutaredoxin-related p  30.6      23  0.0005   22.1   0.6   14    3-16     77-90  (105)
 59 PRK13344 spxA transcriptional   30.0      27 0.00059   21.6   0.9   43    8-50     50-93  (132)
 60 KOG0911|consensus               30.0      24 0.00051   24.7   0.7   17    3-19    200-216 (227)
 61 KOG4392|consensus               29.6      87  0.0019   19.9   3.1   39   13-54     11-59  (117)
 62 PF09494 Slx4:  Slx4 endonuclea  29.4      52  0.0011   17.9   1.9   17   30-46     23-39  (64)
 63 PF09865 DUF2092:  Predicted pe  29.2      81  0.0018   21.3   3.2   25   30-54     88-114 (214)
 64 PF05595 DUF771:  Domain of unk  29.1      54  0.0012   19.1   2.0   18   31-48     23-47  (91)
 65 PTZ00171 acyl carrier protein;  28.3     9.2  0.0002   24.6  -1.5   37   11-47    108-146 (148)
 66 PF14658 EF-hand_9:  EF-hand do  27.7      50  0.0011   18.7   1.7   16   30-45     13-28  (66)
 67 cd04441 DEP_2_DEP6 DEP (Dishev  27.7      28  0.0006   20.5   0.6   20   32-51     33-53  (85)
 68 cd01806 Nedd8 Nebb8-like  ubiq  27.7   1E+02  0.0022   16.2   4.6   34    1-45      1-34  (76)
 69 PF06117 DUF957:  Enterobacteri  27.5      64  0.0014   18.5   2.1   21   33-53      9-29  (65)
 70 COG4822 CbiK Cobalamin biosynt  27.3      37  0.0008   24.2   1.3   26   32-57    179-207 (265)
 71 TIGR03083 uncharacterized Acti  26.7      67  0.0015   20.3   2.3   22   23-44     21-42  (202)
 72 PF11716 MDMPI_N:  Mycothiol ma  26.6      67  0.0015   18.7   2.2   16   29-44     26-41  (140)
 73 cd00059 FH Forkhead (FH), also  26.0      73  0.0016   18.3   2.2   18   29-46     19-36  (78)
 74 cd01803 Ubiquitin Ubiquitin. U  25.4 1.1E+02  0.0025   16.0   4.5   33    1-44      1-33  (76)
 75 PF11641 Antigen_Bd37:  Glycosy  25.3      32  0.0007   23.9   0.7   15   28-42     25-39  (224)
 76 PF08817 YukD:  WXG100 protein   25.2      64  0.0014   17.9   1.8   26   18-46     12-37  (79)
 77 TIGR00517 acyl_carrier acyl ca  24.5      61  0.0013   17.6   1.6   34   11-44     41-76  (77)
 78 TIGR01034 metK S-adenosylmethi  24.4 1.8E+02  0.0039   21.8   4.4   41    2-47    164-205 (377)
 79 KOG3571|consensus               24.0      69  0.0015   25.3   2.3   37   10-51    406-444 (626)
 80 KOG3954|consensus               23.9      59  0.0013   23.8   1.8   19   34-52    196-215 (336)
 81 PRK13021 secF preprotein trans  23.5 1.9E+02  0.0041   20.5   4.3   31    3-44     35-65  (297)
 82 PF02991 Atg8:  Autophagy prote  23.4 1.8E+02  0.0039   17.5   5.1   48    2-54     18-66  (104)
 83 cd00166 SAM Sterile alpha moti  23.2      79  0.0017   15.8   1.8   15   32-46      2-16  (63)
 84 PF00034 Cytochrom_C:  Cytochro  22.8      74  0.0016   16.4   1.7   12   32-43     78-89  (91)
 85 PRK08172 putative acyl carrier  22.7      72  0.0016   18.2   1.7   28   18-45     49-78  (82)
 86 cd04439 DEP_1_P-Rex DEP (Dishe  22.6      54  0.0012   18.9   1.2   32   15-49     15-46  (81)
 87 cd04371 DEP DEP domain, named   22.6      67  0.0015   17.3   1.5   16   31-46     28-43  (81)
 88 PF09467 Yopt:  Hypothetical pr  22.5      83  0.0018   18.2   1.9   22   34-55     25-46  (71)
 89 COG0137 ArgG Argininosuccinate  22.5      54  0.0012   24.7   1.4   12    2-13      6-17  (403)
 90 PF10827 DUF2552:  Protein of u  22.5      72  0.0016   18.9   1.7   16   30-45     57-72  (79)
 91 PF02350 Epimerase_2:  UDP-N-ac  22.2      50  0.0011   23.3   1.2   39   20-58     36-77  (346)
 92 PRK08364 sulfur carrier protei  22.1      97  0.0021   16.9   2.1   19   21-42     16-34  (70)
 93 PRK12459 S-adenosylmethionine   21.4 1.8E+02  0.0038   21.9   3.9   41    2-47    171-212 (386)
 94 COG1365 Predicted ATPase (PP-l  21.2      61  0.0013   23.0   1.4   13    1-13     61-73  (255)
 95 cd04449 DEP_DEPDC5-like DEP (D  21.1      49  0.0011   18.9   0.8   20   32-51     30-51  (83)
 96 cd01712 ThiI ThiI is required   21.1      62  0.0013   20.1   1.3   14    2-15      1-14  (177)
 97 cd03001 PDI_a_P5 PDIa family,   21.1      96  0.0021   16.8   2.0   12   30-41     91-102 (103)
 98 PF12140 DUF3588:  Protein of u  21.0 1.3E+02  0.0027   18.8   2.7   23   17-42     77-99  (118)
 99 TIGR01307 pgm_bpd_ind 2,3-bisp  21.0 3.5E+02  0.0077   20.8   5.5   53    2-54    329-386 (501)
100 PF14237 DUF4339:  Domain of un  20.9 1.2E+02  0.0026   15.1   2.2   19   30-48     12-30  (45)
101 PF00610 DEP:  Domain found in   20.7      80  0.0017   16.9   1.6   16   30-45     16-31  (74)
102 PTZ00273 oxidase reductase; Pr  20.7      62  0.0013   22.4   1.4   39    8-48    214-254 (320)
103 smart00339 FH FORKHEAD. FORKHE  20.7   1E+02  0.0023   17.9   2.2   18   29-46     19-36  (89)
104 PRK11106 queuosine biosynthesi  20.7      67  0.0015   21.8   1.5   12    2-13      3-14  (231)
105 cd08532 SAM_PNT-PDEF-like Ster  20.7      75  0.0016   18.3   1.5   22   22-43      3-24  (76)
106 COG1837 Predicted RNA-binding   20.6      76  0.0017   18.5   1.5   19   34-52      1-19  (76)
107 cd01991 Asn_Synthase_B_C The C  20.6      63  0.0014   21.0   1.3   12    2-13     17-28  (269)
108 cd01996 Alpha_ANH_like_III Thi  20.5      61  0.0013   19.5   1.2   14    2-15      3-16  (154)
109 CHL00124 acpP acyl carrier pro  20.4      87  0.0019   17.1   1.7   34   12-45     44-79  (82)
110 PRK09583 mycothiol-dependent m  20.4      85  0.0019   21.0   2.0   23   23-45     36-58  (241)
111 PF00085 Thioredoxin:  Thioredo  20.3 1.2E+02  0.0025   16.3   2.2   15   30-44     89-103 (103)
112 PLN02639 oxidoreductase, 2OG-F  20.2      62  0.0013   22.8   1.3   37    8-47    227-265 (337)
113 cd01713 PAPS_reductase This do  20.1      70  0.0015   18.7   1.4   13    2-14      1-13  (173)
114 cd04878 ACT_AHAS N-terminal AC  20.1      90   0.002   15.5   1.6   24   21-44      1-24  (72)

No 1  
>PF09138 Urm1:  Urm1 (Ubiquitin related modifier);  InterPro: IPR015221 Ubiquitin related modifier 1 (Urm1) is a ubiquitin related protein that modifies proteins in the yeast ubiquitin-like urmylation pathway []. Structural comparisons and phylogenetic analysis of the ubiquitin superfamily has indicated that Urm1 has the most conserved structural and sequence features of the common ancestor of the entire superfamily []. ; GO: 0034227 tRNA thio-modification, 0005737 cytoplasm; PDB: 2AX5_A 2QJL_A 2PKO_A 1WGK_A 1XO3_A 2K9X_A.
Probab=99.92  E-value=2.6e-26  Score=139.97  Aligned_cols=57  Identities=58%  Similarity=0.965  Sum_probs=49.8

Q ss_pred             eEEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhccCCCCCceecCCC
Q psy10732          2 KITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNKLTERPELFVQGDS   58 (58)
Q Consensus         2 ~i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nll~er~elFv~~~t   58 (58)
                      +|+|||+||||+||+|||+|++++|..++++||++||+|||+|++++|||+|+++++
T Consensus         1 ~i~vEF~GGlE~Lf~~~k~h~v~l~~~~~~~ti~~Li~~l~~nll~~r~elF~~~~~   57 (96)
T PF09138_consen    1 KITVEFSGGLELLFGNQKKHKVSLPSDGEPATIKDLIDYLRDNLLKERPELFLEGGS   57 (96)
T ss_dssp             EEEEEEETTCGGGTTT-SEEEEEE-SSCSC-BHHHHHHHHCCCT-SSGHHHHBSSSS
T ss_pred             CEEEEEcCcHHHHhCCceeEEEEcCCCCCCcCHHHHHHHHHHhccCCCHhHEecCCe
Confidence            689999999999999999999999977778999999999999999999999998764


No 2  
>KOG4146|consensus
Probab=99.82  E-value=2.2e-20  Score=114.38  Aligned_cols=58  Identities=34%  Similarity=0.554  Sum_probs=54.8

Q ss_pred             CeEEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhccCCCCCceecCCC
Q psy10732          1 MKITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNKLTERPELFVQGDS   58 (58)
Q Consensus         1 ~~i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nll~er~elFv~~~t   58 (58)
                      +.++|||.||+|++|++||.|.+++|...+|||+++||.||..|++++|+++|+++||
T Consensus         5 ~~vkvef~Gg~dllfn~~k~~~~~l~~~e~~~tvgdll~yi~~~~ie~r~~lFi~~gs   62 (101)
T KOG4146|consen    5 HEVKVEFLGGLDLLFNKQKIHLTRLEVGESPATVGDLLDYIFGKYIETRDSLFIHHGS   62 (101)
T ss_pred             eeEEEEEcCceeeeECCeEEEEEecccCCCcccHHHHHHHHHHHHhcCCcceEeeCCc
Confidence            5789999999999999999999999977789999999999999999999999998875


No 3  
>cd01764 Urm1 Urm1-like ubuitin domain. Urm1 (Ubiquitin-Related Modifier1)  The Urm1 fold, like those of two closely related proteins MoaD (molybdopterin synthase) and ThiS (sulfur carrier protein), is similar to that of ubiquitin although there is little or no sequence similarity. The C-terminal glycines of Urm1 are conjugated to an E1-like protein Uba4 as part of a novel conjugation system in yeast.  The Urm1 fold is found only in eukaryotes.
Probab=99.50  E-value=3.9e-14  Score=85.14  Aligned_cols=54  Identities=46%  Similarity=0.812  Sum_probs=48.4

Q ss_pred             EEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhccCCCCCceecCC
Q psy10732          3 ITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNKLTERPELFVQGD   57 (58)
Q Consensus         3 i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nll~er~elFv~~~   57 (58)
                      |+|||+||||.+|+++++|.+++|.+ ++.||++||+||++++...|+++|.+++
T Consensus         1 i~v~f~ggl~~~~~~~~~~~~~~~~~-~~~tV~dll~~L~~~~~~~~~~lf~~~g   54 (94)
T cd01764           1 IKVEFLGGLELLFGNQKEHHVVLDGE-KPVTVGDLLDYVASNLLEERPDLFIEGG   54 (94)
T ss_pred             CEEEEechHHHHhCCceEEEEeccCC-CCCcHHHHHHHHHHhCchhhhhhEecCC
Confidence            58999999999999999999999954 4479999999999999888999998654


No 4  
>COG5131 URM1 Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones]
Probab=98.96  E-value=1e-09  Score=66.96  Aligned_cols=55  Identities=18%  Similarity=0.340  Sum_probs=44.8

Q ss_pred             CeEEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhccC--CCCCceecCCC
Q psy10732          1 MKITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNKLT--ERPELFVQGDS   58 (58)
Q Consensus         1 ~~i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nll~--er~elFv~~~t   58 (58)
                      |.++|||.|||+++|+ ||.|++++.. .++++++.||++++. ++.  .|.++|++.++
T Consensus         1 ~~~KvellGgld~~fn-qR~~el~~~~-~e~~~vg~liD~~~~-~i~~p~~~sifie~g~   57 (96)
T COG5131           1 HEMKVELLGGLDVEFN-QREIELTREE-VEGSSVGTLIDALRY-FIYAPTRDSIFIEHGE   57 (96)
T ss_pred             CCceEEEeccchhhhc-ceeeEEEEcc-cCCcchhhHHHHHHH-HHhCCccceeeecCCC
Confidence            5689999999999999 9999999883 356999999999998 332  25578887653


No 5  
>PLN02799 Molybdopterin synthase sulfur carrier subunit
Probab=92.87  E-value=0.31  Score=27.52  Aligned_cols=41  Identities=29%  Similarity=0.270  Sum_probs=31.6

Q ss_pred             CeEEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhc
Q psy10732          1 MKITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNK   45 (58)
Q Consensus         1 ~~i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nl   45 (58)
                      |+|+|-|-|-+--.++ .+...+++|   ..+|+++|++++..+.
T Consensus         2 m~i~V~~fa~~re~~g-~~~~~~~~~---~~~tv~~L~~~l~~~~   42 (82)
T PLN02799          2 VEIKVLFFARARELTG-VSDMTLELP---AGSTTADCLAELVAKF   42 (82)
T ss_pred             eEEEEEehHHHHHHhC-CCeEEEECC---CCCcHHHHHHHHHHHC
Confidence            6899999998876776 445567777   2489999999997654


No 6  
>cd00754 MoaD Ubiquitin domain of MoaD-like proteins. MoaD family. Members of this family are involved in biosynthesis of the molybdenum cofactor (Moco), an essential cofactor of a diverse group of redox enzymes. Moco biosynthesis is an evolutionarily conserved pathway present in eubacteria, archaea and eukaryotes. Moco contains a tricyclic pyranopterin, termed molybdopterin (MPT), that contains the cis-dithiolene group responsible for molybdenum ligation. This dithiolene group is generated by MPT synthase, the second major step in Moco biosynthesis. MPT synthase consists of a large (MoeE) and small (MoaD) subunit. The small subunit  is inserted into the lare subunit to form the active site.  The small subunit, which is structurally similar to ubiquitin, contains a C-terminal thiocarboxylated glycine residue that serves as a sulfur donor for the synthesis of the MPT dithiolene group.
Probab=91.75  E-value=0.45  Score=26.19  Aligned_cols=39  Identities=23%  Similarity=0.284  Sum_probs=30.1

Q ss_pred             EEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhc
Q psy10732          3 ITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNK   45 (58)
Q Consensus         3 i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nl   45 (58)
                      |+|.|-|.|--+++.. ..++++|.   ..|+++|++++.+..
T Consensus         1 i~v~~f~~l~~~~g~~-~~~~~~~~---~~tv~~ll~~l~~~~   39 (80)
T cd00754           1 VKVLYFARLREAAGKD-EEELELPE---GATVGELLDALEARY   39 (80)
T ss_pred             CEEEEeHHHHHHhCCc-eEEEECCC---CCcHHHHHHHHHHHC
Confidence            5788899988777653 46777773   479999999998764


No 7  
>TIGR01682 moaD molybdopterin converting factor, subunit 1, non-archaeal. The C-terminal Gly-Gly of this model is critical to function.
Probab=89.89  E-value=0.85  Score=25.60  Aligned_cols=40  Identities=25%  Similarity=0.255  Sum_probs=29.9

Q ss_pred             EEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhc
Q psy10732          3 ITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNK   45 (58)
Q Consensus         3 i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nl   45 (58)
                      |+|.|-|.+--.++. +.-++++|.+  ..|+++|+++|.+.+
T Consensus         1 v~V~~fa~lr~~~g~-~~~~~~~~~~--~~tv~~L~~~L~~~~   40 (80)
T TIGR01682         1 IKVLYFARLREQAGT-DEETLELPDE--STTVGELKEHLAKEG   40 (80)
T ss_pred             CEEEEeHHHHHHhCC-CeEEEECCCC--CcCHHHHHHHHHHhC
Confidence            467788888777774 3446778843  379999999998875


No 8  
>TIGR01687 moaD_arch MoaD family protein, archaeal. Members of this family appear to be archaeal versions of MoaD, subunit 1 of molybdopterin converting factor. This model has been split from the bacterial/eukaryotic equivalog model TIGR01682 because the presence of two members of this family in a substantial number of archaeal species suggests that roles might not be interchangeable.
Probab=88.32  E-value=0.97  Score=25.63  Aligned_cols=38  Identities=16%  Similarity=0.217  Sum_probs=28.9

Q ss_pred             EEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhc
Q psy10732          3 ITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNK   45 (58)
Q Consensus         3 i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nl   45 (58)
                      |+|.|-|.+--+++... -++++|    .+|+++|++++.+++
T Consensus         1 v~V~~fa~lre~~g~~~-~~v~~~----~~tv~~l~~~l~~~~   38 (88)
T TIGR01687         1 VRVKYFATLRDITGKKS-EEIEIE----GKTVGDLLNELMARY   38 (88)
T ss_pred             CEEEEEhHHHHHhCCce-EEEEeC----CCCHHHHHHHHHHHC
Confidence            57888898888888543 345554    289999999998775


No 9  
>PF12053 DUF3534:  Domain of unknown function (DUF3534);  InterPro: IPR021922  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is about 150 amino acids in length. This domain is found associated with PF00595 from PFAM. This domain has a conserved GILD sequence motif. ; PDB: 2NS5_A.
Probab=76.28  E-value=2.6  Score=27.40  Aligned_cols=36  Identities=31%  Similarity=0.475  Sum_probs=22.5

Q ss_pred             CeEEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhccC
Q psy10732          1 MKITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNKLT   47 (58)
Q Consensus         1 ~~i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nll~   47 (58)
                      |+|||-|        ++.   .|.+|-..+.+||++|+.....++.|
T Consensus         1 mkvtV~f--------g~~---~vvVPC~dg~~tV~~L~~~A~~RY~K   36 (145)
T PF12053_consen    1 MKVTVCF--------GRT---RVVVPCGDGQLTVRDLIQQALRRYRK   36 (145)
T ss_dssp             -EEEEEE--------TTE---EEEEEESSS---HHHHHHHHHHHHHH
T ss_pred             CeEEEEe--------CCe---EEEEEeCCCCccHHHHHHHHhHhHHH
Confidence            6777655        443   46678555679999999988777765


No 10 
>PRK11130 moaD molybdopterin synthase small subunit; Provisional
Probab=72.23  E-value=9.8  Score=21.42  Aligned_cols=38  Identities=26%  Similarity=0.267  Sum_probs=27.3

Q ss_pred             EEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhc
Q psy10732          3 ITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNK   45 (58)
Q Consensus         3 i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nl   45 (58)
                      |+|-|-+-+-=+++. +.  ++++.++  .|+++|+++|.++.
T Consensus         2 v~V~~Fa~lre~~g~-~~--~~v~~~~--~tv~~l~~~L~~~~   39 (81)
T PRK11130          2 IKVLFFAQVRELVGT-DA--LELAADF--PTVEALRQHLAQKG   39 (81)
T ss_pred             EEEEEeHHHHHHhCC-ce--EEecCCC--CCHHHHHHHHHHhC
Confidence            677777777777774 33  4555322  79999999998875


No 11 
>PF04110 APG12:  Ubiquitin-like autophagy protein Apg12 ;  InterPro: IPR007242 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells. In yeast, 15 Apg proteins coordinate the formation of autophagosomes. No molecule involved in autophagy has yet been identified in higher eukaryotes []. The pre-autophagosomal structure contains at least five Apg proteins: Apg1p, Apg2p, Apg5p, Aut7p/Apg8p and Apg16p. It is found in the vacuole []. The C-terminal glycine of Apg12p is conjugated to a lysine residue of Apg5p via an isopeptide bond. During autophagy, cytoplasmic components are enclosed in autophagosomes and delivered to lysosomes/vacuoles. Auotphagy protein 16 (Apg16) has been shown to be bind to Apg5 and is required for the function of the Apg12p-Apg5p conjugate []. Autophagy protein 5 (Apg5) is directly required for the import of aminopeptidase I via the cytoplasm-to-vacuole targeting pathway []. This entry represents Apg12, which is covalently bound to Apg5 [].; GO: 0000045 autophagic vacuole assembly, 0005737 cytoplasm; PDB: 1WZ3_B.
Probab=69.72  E-value=17  Score=21.69  Aligned_cols=45  Identities=22%  Similarity=0.324  Sum_probs=24.7

Q ss_pred             EEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhcc-CCCCCcee
Q psy10732          3 ITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNKL-TERPELFV   54 (58)
Q Consensus         3 i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nll-~er~elFv   54 (58)
                      |...-.|++=.|  ++++.+++-     .-+++.++++||..+- +++..+|+
T Consensus         4 v~fk~iG~aPil--k~~k~kI~~-----~~~f~~vi~fLrk~Lk~~~~~slFl   49 (87)
T PF04110_consen    4 VRFKAIGSAPIL--KQKKFKISA-----SQTFATVIAFLRKKLKLKPSDSLFL   49 (87)
T ss_dssp             EEEEEETT------S--EEEEET-----TSBTHHHHHHHHHHCT----SS-EE
T ss_pred             EEEEecCCCccc--cCcEEEECC-----CCchHHHHHHHHHHhCCccCCeEEE
Confidence            444556776666  566666662     2589999999998885 34556665


No 12 
>cd00196 UBQ Ubiquitin-like proteins. Ubiquitin homologs; Includes ubiquitin and ubiquitin-like proteins. Ubiquitin-mediated proteolysis is part of the regulated turnover of proteins required for controlling cell cycle progression. Other family members are protein modifiers that perform a wide range of functions. Ubiquitination usually results in a covalent bond between the C-terminus of ubiquitin and the epsilon-amino group of a substrate lysine. The three-step mechanism requires an activating enzyme (E1) that forms a thiol ester with the C-terminal carboxy group, a conjugating enzyme (E2) that transiently carries the activated ubiquitin molecule as a thiol ester, and a ligase (E3) that transfers the activated ubiquitin from the E2 to the substrate lysine residue. In poly-ubiquitination, ubiquitin itself is the substrate.
Probab=64.89  E-value=12  Score=17.36  Aligned_cols=25  Identities=28%  Similarity=0.175  Sum_probs=18.4

Q ss_pred             eeeEEEecCCCCCcccHHHHHHHHHHhc
Q psy10732         18 VKNHDLDLPTGEKPWTIKGLIEWLKLNK   45 (58)
Q Consensus        18 ~k~h~v~l~~~~~~~ti~~Li~~i~~nl   45 (58)
                      .+...+.++   ...|++++++++.++.
T Consensus         7 ~~~~~~~~~---~~~tv~~l~~~i~~~~   31 (69)
T cd00196           7 GKTVELLVP---SGTTVADLKEKLAKKL   31 (69)
T ss_pred             CCEEEEEcC---CCCcHHHHHHHHHHHH
Confidence            445556665   2379999999999875


No 13 
>COG2372 CopC Uncharacterized protein, homolog of Cu resistance protein CopC [General function prediction only]
Probab=64.84  E-value=4.6  Score=25.86  Aligned_cols=18  Identities=39%  Similarity=0.545  Sum_probs=15.1

Q ss_pred             eEEEEeccchhhhcCCee
Q psy10732          2 KITVQFGGGAELLFGKVK   19 (58)
Q Consensus         2 ~i~vEF~GGlElLF~~~k   19 (58)
                      +|+++|++|+|..|..-+
T Consensus        48 ~i~L~Fse~ve~~fs~~~   65 (127)
T COG2372          48 AITLEFSEGVEPGFSGAK   65 (127)
T ss_pred             eEEEecCCccCCCcceeE
Confidence            588999999999987543


No 14 
>PF14451 Ub-Mut7C:  Mut7-C ubiquitin
Probab=64.22  E-value=11  Score=22.01  Aligned_cols=39  Identities=23%  Similarity=0.222  Sum_probs=28.0

Q ss_pred             eEEEEeccchhhhcCCee-eEEEecCCCCCcccHHHHHHHH
Q psy10732          2 KITVQFGGGAELLFGKVK-NHDLDLPTGEKPWTIKGLIEWL   41 (58)
Q Consensus         2 ~i~vEF~GGlElLF~~~k-~h~v~l~~~~~~~ti~~Li~~i   41 (58)
                      .|++.|.|.|--++...+ ...+..+-+ +..|++++|.-+
T Consensus         3 ~i~~rf~~~L~~flp~~~r~~~~~~~~~-~~~tvkd~IEsL   42 (81)
T PF14451_consen    3 TITFRFYAELNDFLPPERRGGPFTHPFD-GGATVKDVIESL   42 (81)
T ss_pred             EEEEEEchHHhhhcChhhcCCceEEecC-CCCcHHHHHHHc
Confidence            588999999988887543 445555533 348999999765


No 15 
>cd04438 DEP_dishevelled DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in dishevelled-like proteins.  Dishevelled-like proteins play a key role in the transduction of the Wnt signal from the cell surface to the nucleus, which in turn is an important regulatory pathway for cellular development and growth. They contain an N-terminal DIX domain, a central PDZ domain, and a C-terminal DEP domain.
Probab=59.70  E-value=9.1  Score=22.36  Aligned_cols=34  Identities=24%  Similarity=0.442  Sum_probs=24.2

Q ss_pred             cCCeeeEEEecCCCCCcccHHHHHHHHHHhc--cCCCCC
Q psy10732         15 FGKVKNHDLDLPTGEKPWTIKGLIEWLKLNK--LTERPE   51 (58)
Q Consensus        15 F~~~k~h~v~l~~~~~~~ti~~Li~~i~~nl--l~er~e   51 (58)
                      ..+++.|.-+.|   ...+=.+|++||.+|.  +.+|.|
T Consensus        16 ikdR~~~~~~~p---~~F~GsdlVdWL~~~~~~~~~R~e   51 (84)
T cd04438          16 IKDRMWLKITIP---NSFIGSDLVDWLLSHVEGLTDRRE   51 (84)
T ss_pred             eEEEEEeeEECC---ccccchHHHHHHHHhCCCCCCHHH
Confidence            345666766677   2256689999999988  467764


No 16 
>PF05372 Delta_lysin:  Delta lysin family;  InterPro: IPR008034 Delta-lysin is a 26 amino acid, hemolytic peptide toxin secreted by Staphylococcus aureus. It is thought that delta-toxin forms an amphipathic helix upon binding to lipid bilayers []. The precise mode of action of delta-lysis is unclear.; GO: 0019836 hemolysis by symbiont of host erythrocytes, 0005576 extracellular region; PDB: 2KAM_A 2DTB_A 1DTC_A.
Probab=56.92  E-value=9.2  Score=18.14  Aligned_cols=14  Identities=14%  Similarity=0.109  Sum_probs=12.0

Q ss_pred             ccHHHHHHHHHHhc
Q psy10732         32 WTIKGLIEWLKLNK   45 (58)
Q Consensus        32 ~ti~~Li~~i~~nl   45 (58)
                      .|+++++.||.+.+
T Consensus         7 sTIgdfvKlI~~TV   20 (25)
T PF05372_consen    7 STIGDFVKLIIETV   20 (25)
T ss_dssp             HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHH
Confidence            48999999998865


No 17 
>KOG1654|consensus
Probab=56.35  E-value=25  Score=22.31  Aligned_cols=41  Identities=17%  Similarity=0.175  Sum_probs=29.8

Q ss_pred             CeEEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhcc
Q psy10732          1 MKITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNKL   46 (58)
Q Consensus         1 ~~i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nll   46 (58)
                      +.|.||..|.-++=--++++.  =+|+   .+||++++.-||..+-
T Consensus        29 iPVIvEk~~~~~lp~lDK~Ky--LVP~---dltvgqfi~iIRkRiq   69 (116)
T KOG1654|consen   29 IPVIVEKAGKSQLPDLDKKKY--LVPD---DLTVGQFIKIIRKRIQ   69 (116)
T ss_pred             CcEEEEecccccCccccccee--eccc---cccHHHHHHHHHHHhc
Confidence            457889888888755555553  3452   3999999999998874


No 18 
>PHA02141 hypothetical protein
Probab=56.33  E-value=7.3  Score=23.94  Aligned_cols=15  Identities=33%  Similarity=0.594  Sum_probs=12.4

Q ss_pred             ccHHHHHHHHHHhcc
Q psy10732         32 WTIKGLIEWLKLNKL   46 (58)
Q Consensus        32 ~ti~~Li~~i~~nll   46 (58)
                      .++..+|+|++.|.+
T Consensus         3 ~slss~~swl~~n~l   17 (105)
T PHA02141          3 PSLSSTISWLRNNVL   17 (105)
T ss_pred             ccHHHHHHHHHhchH
Confidence            368899999999864


No 19 
>PF02597 ThiS:  ThiS family;  InterPro: IPR003749 ThiS (thiaminS) is a 66 aa protein involved in sulphur transfer. ThiS is coded in the thiCEFSGH operon in Escherichia coli. This family of proteins have two conserved Glycines at the COOH terminus. Thiocarboxylate is formed at the last G in the activation process. Sulphur is transferred from ThiI to ThiS in a reaction catalysed by IscS []. MoaD, a protein involved in sulphur transfer during molybdopterin synthesis, is about the same length and shows limited sequence similarity to ThiS. Both have the conserved GG at the COOH end.; PDB: 1JW9_D 1JWB_D 1JWA_D 3BII_D 1NVI_D 1FMA_D 1FM0_D 2QIE_G 2Q5W_D 2K5P_A ....
Probab=56.12  E-value=25  Score=18.79  Aligned_cols=34  Identities=24%  Similarity=0.413  Sum_probs=21.7

Q ss_pred             EeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhc
Q psy10732          6 QFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNK   45 (58)
Q Consensus         6 EF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nl   45 (58)
                      .|-|-+--+.+   ...+.++   +..|+++|++.+..+.
T Consensus         2 ~~fg~~~~~~g---~~~~~~~---~~~tv~~ll~~l~~~~   35 (77)
T PF02597_consen    2 KFFGELREIAG---EEEIEVP---EGSTVRDLLEALAERY   35 (77)
T ss_dssp             EETTHHHHHHT---EEEEEES---STSBHHHHHHHHCHHT
T ss_pred             EEChhHHHHhC---CeEEecC---CCCcHHHHHHHHHhhc
Confidence            34444444455   3344455   3489999999998776


No 20 
>PRK09184 acyl carrier protein; Provisional
Probab=55.97  E-value=3.4  Score=24.33  Aligned_cols=36  Identities=11%  Similarity=0.179  Sum_probs=24.3

Q ss_pred             hhhhcCCeeeEEEecCCCCC-----cccHHHHHHHHHHhcc
Q psy10732         11 AELLFGKVKNHDLDLPTGEK-----PWTIKGLIEWLKLNKL   46 (58)
Q Consensus        11 lElLF~~~k~h~v~l~~~~~-----~~ti~~Li~~i~~nll   46 (58)
                      +|+...-++..-+.+|++..     =.|+++|..||.++.-
T Consensus        48 velv~~lE~~fgi~i~~~~~~~~~~~~TV~~l~~~I~~~~~   88 (89)
T PRK09184         48 LEIALVISKRYGFQLRSDNPDNQRIFASLRALAAYVAAHRT   88 (89)
T ss_pred             HHHHHHHHHHHCCcCCCcchhhhhccCCHHHHHHHHHHhhc
Confidence            45555556666677873221     2599999999998753


No 21 
>PF00733 Asn_synthase:  Asparagine synthase;  InterPro: IPR001962 This domain is always found associated with (IPR000583 from INTERPRO). Family members that contain this domain catalyse the conversion of aspartate to asparagine. Asparagine synthetase B (6.3.5.4 from EC) catalyzes the assembly of asparagine from aspartate, Mg(2+)ATP, and glutamine. The three-dimensional architecture of the N-terminal domain of asparagine synthetase B is similar to that observed for glutamine phosphoribosylpyrophosphate amidotransferase while the molecular motif of the C-domain is reminiscent to that observed for GMP synthetase [].; GO: 0004066 asparagine synthase (glutamine-hydrolyzing) activity, 0006529 asparagine biosynthetic process; PDB: 1JGT_A 1M1Z_B 1MB9_B 1MBZ_B 1MC1_A 1Q15_D 1Q19_C 1CT9_C 3K32_F.
Probab=53.93  E-value=8.5  Score=24.42  Aligned_cols=12  Identities=25%  Similarity=0.523  Sum_probs=8.2

Q ss_pred             eEEEEeccchhh
Q psy10732          2 KITVQFGGGAEL   13 (58)
Q Consensus         2 ~i~vEF~GGlEl   13 (58)
                      +|-+.+|||+|.
T Consensus        19 ~i~~~LSGGlDS   30 (255)
T PF00733_consen   19 PIGILLSGGLDS   30 (255)
T ss_dssp             EEEEE--SSHHH
T ss_pred             CEEEECCCChhH
Confidence            467899999996


No 22 
>PF07912 ERp29_N:  ERp29, N-terminal domain;  InterPro: IPR012883 ERp29 (P52555 from SWISSPROT) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [, ]. The protein exists as a homodimer, with each monomer being composed of two domains. The N-terminal domain featured in this family is organised into a thioredoxin-like fold that resembles the a domain of human protein disulphide isomerase (PDI) []. However, this domain lacks the C-X-X-C motif required for the redox function of PDI; it is therefore thought that the function of ERp29 is similar to the chaperone function of PDI []. The N-terminal domain is exclusively responsible for the homodimerisation of the protein, without covalent linkages or additional contacts with other domains []. ; GO: 0009306 protein secretion, 0005788 endoplasmic reticulum lumen; PDB: 2QC7_B 1G7E_A 2C0G_B 1OVN_A 2C0F_A 2C0E_A 2C1Y_B.
Probab=51.13  E-value=9.7  Score=24.40  Aligned_cols=24  Identities=21%  Similarity=0.254  Sum_probs=16.0

Q ss_pred             eEEEecCCCCCcccHHHHHHHHHHh
Q psy10732         20 NHDLDLPTGEKPWTIKGLIEWLKLN   44 (58)
Q Consensus        20 ~h~v~l~~~~~~~ti~~Li~~i~~n   44 (58)
                      ..-|..| ..+++|+..|-.|++.|
T Consensus        95 ~~pv~~p-~~~~~t~~~l~~fvk~~  118 (126)
T PF07912_consen   95 EEPVRYP-FDGDVTADNLQRFVKSN  118 (126)
T ss_dssp             TSEEEE--TCS-S-HHHHHHHHHHT
T ss_pred             CCCccCC-ccCCccHHHHHHHHHhC
Confidence            3445566 34579999999999987


No 23 
>COG4134 ABC-type uncharacterized transport system, periplasmic component [General function prediction only]
Probab=48.74  E-value=27  Score=26.15  Aligned_cols=38  Identities=24%  Similarity=0.309  Sum_probs=25.7

Q ss_pred             ccchhhhcC-CeeeEEEecC-CCCCcccHHHHHHHHHHhc
Q psy10732          8 GGGAELLFG-KVKNHDLDLP-TGEKPWTIKGLIEWLKLNK   45 (58)
Q Consensus         8 ~GGlElLF~-~~k~h~v~l~-~~~~~~ti~~Li~~i~~nl   45 (58)
                      .+|+|..++ +|-.....-. ...-|-|+.+|+.|.+.|=
T Consensus       140 t~Gl~~~~~~~q~~f~yd~~k~~~~P~s~eeLL~wA~aNP  179 (384)
T COG4134         140 TEGLESPWGGNQLVFIYDRDKVPQVPQSFEELLVWAKANP  179 (384)
T ss_pred             CCcccccccCCcceEEEccccCCCCCcCHHHHHHHHHhCc
Confidence            478888887 5655444411 2223689999999999874


No 24 
>smart00666 PB1 PB1 domain. Phox and Bem1p domain, present in many eukaryotic cytoplasmic signalling proteins. The domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate.
Probab=46.89  E-value=48  Score=18.03  Aligned_cols=33  Identities=15%  Similarity=0.330  Sum_probs=24.5

Q ss_pred             eEEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhcc
Q psy10732          2 KITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNKL   46 (58)
Q Consensus         2 ~i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nll   46 (58)
                      .|++.| ||        ..+.+.+|.   ++|..+|.+-|++.+-
T Consensus         3 ~vK~~~-~~--------~~~~~~~~~---~~s~~dL~~~i~~~~~   35 (81)
T smart00666        3 DVKLRY-GG--------ETRRLSVPR---DISFEDLRSKVAKRFG   35 (81)
T ss_pred             cEEEEE-CC--------EEEEEEECC---CCCHHHHHHHHHHHhC
Confidence            567777 33        467788883   4899999999988764


No 25 
>PF09379 FERM_N:  FERM N-terminal domain ;  InterPro: IPR018979  This domain is the N-terminal ubiquitin-like structural domain of the FERM domain.  The FERM domain (F for 4.1 protein, E for ezrin, R for radixin and M for moesin) is a widespread protein module involved in localising proteins to the plasma membrane []. FERM domains are found in a number of cytoskeletal-associated proteins that associate with various proteins at the interface between the plasma membrane and the cytoskeleton. The FERM domain is located at the N terminus of the majority of FERM-containing proteins [, ], which includes:    Band 4.1, which links the spectrin-actin cytoskeleton of erythrocytes to the plasma membrane. Ezrin, a component of the undercoat of the microvilli plasma membrane. Moesin, which is probably involved in binding major cytoskeletal structures to the plasma membrane. Radixin, which is involved in the binding of the barbed end of actin filaments to the plasma membrane in the undercoat of the cell- to-cell adherens junction. Talin, a cytoskeletal protein concentrated in regions of cell-substratum contact and, in lymphocytes, of cell-cell contacts. Filopodin, a slime mold protein that binds actin and which is involved in the control of cell motility and chemotaxis. Merlin (or schwannomin). Protein NBL4. Unconventional myosins X, VIIa and XV, which are mutated in congenital deafness. Focal-adhesion kinases (FAKs), cytoplasmic protein tyrosine kinases involved in signalling through integrins. Janus tyrosine kinases (JAKs), cytoplasmic tyrosine kinases that are non-covalently associated with the cytoplasmic tails of receptors for cytokines or polypeptidic hormones. Non-receptor tyrosine-protein kinase TYK2. Protein-tyrosine phosphatases PTPN3 and PTPN4, enzyme that appear to act at junctions between the membrane and the cytoskeleton. Protein-tyrosine phosphatases PTPN14 and PTP-D1, PTP-RL10 and PTP2E.  Caenorhabditis elegans protein phosphatase ptp-1.   Ezrin, moesin, and radixin are highly related proteins (ERM protein family), but the other proteins in which the FERM domain is found do not share any region of similarity outside of this domain. ERM proteins are made of three domains, the FERM domain, a central helical domain and a C-terminal tail domain, which binds F-actin. The amino-acid sequence of the FERM domain is highly conserved among ERM proteins and is responsible for membrane association by direct binding to the cytoplasmic domain or tail of integral membrane proteins. ERM proteins are regulated by an intramolecular association of the FERM and C-terminal tail domains that masks their binding sites for other molecules. For cytoskeleton-membrane cross-linking, the dormant molecules becomes activated and the FERM domain attaches to the membrane by binding specific membrane proteins, while the last 34 residues of the tail bind actin filaments. Aside from binding to membranes, the activated FERM domain of ERM proteins can also bind the guanine nucleotide dissociation inhibitor of Rho GTPase (RhoDGI), which suggests that in addition to functioning as a cross-linker, ERM proteins may influence Rho signalling pathways. The crystal structure of the FERM domain reveals that it is composed of three structural modules (F1, F2, and F3) that together form a compact clover-shaped structure []. The FERM domain has also been called the amino-terminal domain, the 30kDa domain, 4.1N30, the membrane-cytoskeletal-linking domain, the ERM-like domain, the ezrin-like domain of the band 4.1 superfamily, the conserved N-terminal region, and the membrane attachment domain [].; PDB: 1EF1_B 1SGH_A 1E5W_A 2KC2_A 2KMA_A 3IVF_A 1H4R_B 3U8Z_A 1ISN_A 3BIN_A ....
Probab=46.48  E-value=47  Score=17.89  Aligned_cols=32  Identities=16%  Similarity=0.098  Sum_probs=21.7

Q ss_pred             eeEEEecCCCCCcccHHHHHHHHHHhccCCCCCce
Q psy10732         19 KNHDLDLPTGEKPWTIKGLIEWLKLNKLTERPELF   53 (58)
Q Consensus        19 k~h~v~l~~~~~~~ti~~Li~~i~~nll~er~elF   53 (58)
                      ...+++++   ..+|.++|+..+++.+=-.-++.|
T Consensus         7 ~~~~~~v~---~~~t~~~l~~~v~~~l~l~e~~~F   38 (80)
T PF09379_consen    7 TTKTFEVD---PKTTGQDLLEQVCDKLGLKEKEYF   38 (80)
T ss_dssp             EEEEEEEE---TTSBHHHHHHHHHHHHTTSSGGGE
T ss_pred             CcEEEEEc---CCCcHHHHHHHHHHHcCCCCccEE
Confidence            34556666   347899999999998853334433


No 26 
>PF04424 DUF544:  Protein of unknown function (DUF544)     ;  InterPro: IPR007518 This is a eukaryotic protein of unknown function.
Probab=46.24  E-value=15  Score=22.54  Aligned_cols=28  Identities=21%  Similarity=0.405  Sum_probs=22.2

Q ss_pred             EecCCCCCcccHHHHHHHHHHhccCCCC
Q psy10732         23 LDLPTGEKPWTIKGLIEWLKLNKLTERP   50 (58)
Q Consensus        23 v~l~~~~~~~ti~~Li~~i~~nll~er~   50 (58)
                      ++||++.+.++..+|++.+.+-++..++
T Consensus        10 i~L~~~~~~Vs~~~Ll~~l~~~ll~~~~   37 (121)
T PF04424_consen   10 ITLPPDREEVSLDDLLQLLADYLLESNP   37 (121)
T ss_pred             CcCCCCCCEECHHHHHHHHHHHHHhcCc
Confidence            3477566679999999999999987544


No 27 
>cd01612 APG12_C Ubiquitin-like domain of APG12. APG12_C    The carboxy-terminal ubiquitin-like domain of APG12. Autophagy is a process in which cytoplasmic components are delivered to the lysosome/vacuole for degradation. Autophagy requires a ubiquitin-like protein conjugation system, in which APG12 is covalently bound to APG5.
Probab=45.45  E-value=56  Score=19.11  Aligned_cols=30  Identities=13%  Similarity=0.371  Sum_probs=20.5

Q ss_pred             EEecCCCCCcccHHHHHHHHHHhccCCCCC-cee
Q psy10732         22 DLDLPTGEKPWTIKGLIEWLKLNKLTERPE-LFV   54 (58)
Q Consensus        22 ~v~l~~~~~~~ti~~Li~~i~~nll~er~e-lFv   54 (58)
                      +.-+|.   ..|++.++.+||..+--...+ +|+
T Consensus        19 kflv~~---~~tv~~~~~~lrk~L~l~~~~slfl   49 (87)
T cd01612          19 VFKISA---TQSFQAVIDFLRKRLKLKASDSLFL   49 (87)
T ss_pred             EEEeCC---CCCHHHHHHHHHHHhCCCccCeEEE
Confidence            344663   379999999999988644333 554


No 28 
>cd01611 GABARAP Ubiquitin domain of GABA-receptor-associated protein. GABARAP  (GABA-receptor-associated protein) belongs ot a large family of proteins that mediate intracellular membrane trafficking and/or fusion.  GABARAP binds not only to GABA, type A but also to tubulin, gephrin, and ULK1.  Orthologues of GABARAP include Gate-16 (golgi-associated ATPase enhancer), LC3 (microtubule-associated protein light chain 3), and ATG8 (autophagy protein 8).  ATG8 is a ubiquitin-like protein that is conjugated to the membrane phospholipid, phosphatidylethanolamine as part of a ubiquitin-like conjugation system essential for autophagosome-formation.
Probab=45.41  E-value=70  Score=19.56  Aligned_cols=48  Identities=15%  Similarity=0.101  Sum_probs=29.3

Q ss_pred             eEEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhccCCCCC-cee
Q psy10732          2 KITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNKLTERPE-LFV   54 (58)
Q Consensus         2 ~i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nll~er~e-lFv   54 (58)
                      .|.||=...-++=.-++++.  -+|   +..|+++++..||..+--...+ +|+
T Consensus        26 PVIvE~~~~~~~p~l~k~Kf--lVp---~~~tv~~f~~~irk~l~l~~~~slfl   74 (112)
T cd01611          26 PVIVERYPKSDLPDLDKKKY--LVP---SDLTVGQFVYIIRKRIQLRPEKALFL   74 (112)
T ss_pred             EEEEEEcCCCCcccccCceE--Eec---CCCCHHHHHHHHHHHhCCCccceEEE
Confidence            46666555545433334443  366   3389999999999987433333 554


No 29 
>cd01812 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N  N-terminal ubiquitin-like (Ubl) domain of the BAG1 protein.  This domain occurs together with the BAG domain and is closely related to the Ubl domain of a family of deubiquitinases that includes Rpn11, UBP6 (USP14), USP7 (HAUSP).
Probab=45.07  E-value=47  Score=17.43  Aligned_cols=32  Identities=28%  Similarity=0.501  Sum_probs=22.0

Q ss_pred             CeEEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHh
Q psy10732          1 MKITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLN   44 (58)
Q Consensus         1 ~~i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~n   44 (58)
                      |+|+|.++ |        +.+.+++++   ..|+++|-+.|.+.
T Consensus         1 i~i~vk~~-g--------~~~~i~v~~---~~tv~~lK~~i~~~   32 (71)
T cd01812           1 IRVRVKHG-G--------ESHDLSISS---QATFGDLKKMLAPV   32 (71)
T ss_pred             CEEEEEEC-C--------EEEEEEECC---CCcHHHHHHHHHHh
Confidence            45666664 3        567888873   36899998888653


No 30 
>PRK14561 hypothetical protein; Provisional
Probab=44.80  E-value=14  Score=24.04  Aligned_cols=15  Identities=40%  Similarity=0.625  Sum_probs=12.7

Q ss_pred             CeEEEEeccchhhhc
Q psy10732          1 MKITVQFGGGAELLF   15 (58)
Q Consensus         1 ~~i~vEF~GGlElLF   15 (58)
                      |+|-|=||||.|..+
T Consensus         1 mkV~ValSGG~DSsl   15 (194)
T PRK14561          1 MKAGVLFSGGKDSSL   15 (194)
T ss_pred             CEEEEEEechHHHHH
Confidence            788999999999743


No 31 
>PTZ00380 microtubule-associated protein (MAP); Provisional
Probab=44.20  E-value=81  Score=19.90  Aligned_cols=46  Identities=22%  Similarity=0.171  Sum_probs=29.4

Q ss_pred             CeEEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhccCCCCCcee
Q psy10732          1 MKITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNKLTERPELFV   54 (58)
Q Consensus         1 ~~i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nll~er~elFv   54 (58)
                      +.|.||=.....   +  |++-+-+|.   ..||++++..||.++--....+|+
T Consensus        28 IPVIvEk~~~s~---d--K~KfllVP~---d~tV~qF~~iIRkrl~l~~~k~fl   73 (121)
T PTZ00380         28 VAVVVEAAEKAG---S--KVHFLALPR---DATVAELEAAVRQALGTSAKKVTL   73 (121)
T ss_pred             cEEEEeecCCCC---C--ceEEEEcCC---CCcHHHHHHHHHHHcCCChhHEEE
Confidence            356677766655   2  333345773   389999999999987544333444


No 32 
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as a noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants.
Probab=43.89  E-value=53  Score=17.68  Aligned_cols=35  Identities=11%  Similarity=0.204  Sum_probs=25.0

Q ss_pred             eEEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhccC
Q psy10732          2 KITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNKLT   47 (58)
Q Consensus         2 ~i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nll~   47 (58)
                      .|++.|.|+         .+.+.+|+  ..++..+|.+-|++.+-.
T Consensus         2 ~vK~~~~~~---------~~~~~~~~--~~~s~~~L~~~i~~~~~~   36 (81)
T cd05992           2 RVKVKYGGE---------IRRFVVVS--RSISFEDLRSKIAEKFGL   36 (81)
T ss_pred             cEEEEecCC---------CEEEEEec--CCCCHHHHHHHHHHHhCC
Confidence            567777754         45566664  348999999999987754


No 33 
>PRK14752 delta-hemolysin; Provisional
Probab=42.19  E-value=20  Score=18.91  Aligned_cols=15  Identities=27%  Similarity=0.383  Sum_probs=12.6

Q ss_pred             ccHHHHHHHHHHhcc
Q psy10732         32 WTIKGLIEWLKLNKL   46 (58)
Q Consensus        32 ~ti~~Li~~i~~nll   46 (58)
                      .|+++++.||.+.+-
T Consensus        25 ~tig~~vk~ii~tv~   39 (44)
T PRK14752         25 STIGDLVKWIIDTVN   39 (44)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            589999999988764


No 34 
>PF07549 Sec_GG:  SecD/SecF GG Motif;  InterPro: IPR022646  Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway. Proteins are produced in the cytoplasm as precursors, and require a chaperone subunit to direct them to the translocase component []. From there, the mature proteins are either targeted to the outer membrane, or remain as periplasmic proteins. The translocase protein subunits are encoded on the bacterial chromosome.   The translocase itself comprises 7 proteins, including a chaperone protein (SecB), an ATPase (SecA), an integral membrane complex (SecCY, SecE and SecG), and two additional membrane proteins that promote the release of the mature peptide into the periplasm (SecD and SecF) []. The chaperone protein SecB [] is a highly acidic homotetrameric protein that exists as a "dimer of dimers" in the bacterial cytoplasm. SecB maintains preproteins in an unfolded state after translation, and targets these to the peripheral membrane protein ATPase SecA for secretion []. Together with SecY and SecG, SecE forms a multimeric channel through which preproteins are translocated, using both proton motive forces and ATP-driven secretion. The latter is mediated by SecA. The structure of the Escherichia coli SecYEG assembly revealed a sandwich of two membranes interacting through the extensive cytoplasmic domains []. Each membrane is composed of dimers of SecYEG. The monomeric complex contains 15 transmembrane helices.  The SecD and SecF equivalents of the Gram-positive bacterium Bacillus subtilis are jointly present in one polypeptide, denoted SecDF, that is required to maintain a high capacity for protein secretion. Unlike the SecD subunit of the pre-protein translocase of E. coli, SecDF of B. subtilis was not required for the release of a mature secretory protein from the membrane, indicating that SecDF is involved in earlier translocation steps []. Comparison with SecD and SecF proteins from other organisms revealed the presence of 10 conserved regions in SecDF, some of which appear to be important for SecDF function. Interestingly, the SecDF protein of B. subtilis has 12 putative transmembrane domains. Thus, SecDF does not only show sequence similarity but also structural similarity to secondary solute transporters []. This entry represents a GG-containing domain found in the N-terminal region of prokaryotic SecD and SecF protein export membrane proteins. It is found in association with PF02355 from PFAM. SecD and SecF proteins are part of the multimeric protein export complex comprising SecA, D, E, F, G, Y, and YajC []. SecD and SecF are required to maintain a proton motive force []. ; PDB: 3AQP_A 2RRN_A 3AQO_B.
Probab=41.87  E-value=6.4  Score=18.84  Aligned_cols=13  Identities=23%  Similarity=0.682  Sum_probs=7.8

Q ss_pred             eEEEEeccchhhh
Q psy10732          2 KITVQFGGGAELL   14 (58)
Q Consensus         2 ~i~vEF~GGlElL   14 (58)
                      +.=++|.||.++.
T Consensus        10 n~GlDf~GG~~i~   22 (31)
T PF07549_consen   10 NLGLDFTGGTSIT   22 (31)
T ss_dssp             -EECCCC-EEEEE
T ss_pred             cccEEcCCCeEEE
Confidence            4457899997654


No 35 
>COG0830 UreF Urease accessory protein UreF [Posttranslational modification, protein turnover, chaperones]
Probab=41.47  E-value=19  Score=24.85  Aligned_cols=29  Identities=21%  Similarity=0.190  Sum_probs=21.1

Q ss_pred             EeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhc
Q psy10732          6 QFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNK   45 (58)
Q Consensus         6 EF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nl   45 (58)
                      -+|+|||..-.+..+|           +...|..|++..+
T Consensus        24 s~S~GLEtai~~g~V~-----------d~~tl~~wl~~~L   52 (229)
T COG0830          24 SYSFGLETAIQAGIVT-----------DAATLEAWLKTQL   52 (229)
T ss_pred             cccccHHHHHHcCccC-----------CHHHHHHHHHHHH
Confidence            4799999998877663           4566777776554


No 36 
>PRK13291 metal-dependent hydrolase; Provisional
Probab=40.83  E-value=12  Score=23.93  Aligned_cols=23  Identities=22%  Similarity=0.533  Sum_probs=16.7

Q ss_pred             ecCCCCCcccHHHHHHHHHHhcc
Q psy10732         24 DLPTGEKPWTIKGLIEWLKLNKL   46 (58)
Q Consensus        24 ~l~~~~~~~ti~~Li~~i~~nll   46 (58)
                      +.+...+.||+++++.+|+|.-+
T Consensus        49 ~~~~~~gkWSi~Evl~HL~D~e~   71 (173)
T PRK13291         49 DTPYREGGWTVRQVVHHVADSHM   71 (173)
T ss_pred             cCCCCCCCCcHHHHHHHHHHHHH
Confidence            33334567999999999997543


No 37 
>PRK00468 hypothetical protein; Provisional
Probab=40.52  E-value=26  Score=20.10  Aligned_cols=21  Identities=19%  Similarity=0.219  Sum_probs=16.9

Q ss_pred             HHHHHHHHHHhccCCCCCcee
Q psy10732         34 IKGLIEWLKLNKLTERPELFV   54 (58)
Q Consensus        34 i~~Li~~i~~nll~er~elFv   54 (58)
                      |.+|+.||...+..++.++=+
T Consensus         1 m~~Lv~~iv~~LVd~Pe~v~V   21 (75)
T PRK00468          1 MKELVETIAKALVDNPDAVQV   21 (75)
T ss_pred             CHHHHHHHHHHhcCCCCeEEE
Confidence            578999999999887766554


No 38 
>PRK07117 acyl carrier protein; Validated
Probab=38.42  E-value=4.9  Score=23.12  Aligned_cols=27  Identities=19%  Similarity=0.150  Sum_probs=18.4

Q ss_pred             eeEEEecCC--CCCcccHHHHHHHHHHhc
Q psy10732         19 KNHDLDLPT--GEKPWTIKGLIEWLKLNK   45 (58)
Q Consensus        19 k~h~v~l~~--~~~~~ti~~Li~~i~~nl   45 (58)
                      ....+.+|.  -.+--|+++++.|+..++
T Consensus        51 d~f~i~I~~~~~~~i~Tv~d~v~~i~~~~   79 (79)
T PRK07117         51 ESLSLKIPLVEFAGAKNIGELADLLYAKL   79 (79)
T ss_pred             HHHCCccCHHHHHhcCCHHHHHHHHHHhC
Confidence            344467772  223579999999998753


No 39 
>PF11976 Rad60-SLD:  Ubiquitin-2 like Rad60 SUMO-like;  InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins. SUMOs are small proteins that are covalently attached to lysines as post-translational modifications and are used to control multiple cellular process including signal transduction, nuclear transport and DNA replication and repair []. Unlike ubiquitin, they are not involved in protein degradation.  This entry also contains the C-terminal Rad60 DNA repair protein SUMO-like domain.; PDB: 3RD2_A 2JXX_A 3RCZ_A 3GOE_A 3A4S_D 3A4R_B 2IO1_D 1U4A_A 2K1F_A 1WZ0_A ....
Probab=38.07  E-value=65  Score=17.05  Aligned_cols=38  Identities=24%  Similarity=0.195  Sum_probs=24.8

Q ss_pred             CeEEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhccCCC
Q psy10732          1 MKITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNKLTER   49 (58)
Q Consensus         1 ~~i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nll~er   49 (58)
                      |+|+|...+|        +.+.+.+..   ..+++.|++..++..=-..
T Consensus         1 I~i~v~~~~~--------~~~~~~v~~---~~~~~~l~~~~~~~~~i~~   38 (72)
T PF11976_consen    1 ITIKVRSQDG--------KEIKFKVKP---TTTVSKLIEKYCEKKGIPP   38 (72)
T ss_dssp             EEEEEEETTS--------EEEEEEEET---TSCCHHHHHHHHHHHTTTT
T ss_pred             CEEEEEeCCC--------CEEEEEECC---CCcHHHHHHHHHHhhCCCc
Confidence            3455555555        466677663   3689999999988654333


No 40 
>cd01805 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belongs to a family of adaptor molecules having affinity for both the proteasome and ubiquitinylated proteins and thought to shuttle these ubiquitinylated proteins to the proteasome for destruction. RAD23 interacts with ubiquitin through its C-terminal ubiquitin-associated domains (UBA) and with the proteasome through its N-terminal ubiquitin-like domain (UBL).
Probab=36.37  E-value=72  Score=17.06  Aligned_cols=34  Identities=24%  Similarity=0.212  Sum_probs=23.8

Q ss_pred             CeEEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhc
Q psy10732          1 MKITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNK   45 (58)
Q Consensus         1 ~~i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nl   45 (58)
                      |.|.|...+|        +.+.+++++.   .|+++|-+.|.+..
T Consensus         1 m~i~vk~~~g--------~~~~l~v~~~---~TV~~lK~~i~~~~   34 (77)
T cd01805           1 MKITFKTLKQ--------QTFPIEVDPD---DTVAELKEKIEEEK   34 (77)
T ss_pred             CEEEEEeCCC--------CEEEEEECCC---CcHHHHHHHHHHhh
Confidence            5667766655        4577777742   68999998887643


No 41 
>PF02084 Bindin:  Bindin;  InterPro: IPR000775 Bindin, the major protein component of the acrosome granule of sea urchin sperm, mediates species-specific adhesion of sperm to the egg surface during fertilisation [, ]. The protein coats the acrosomal process after externalisation by the acrosome reaction; it binds to sulphated, fucose-containing polysaccharides on the vitelline-layer receptor proteoglycans that cover the egg plasma membrane. Bindins from different genera show high levels of sequence similarity in both the mature bindin domain and in the probindin precursor region. The most highly conserved region is a 42-residue segment in the central portion of the mature bindin protein. This domain may be responsible for conserved functions of bindin, while the more highly divergent flanking regions may be responsible for its species-specific properties [].; GO: 0007342 fusion of sperm to egg plasma membrane
Probab=36.30  E-value=30  Score=24.37  Aligned_cols=27  Identities=30%  Similarity=0.528  Sum_probs=20.6

Q ss_pred             EEEecC-CCCCcccHHHHHHHHHH--hccC
Q psy10732         21 HDLDLP-TGEKPWTIKGLIEWLKL--NKLT   47 (58)
Q Consensus        21 h~v~l~-~~~~~~ti~~Li~~i~~--nll~   47 (58)
                      .+|+|| +-.+|-+++-|+.+||-  |||.
T Consensus       116 TKiDLPVDINDPYDlGLLLRhLRHHSNLLA  145 (238)
T PF02084_consen  116 TKIDLPVDINDPYDLGLLLRHLRHHSNLLA  145 (238)
T ss_pred             cccccccccCChhhHHHHHHHHHHHHHHHh
Confidence            357777 55678999999999984  5654


No 42 
>PRK02821 hypothetical protein; Provisional
Probab=35.49  E-value=47  Score=19.23  Aligned_cols=21  Identities=14%  Similarity=0.183  Sum_probs=17.3

Q ss_pred             HHHHHHHHHHhccCCCCCcee
Q psy10732         34 IKGLIEWLKLNKLTERPELFV   54 (58)
Q Consensus        34 i~~Li~~i~~nll~er~elFv   54 (58)
                      +++|+.||...+..++.++=|
T Consensus         2 ~~~lv~~ivk~LVd~Pe~V~V   22 (77)
T PRK02821          2 LADAVEHLVRGIVDNPDDVRV   22 (77)
T ss_pred             HHHHHHHHHHHhCCCCCeEEE
Confidence            689999999999877666655


No 43 
>PF09364 XFP_N:  XFP N-terminal domain;  InterPro: IPR018970  Phosphoketolases (PK) are key enzymes of the pentose phosphate pathway of heterofermentative and facultative homofermentative lactic acid bacteria and of the D-fructose 6-phosphate shunt of bifidobacteria. PK activity has been sporadically reported in other microorganisms including eukaryotic yeasts. Xylulose-5-phosphate/fructose-6-phosphate phosphoketolase is a thiamine diphosphate (ThdP)-dependent enzyme found in bacteria such as Bifidobacterium sp [, ]. This enzyme has dual-specificity with the following catalytic activities:    4.1.2.9 from EC: xylose 5-P + Pi = acetyl-P + glyeraldehyde-3-P  4.1.2.22 from EC: fructose-6-P + Pi = acetyl-P + erythrose-4-P   Phosphoketolases are distantly related to transketolases, e.g. IPR005475 from INTERPRO.; PDB: 3AI7_B 3AHC_A 3AHJ_A 3AHG_A 3AHE_A 3AHI_A 3AHD_A 3AHF_A 3AHH_A.
Probab=35.48  E-value=12  Score=27.84  Aligned_cols=37  Identities=35%  Similarity=0.705  Sum_probs=24.5

Q ss_pred             CCeeeEEEecCC-CCCcccHHHHHHHHHHhccCCCC-CceecC
Q psy10732         16 GKVKNHDLDLPT-GEKPWTIKGLIEWLKLNKLTERP-ELFVQG   56 (58)
Q Consensus        16 ~~~k~h~v~l~~-~~~~~ti~~Li~~i~~nll~er~-elFv~~   56 (58)
                      +.-|.|+|.||. ..++-.+..|-+||+.    -|| |||=++
T Consensus       297 Gt~raHQVPl~~~~~~~~~l~~Le~Wl~S----Y~PeeLFd~~  335 (379)
T PF09364_consen  297 GTFRAHQVPLPDVRTDPEHLRLLEDWLRS----YRPEELFDED  335 (379)
T ss_dssp             TSGGGSS-SSTTTTTSHHHHHHHHHHHHH----T-GGGTB-TT
T ss_pred             CcceeeeccccccCCCHHHHHHHHHHHHh----CCHHHhcCCC
Confidence            445789999994 3456788999999984    455 687543


No 44 
>KOG0626|consensus
Probab=35.29  E-value=35  Score=26.47  Aligned_cols=22  Identities=23%  Similarity=0.836  Sum_probs=18.0

Q ss_pred             cccHHHHHHHHHHhccCCCCCcee
Q psy10732         31 PWTIKGLIEWLKLNKLTERPELFV   54 (58)
Q Consensus        31 ~~ti~~Li~~i~~nll~er~elFv   54 (58)
                      ||.++.++.||++++  ..|.+||
T Consensus       391 P~Glr~~L~yiK~~Y--~np~iyI  412 (524)
T KOG0626|consen  391 PWGLRKLLNYIKDKY--GNPPIYI  412 (524)
T ss_pred             cHHHHHHHHHHHhhc--CCCcEEE
Confidence            789999999999977  3466776


No 45 
>PRK12449 acyl carrier protein; Provisional
Probab=35.23  E-value=34  Score=18.74  Aligned_cols=26  Identities=15%  Similarity=0.359  Sum_probs=17.2

Q ss_pred             eEEEecCCC--CCcccHHHHHHHHHHhc
Q psy10732         20 NHDLDLPTG--EKPWTIKGLIEWLKLNK   45 (58)
Q Consensus        20 ~h~v~l~~~--~~~~ti~~Li~~i~~nl   45 (58)
                      .+.+.+|+.  .+-.|+++|++|+.+++
T Consensus        52 ~f~i~i~~~~~~~~~ti~~l~~~l~~~~   79 (80)
T PRK12449         52 EFHIAIPDEDVEDMVSMGDLLDYLVQRL   79 (80)
T ss_pred             HhCCCCCHHHHHhCCCHHHHHHHHHHhc
Confidence            344566621  12468999999998764


No 46 
>PRK10738 hypothetical protein; Provisional
Probab=35.06  E-value=50  Score=20.46  Aligned_cols=39  Identities=15%  Similarity=0.258  Sum_probs=26.0

Q ss_pred             CeEEEEeccchhhhcCCeeeEEEecCC---CCCcccHHHHHH
Q psy10732          1 MKITVQFGGGAELLFGKVKNHDLDLPT---GEKPWTIKGLIE   39 (58)
Q Consensus         1 ~~i~vEF~GGlElLF~~~k~h~v~l~~---~~~~~ti~~Li~   39 (58)
                      |++++...||+-..=.+.+-|++.+..   +.+|..+.-|+.
T Consensus         1 m~~~~~w~~~~~f~~~~~~g~~i~~D~~G~~~g~~P~EllL~   42 (134)
T PRK10738          1 MQARVKWVEGLTFLGESASGHQILMDGNSGDKAPSPMEMVLM   42 (134)
T ss_pred             CEEEEEEeCCcEEEEEcCCCCEEEEcCCCCCCCCCHHHHHHH
Confidence            788999999887555566778888762   223555555443


No 47 
>PRK01064 hypothetical protein; Provisional
Probab=34.57  E-value=37  Score=19.70  Aligned_cols=21  Identities=14%  Similarity=0.377  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHhccCCCCCcee
Q psy10732         34 IKGLIEWLKLNKLTERPELFV   54 (58)
Q Consensus        34 i~~Li~~i~~nll~er~elFv   54 (58)
                      |.+|+.||...+..++.++-|
T Consensus         1 m~~Lv~~iv~~LVd~Pe~V~V   21 (78)
T PRK01064          1 MKEFLAYIVKNLVDRPEEVHI   21 (78)
T ss_pred             CHHHHHHHHHHhcCCCCeEEE
Confidence            468999999999887776655


No 48 
>KOG4027|consensus
Probab=34.20  E-value=35  Score=23.16  Aligned_cols=23  Identities=30%  Similarity=0.527  Sum_probs=17.3

Q ss_pred             EEEecC--CCCCcccHHHHHHHHHH
Q psy10732         21 HDLDLP--TGEKPWTIKGLIEWLKL   43 (58)
Q Consensus        21 h~v~l~--~~~~~~ti~~Li~~i~~   43 (58)
                      |+.++|  -.+.+.+|.+|++|++.
T Consensus       115 h~~~vp~f~Pe~~s~~q~~tswl~r  139 (187)
T KOG4027|consen  115 HVCRVPCFLPEPSSTVQQLTSWLRR  139 (187)
T ss_pred             eeEEEeeEecCCHHHHHHHHHHHHh
Confidence            777777  23346899999999974


No 49 
>PF13085 Fer2_3:  2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B ....
Probab=33.74  E-value=78  Score=19.36  Aligned_cols=23  Identities=9%  Similarity=0.239  Sum_probs=17.3

Q ss_pred             eEEEecCCCCCcccHHHHHHHHHHhc
Q psy10732         20 NHDLDLPTGEKPWTIKGLIEWLKLNK   45 (58)
Q Consensus        20 ~h~v~l~~~~~~~ti~~Li~~i~~nl   45 (58)
                      .++++.+   ...|+=+++.||++++
T Consensus        20 ~y~v~~~---~~~tVLd~L~~Ik~~~   42 (110)
T PF13085_consen   20 EYEVPVE---PGMTVLDALNYIKEEQ   42 (110)
T ss_dssp             EEEEEGG---STSBHHHHHHHHHHHT
T ss_pred             EEEecCC---CCCcHHHHHHHHHhcc
Confidence            3444444   3489999999999986


No 50 
>smart00049 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin. Domain of unknown function present in signalling proteins that contain PH, rasGEF, rhoGEF, rhoGAP, RGS, PDZ domains. DEP domain in Drosophila dishevelled is essential to rescue planar polarity defects and induce JNK signalling (Cell 94, 109-118).
Probab=33.38  E-value=45  Score=18.06  Aligned_cols=16  Identities=31%  Similarity=0.403  Sum_probs=14.1

Q ss_pred             cccHHHHHHHHHHhcc
Q psy10732         31 PWTIKGLIEWLKLNKL   46 (58)
Q Consensus        31 ~~ti~~Li~~i~~nll   46 (58)
                      -.+=.++++||.++..
T Consensus        20 ~F~G~e~v~wL~~~~~   35 (77)
T smart00049       20 CFTGSELVDWLMDNLE   35 (77)
T ss_pred             eeEcHHHHHHHHHcCC
Confidence            4788999999999986


No 51 
>PF08825 E2_bind:  E2 binding domain;  InterPro: IPR014929 E1 and E2 enzymes play a central role in ubiquitin and ubiquitin-like protein transfer cascades. This is an E2 binding domain that is found on NEDD8 activating E1 enzyme. The protein resembles ubiquitin, and recruits the catalytic core of the E2 enzyme Ubc12 in a similar manner to that in which ubiquitin interacts with ubiquitin binding domains []. ; GO: 0005524 ATP binding, 0016881 acid-amino acid ligase activity, 0045116 protein neddylation; PDB: 3GZN_D 3DBL_F 1R4N_H 1R4M_D 2NVU_B 1TT5_D 3DBR_D 3DBH_H 1YOV_B 3FN1_A ....
Probab=33.23  E-value=35  Score=19.95  Aligned_cols=15  Identities=33%  Similarity=0.612  Sum_probs=13.2

Q ss_pred             CcccHHHHHHHHHHh
Q psy10732         30 KPWTIKGLIEWLKLN   44 (58)
Q Consensus        30 ~~~ti~~Li~~i~~n   44 (58)
                      ..||+++||+.|++.
T Consensus         5 ~~~TL~~lid~L~~~   19 (84)
T PF08825_consen    5 PSWTLQDLIDSLCEK   19 (84)
T ss_dssp             TTSBSHHHHHHHHHS
T ss_pred             ccchHHHHHHHHHhC
Confidence            349999999999987


No 52 
>PF03164 Mon1:  Trafficking protein Mon1;  InterPro: IPR004353 Members of this family have been called SAND proteins [] although these proteins do not contain a SAND domain. In Saccharomyces cerevisiae a protein complex of Mon1 and Ccz1 functions with the small GTPase Ypt7 to mediate vesicle trafficking to the vacuole [, ]. The Mon1/Ccz1 complex is conserved in eukaryotic evolution and members of this family (previously known as DUF254) are distant homologues to domains of known structure that assemble into cargo vesicle adapter (AP) complexes [, ].
Probab=32.62  E-value=35  Score=25.00  Aligned_cols=21  Identities=33%  Similarity=0.762  Sum_probs=16.0

Q ss_pred             cHHHHHHHHHHhccCCCCCceecCC
Q psy10732         33 TIKGLIEWLKLNKLTERPELFVQGD   57 (58)
Q Consensus        33 ti~~Li~~i~~nll~er~elFv~~~   57 (58)
                      ++..|++|++    ++.+.||+.++
T Consensus       392 ~~~~likWik----k~e~rLFI~~~  412 (415)
T PF03164_consen  392 SANKLIKWIK----KEENRLFITNG  412 (415)
T ss_pred             HHHHHHHHHH----hhcCeEEecCC
Confidence            4778888998    55668999764


No 53 
>cd04450 DEP_RGS7-like DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in RGS (regulator of G-protein signaling) proteins of the subfamily R7. This subgroup contains RGS7, RGS6, RGS9 and RGS11. They share a common domain architecture, containing, beside the RGS domain, a DEP domain and a GGL (G-protein gamma subunit-like ) domain. RGS proteins are GTPase-activating (GAP) proteins of heterotrimeric G proteins by increasing the rate of GTP hydrolysis of the alpha subunit. The fungal homologs, like yeast Sst2, share a related common domain architecture, containing RGS and DEP domains. Sst2 has been identified as the principal regulator of mating pheromone signaling and recently the DEP domain of Sst2 has been shown to be necessary and sufficient to mediate receptor interaction.
Probab=32.47  E-value=64  Score=18.48  Aligned_cols=38  Identities=21%  Similarity=0.316  Sum_probs=24.3

Q ss_pred             cchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhcc-CCCCC
Q psy10732          9 GGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNKL-TERPE   51 (58)
Q Consensus         9 GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nll-~er~e   51 (58)
                      .|+.+  -+.|.+.-..|   .-.|=.++++||.+|.- .+|.|
T Consensus        11 ~Gv~~--~~~r~~~~~~~---~~F~G~~~v~WL~~~~~~~~~~E   49 (88)
T cd04450          11 VGVRM--RTEKSFLTTVP---YAFTGKAIVQWLMDCTDVVDPSE   49 (88)
T ss_pred             CCeee--eeeEEeeeEcC---ceeEhHHHHHHHHHCCCCCCHHH
Confidence            45553  34555555566   33778899999999974 34443


No 54 
>PF09358 UBA_e1_C:  Ubiquitin-activating enzyme e1 C-terminal domain;  InterPro: IPR018965  This presumed domain found at the C terminus of Ubiquitin-activating enzyme e1 proteins is functionally uncharacterised. ; PDB: 3CMM_A.
Probab=32.36  E-value=38  Score=20.94  Aligned_cols=15  Identities=27%  Similarity=0.450  Sum_probs=11.9

Q ss_pred             cccHHHHHHHHHHhc
Q psy10732         31 PWTIKGLIEWLKLNK   45 (58)
Q Consensus        31 ~~ti~~Li~~i~~nl   45 (58)
                      +.|+++||+|++++.
T Consensus        42 ~~Tl~~li~~~~~~~   56 (125)
T PF09358_consen   42 DMTLQELIDYFKEKY   56 (125)
T ss_dssp             --BHHHHHHHHHHTT
T ss_pred             CCCHHHHHHHHHHHh
Confidence            589999999999865


No 55 
>PF01372 Melittin:  Melittin;  InterPro: IPR002116 Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an Arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Api m 3. Melittin is the principal protein component of the venom of the honeybee, Apis mellifera. It inhibits protein kinase C, Ca2+/calmodulin-dependent protein kinase II, myosin light chain kinase and Na+/K+-ATPase (synaptosomal membrane) and is a cell membrane lytic factor. Melittin is a small peptide with no disulphide bridge; the N-terminal part of the molecule is predominantly hydrophobic and the C-terminal part is hydrophilic and strongly basic. The molecular mechanisms underlying the various effects of melittin on membranes have not been completely defined and much of the evidence indicates that different molecular mechanisms may underlie different actions of the peptide []. Extensive work with melittin has shown that the venom has multiple effects, probably, as a result of its interaction with negatively changed phospholipids. It inhibits well known transport pumps such as the Na+-K+-ATPase and the H+-K+-ATPase. Melittin increases the permeability of cell membranes to ions, particularly Na+ and indirectly Ca2+, because of the Na+-Ca2+-exchange. This effect results in marked morphological and functional changes, particularly in excitable tissues such as cardiac myocytes. In some other tissues, e.g., cornea, not only Na+ but Cl- permeability is also increased by melittin. Similar effects to melittin on H+-K+-ATPase have been found with the synthetic amphipathic polypeptide Trp-3 [].  The study of melittin in model membranes has been useful for the development of methodology for determination of membrane protein structures. A molecular dynamics simulation of melittin in a hydrated dipalmitoylphosphatidylcholine (DPPC) bilayer was carried out. The effect of melittin on the surrounding membrane was localised to its immediate vicinity, and its asymmetry with respect to the two layers may be a result of the fact that it is not fully transmembranal. Melittin's hydrophilic C terminus anchors it at the extracellular interface, leaving the N terminus "loose" in the lower layer of the membrane [].; GO: 0004860 protein kinase inhibitor activity, 0005576 extracellular region; PDB: 3QRX_B 2MLT_A 1BH1_A.
Probab=32.22  E-value=35  Score=16.31  Aligned_cols=11  Identities=36%  Similarity=0.827  Sum_probs=8.2

Q ss_pred             HHHHHHHHHHh
Q psy10732         34 IKGLIEWLKLN   44 (58)
Q Consensus        34 i~~Li~~i~~n   44 (58)
                      +-.||+||++.
T Consensus        13 LP~lISWIK~k   23 (26)
T PF01372_consen   13 LPTLISWIKNK   23 (26)
T ss_dssp             HHHHHHHHHHH
T ss_pred             ChHHHHHHHHH
Confidence            45689999863


No 56 
>PF12646 DUF3783:  Domain of unknown function (DUF3783);  InterPro: IPR016621 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=31.14  E-value=91  Score=16.67  Aligned_cols=18  Identities=39%  Similarity=0.577  Sum_probs=13.9

Q ss_pred             CCCCcccHHHHHHHHHHh
Q psy10732         27 TGEKPWTIKGLIEWLKLN   44 (58)
Q Consensus        27 ~~~~~~ti~~Li~~i~~n   44 (58)
                      +.+..||+++|+.-|++.
T Consensus        36 ~tN~~Wt~~~L~~El~~E   53 (58)
T PF12646_consen   36 PTNINWTLKDLLEELKEE   53 (58)
T ss_pred             CCcccCcHHHHHHHHHHH
Confidence            355679999999988753


No 57 
>PF05193 Peptidase_M16_C:  Peptidase M16 inactive domain;  InterPro: IPR007863 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. These metallopeptidases belong to MEROPS peptidase family M16 (clan ME). They include proteins, which are classified as non-peptidase homologues either have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity.  The peptidases in this group of sequences include:  Insulinase, insulin-degrading enzyme (3.4.24.56 from EC) Mitochondrial processing peptidase alpha subunit, (Alpha-MPP, 3.4.24.64 from EC) Pitrlysin, Protease III precursor (3.4.24.55 from EC) Nardilysin, (3.4.24.61 from EC) Ubiquinol-cytochrome C reductase complex core protein I,mitochondrial precursor (1.10.2.2 from EC) Coenzyme PQQ synthesis protein F (3.4.99 from EC)  These proteins do not share many regions of sequence similarity; the most noticeable is in the N-terminal section. This region includes a conserved histidine followed, two residues later by a glutamate and another histidine. In pitrilysin, it has been shown [] that this H-x-x-E-H motif is involved in enzymatic activity; the two histidines bind zinc and the glutamate is necessary for catalytic activity. The mitochondrial processing peptidase consists of two structurally related domains. One is the active peptidase whereas the other, the C-terminal region, is inactive. The two domains hold the substrate like a clamp [].; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis; PDB: 1BE3_B 1PP9_B 2A06_B 1SQB_B 1SQP_B 1L0N_B 1SQX_B 1NU1_B 1L0L_B 2FYU_B ....
Probab=30.68  E-value=34  Score=19.89  Aligned_cols=26  Identities=23%  Similarity=0.243  Sum_probs=15.2

Q ss_pred             ccHHHHHHHHHHhccCCCCCceecCC
Q psy10732         32 WTIKGLIEWLKLNKLTERPELFVQGD   57 (58)
Q Consensus        32 ~ti~~Li~~i~~nll~er~elFv~~~   57 (58)
                      +|..+|.+|.+..+-.++-.+++.||
T Consensus         2 it~e~l~~f~~~~y~p~n~~l~i~Gd   27 (184)
T PF05193_consen    2 ITLEDLRAFYKKFYRPSNMTLVIVGD   27 (184)
T ss_dssp             --HHHHHHHHHHHSSGGGEEEEEEES
T ss_pred             CCHHHHHHHHHHhcCccceEEEEEcC
Confidence            56667777777766665555665543


No 58 
>COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones]
Probab=30.58  E-value=23  Score=22.10  Aligned_cols=14  Identities=21%  Similarity=0.541  Sum_probs=10.3

Q ss_pred             EEEEeccchhhhcC
Q psy10732          3 ITVQFGGGAELLFG   16 (58)
Q Consensus         3 i~vEF~GGlElLF~   16 (58)
                      |.=||-||+|++-.
T Consensus        77 i~GEfvGG~DIv~E   90 (105)
T COG0278          77 VNGEFVGGCDIVRE   90 (105)
T ss_pred             ECCEEeccHHHHHH
Confidence            34499999998643


No 59 
>PRK13344 spxA transcriptional regulator Spx; Reviewed
Probab=29.98  E-value=27  Score=21.62  Aligned_cols=43  Identities=14%  Similarity=0.213  Sum_probs=26.0

Q ss_pred             ccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhcc-CCCC
Q psy10732          8 GGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNKL-TERP   50 (58)
Q Consensus         8 ~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nll-~er~   50 (58)
                      ++|.|-|++....--=.++.....++..++++.|.+|=. -.||
T Consensus        50 ~~~~~~lin~~~~~~k~L~~~~~~ls~~e~i~ll~~~P~LikRP   93 (132)
T PRK13344         50 ENGIESIVSSKNRYAKALDCDIEELSVNEVIDLIQENPRILKSP   93 (132)
T ss_pred             CCCHHHhhccCcHHHHhCCcchhcCCHHHHHHHHHhCccceeCc
Confidence            457888888533322124422245788999999988743 2355


No 60 
>KOG0911|consensus
Probab=29.95  E-value=24  Score=24.65  Aligned_cols=17  Identities=24%  Similarity=0.380  Sum_probs=12.4

Q ss_pred             EEEEeccchhhhcCCee
Q psy10732          3 ITVQFGGGAELLFGKVK   19 (58)
Q Consensus         3 i~vEF~GGlElLF~~~k   19 (58)
                      |.=||-||||+|-+-.+
T Consensus       200 I~GEFiGGlDIl~~m~~  216 (227)
T KOG0911|consen  200 VKGEFIGGLDILKEMHE  216 (227)
T ss_pred             ECCEeccCcHHHHHHhh
Confidence            34499999999866443


No 61 
>KOG4392|consensus
Probab=29.62  E-value=87  Score=19.89  Aligned_cols=39  Identities=28%  Similarity=0.370  Sum_probs=26.6

Q ss_pred             hhcCCeeeEEEecCC----------CCCcccHHHHHHHHHHhccCCCCCcee
Q psy10732         13 LLFGKVKNHDLDLPT----------GEKPWTIKGLIEWLKLNKLTERPELFV   54 (58)
Q Consensus        13 lLF~~~k~h~v~l~~----------~~~~~ti~~Li~~i~~nll~er~elFv   54 (58)
                      +||.+.|+.+++...          +.+..|++.+|   +..++++++=||-
T Consensus        11 ll~eg~kKvtin~DtKvpNA~~fTiekEDHTLGNii---~~qLl~D~~vLFa   59 (117)
T KOG4392|consen   11 LLFEGEKKITINKDTKVPNAALFTIEKEDHTLGNII---KSQLLKDPRVLFA   59 (117)
T ss_pred             eeccCCceeEEecCCCCCceEEEEEecccchHHHHH---HHHHccCccceEe
Confidence            467777876666441          33457888875   6778888776774


No 62 
>PF09494 Slx4:  Slx4 endonuclease;  InterPro: IPR018574  The Slx4 protein is a heteromeric structure-specific endonuclease found in fungi. Slx4 with Slx1 acts as a nuclease on branched DNA substrates, particularly simple-Y, 5'-flap, or replication fork structures by cleaving the strand bearing the 5' non-homologous arm at the branch junction and thus generating ligatable nicked products from 5'-flap or replication fork substrates []. 
Probab=29.38  E-value=52  Score=17.92  Aligned_cols=17  Identities=29%  Similarity=0.692  Sum_probs=14.1

Q ss_pred             CcccHHHHHHHHHHhcc
Q psy10732         30 KPWTIKGLIEWLKLNKL   46 (58)
Q Consensus        30 ~~~ti~~Li~~i~~nll   46 (58)
                      +|+.+.+|.+|++.+-+
T Consensus        23 ePI~L~el~~~L~~~g~   39 (64)
T PF09494_consen   23 EPINLEELHAWLKASGI   39 (64)
T ss_pred             CCccHHHHHHHHHHcCC
Confidence            47999999999996554


No 63 
>PF09865 DUF2092:  Predicted periplasmic protein (DUF2092);  InterPro: IPR019207  This entry represents various hypothetical prokaryotic proteins of unknown function. 
Probab=29.22  E-value=81  Score=21.32  Aligned_cols=25  Identities=32%  Similarity=0.445  Sum_probs=19.2

Q ss_pred             CcccHHHHHHHHHHhccCCCC--Ccee
Q psy10732         30 KPWTIKGLIEWLKLNKLTERP--ELFV   54 (58)
Q Consensus        30 ~~~ti~~Li~~i~~nll~er~--elFv   54 (58)
                      .|-|+.++|.++++.+=-+=|  |||+
T Consensus        88 aP~tid~~i~~l~~~~gi~~P~aDll~  114 (214)
T PF09865_consen   88 APGTIDAAIDYLRDKYGIELPLADLLY  114 (214)
T ss_pred             CCCCHHHHHHHHHHhhCCCccHHHhcc
Confidence            467999999999998765555  5655


No 64 
>PF05595 DUF771:  Domain of unknown function (DUF771) ;  InterPro: IPR008489 This entry is represented by Bacteriophage bIL285, Orf7. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of uncharacterised ORFs found in Bacteriophage and Lactococcus lactis.
Probab=29.10  E-value=54  Score=19.10  Aligned_cols=18  Identities=39%  Similarity=0.739  Sum_probs=14.6

Q ss_pred             cccHHHHHH-------HHHHhccCC
Q psy10732         31 PWTIKGLIE-------WLKLNKLTE   48 (58)
Q Consensus        31 ~~ti~~Li~-------~i~~nll~e   48 (58)
                      -|+|.+|..       ||++|++.+
T Consensus        23 ~W~~~dl~k~~~~s~~wi~~~il~~   47 (91)
T PF05595_consen   23 WWDMKDLRKRTGKSREWIKENILYN   47 (91)
T ss_pred             eeeHHHHHHHHCCCHHHHHHHcccC
Confidence            379999986       888999875


No 65 
>PTZ00171 acyl carrier protein; Provisional
Probab=28.29  E-value=9.2  Score=24.59  Aligned_cols=37  Identities=27%  Similarity=0.493  Sum_probs=24.8

Q ss_pred             hhhhcCCeeeEEEecCCC--CCcccHHHHHHHHHHhccC
Q psy10732         11 AELLFGKVKNHDLDLPTG--EKPWTIKGLIEWLKLNKLT   47 (58)
Q Consensus        11 lElLF~~~k~h~v~l~~~--~~~~ti~~Li~~i~~nll~   47 (58)
                      +|++..=.+...+.+|.+  ..-.|++++++||.++..+
T Consensus       108 veLv~~LEdeFgI~Ipded~~~i~TV~dlvd~V~~~~~~  146 (148)
T PTZ00171        108 VELLIAIEQEFNLTIPDHDAEKIKTVQDAIDYIEQNNMA  146 (148)
T ss_pred             HHHHHHHHHHHCCccCHHHHHHCCCHHHHHHHHHHHHhc
Confidence            344444455666778832  2357999999999987643


No 66 
>PF14658 EF-hand_9:  EF-hand domain
Probab=27.72  E-value=50  Score=18.74  Aligned_cols=16  Identities=19%  Similarity=0.297  Sum_probs=12.4

Q ss_pred             CcccHHHHHHHHHHhc
Q psy10732         30 KPWTIKGLIEWLKLNK   45 (58)
Q Consensus        30 ~~~ti~~Li~~i~~nl   45 (58)
                      +.+.+.+|+.||+..=
T Consensus        13 G~V~v~~l~~~Lra~~   28 (66)
T PF14658_consen   13 GRVPVSDLITYLRAVT   28 (66)
T ss_pred             ceEeHHHHHHHHHHHc
Confidence            4577999999998643


No 67 
>cd04441 DEP_2_DEP6 DEP (Dishevelled, Egl-10, and Pleckstrin) domain 2 found in DEP6-like proteins. DEP6 proteins contain two DEP and a PDZ domain. Their function is unknown.
Probab=27.71  E-value=28  Score=20.53  Aligned_cols=20  Identities=25%  Similarity=0.436  Sum_probs=14.8

Q ss_pred             ccHHHHHHHHHHhcc-CCCCC
Q psy10732         32 WTIKGLIEWLKLNKL-TERPE   51 (58)
Q Consensus        32 ~ti~~Li~~i~~nll-~er~e   51 (58)
                      ..=.+|++||.+|-. .+|++
T Consensus        33 F~GsElVdWL~~~~~~~sR~e   53 (85)
T cd04441          33 FVGSEFIDWLLQEGEAESRRE   53 (85)
T ss_pred             eEchHHHHHHHHcCCCCCHHH
Confidence            455799999999874 45654


No 68 
>cd01806 Nedd8 Nebb8-like  ubiquitin protein. Nedd8 (also known as Rub1) has a single conserved ubiquitin-like domain that is part of a protein modification pathway similar to that of ubiquitin.  Nedd8 modifies a family of molecular scaffold proteins called cullins that are responsible for assembling the ROC1/Rbx1 RING-based E3 ubiquitin ligases, of which several play a direct role in tumorigenesis.
Probab=27.69  E-value=1e+02  Score=16.17  Aligned_cols=34  Identities=21%  Similarity=0.274  Sum_probs=22.8

Q ss_pred             CeEEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhc
Q psy10732          1 MKITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNK   45 (58)
Q Consensus         1 ~~i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nl   45 (58)
                      |.|+|...+|        +.+.+++++   ..|+++|-+.|.+..
T Consensus         1 m~i~v~~~~g--------~~~~~~v~~---~~tv~~lK~~i~~~~   34 (76)
T cd01806           1 MLIKVKTLTG--------KEIEIDIEP---TDKVERIKERVEEKE   34 (76)
T ss_pred             CEEEEEeCCC--------CEEEEEECC---CCCHHHHHHHHhHhh
Confidence            5667766655        345566663   378999998887653


No 69 
>PF06117 DUF957:  Enterobacterial protein of unknown function (DUF957);  InterPro: IPR009301 This family consists of several hypothetical proteins from Escherichia coli, Salmonella typhi, Shigella flexneri and Proteus vulgaris. The function of this family is unknown.
Probab=27.53  E-value=64  Score=18.54  Aligned_cols=21  Identities=33%  Similarity=0.485  Sum_probs=15.2

Q ss_pred             cHHHHHHHHHHhccCCCCCce
Q psy10732         33 TIKGLIEWLKLNKLTERPELF   53 (58)
Q Consensus        33 ti~~Li~~i~~nll~er~elF   53 (58)
                      -+.-||.|+.+|+=.+..=.|
T Consensus         9 ~L~iLi~WLedNi~~es~iiF   29 (65)
T PF06117_consen    9 ALEILIAWLEDNIDCESDIIF   29 (65)
T ss_pred             HHHHHHHHHHcccCCCCCeee
Confidence            367899999999966543344


No 70 
>COG4822 CbiK Cobalamin biosynthesis protein CbiK, Co2+ chelatase [Coenzyme metabolism]
Probab=27.32  E-value=37  Score=24.15  Aligned_cols=26  Identities=35%  Similarity=0.580  Sum_probs=20.8

Q ss_pred             ccHHHHHHHHHHhccCC---CCCceecCC
Q psy10732         32 WTIKGLIEWLKLNKLTE---RPELFVQGD   57 (58)
Q Consensus        32 ~ti~~Li~~i~~nll~e---r~elFv~~~   57 (58)
                      ..+..+|.||++|-+++   =|=||+.|+
T Consensus       179 P~~d~vi~~l~~~~~~~v~L~PlMlvAG~  207 (265)
T COG4822         179 PLVDTVIEYLRKNGIKEVHLIPLMLVAGD  207 (265)
T ss_pred             CcHHHHHHHHHHcCCceEEEeeeEEeech
Confidence            35999999999999987   345777665


No 71 
>TIGR03083 uncharacterized Actinobacterial protein TIGR03083. This protein family pulls together several groups of proteins, each very different from the others. They share in common three conserved regions. The first is a region of about 38 amino acids, nearly always at the N-terminus of a protein. This region has a bulky hydrophobic residue, usually Trp, at position 29, and a His residue at position 37 that is invariant, so far, in over 150 instances. The second conserved region has a motif [DE]xxxHxxD. The third conserved region contains a hydrophobic patch and a well-conserved Arg residue. Most examples are found in the Actinobacteria, including the genera Mycobacterium, Corynebacterium, Streptomyces, Nocardia, Frankia, etc. The pattern of near-invariant residues against a backdrop of extreme sequence divergence suggests enzymatic activity and conservation of active site residues.
Probab=26.73  E-value=67  Score=20.31  Aligned_cols=22  Identities=27%  Similarity=0.444  Sum_probs=16.0

Q ss_pred             EecCCCCCcccHHHHHHHHHHh
Q psy10732         23 LDLPTGEKPWTIKGLIEWLKLN   44 (58)
Q Consensus        23 v~l~~~~~~~ti~~Li~~i~~n   44 (58)
                      .+-|.....||+++|+.++..+
T Consensus        21 ~~~Pt~c~gWtvrdl~~Hl~~~   42 (202)
T TIGR03083        21 WAAPTPCPGWTVRDLLAHLAGR   42 (202)
T ss_pred             ccCCCCCCCCcHHHHHHHHHHH
Confidence            4455445569999999999753


No 72 
>PF11716 MDMPI_N:  Mycothiol maleylpyruvate isomerase N-terminal domain;  InterPro: IPR024344 This entry represents the N-terminal metal-binding domain in mycothiol-dependent maleylpyruvate isomerases [].; GO: 0046872 metal ion binding; PDB: 2NSG_A 2NSF_A.
Probab=26.56  E-value=67  Score=18.74  Aligned_cols=16  Identities=25%  Similarity=0.451  Sum_probs=11.9

Q ss_pred             CCcccHHHHHHHHHHh
Q psy10732         29 EKPWTIKGLIEWLKLN   44 (58)
Q Consensus        29 ~~~~ti~~Li~~i~~n   44 (58)
                      ...||+++++.+|...
T Consensus        26 c~gWtv~dlv~Hl~~~   41 (140)
T PF11716_consen   26 CPGWTVRDLVAHLASW   41 (140)
T ss_dssp             STT-BHHHHHHHHHHH
T ss_pred             CCCCcHHHHHHHHHHH
Confidence            3459999999998764


No 73 
>cd00059 FH Forkhead (FH), also known as a "winged helix".  FH is named for the Drosophila fork head protein, a transcription factor which promotes terminal rather than segmental development. This family of transcription factor domains, which bind to B-DNA as monomers, are also found in the Hepatocyte nuclear factor (HNF) proteins, which provide tissue-specific gene regulation. The structure contains 2 flexible loops or "wings" in the C-terminal region, hence the term winged helix.
Probab=26.05  E-value=73  Score=18.26  Aligned_cols=18  Identities=28%  Similarity=0.453  Sum_probs=15.2

Q ss_pred             CCcccHHHHHHHHHHhcc
Q psy10732         29 EKPWTIKGLIEWLKLNKL   46 (58)
Q Consensus        29 ~~~~ti~~Li~~i~~nll   46 (58)
                      ++..|++++-.||++|.=
T Consensus        19 ~~~lTL~eIy~~I~~~~p   36 (78)
T cd00059          19 EKRLTLSEIYKWISDNFP   36 (78)
T ss_pred             CCCeeHHHHHHHHHHhCC
Confidence            356999999999998864


No 74 
>cd01803 Ubiquitin Ubiquitin. Ubiquitin  (includes Ubq/RPL40e and Ubq/RPS27a fusions as well as homopolymeric multiubiquitin protein chains)
Probab=25.45  E-value=1.1e+02  Score=15.97  Aligned_cols=33  Identities=24%  Similarity=0.220  Sum_probs=22.5

Q ss_pred             CeEEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHh
Q psy10732          1 MKITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLN   44 (58)
Q Consensus         1 ~~i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~n   44 (58)
                      |.|.|...+|        +.+.+++++   ..|+++|=+.|.+.
T Consensus         1 m~i~v~~~~g--------~~~~~~v~~---~~tV~~lK~~i~~~   33 (76)
T cd01803           1 MQIFVKTLTG--------KTITLEVEP---SDTIENVKAKIQDK   33 (76)
T ss_pred             CEEEEEcCCC--------CEEEEEECC---cCcHHHHHHHHHHH
Confidence            5667766655        556677773   26888888888654


No 75 
>PF11641 Antigen_Bd37:  Glycosylphosphatidylinositol-anchored merozoite surface protein;  InterPro: IPR021669  This family of proteins represents the core region of Bd37, a surface antigen of B.divergens which is GPI-anchored at the surface of the merozoite. The structure of the protein consists of mainly alpha folds and has three sub domains []. ; PDB: 2JO7_A.
Probab=25.33  E-value=32  Score=23.90  Aligned_cols=15  Identities=40%  Similarity=0.846  Sum_probs=9.4

Q ss_pred             CCCcccHHHHHHHHH
Q psy10732         28 GEKPWTIKGLIEWLK   42 (58)
Q Consensus        28 ~~~~~ti~~Li~~i~   42 (58)
                      .++|.||-+||.|+|
T Consensus        25 sdGp~tIlqLid~LR   39 (224)
T PF11641_consen   25 SDGPFTILQLIDYLR   39 (224)
T ss_dssp             --S---TTHHHHHHH
T ss_pred             cCCCeeHHHHHHHHH
Confidence            457999999999998


No 76 
>PF08817 YukD:  WXG100 protein secretion system (Wss), protein YukD;  InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold []. Ubiquitin covalently binds to protein and flags them for protein degradation, however conjugation assays have indicated that YukD lacks the capacity for covalent bond formation with other proteins []. ; PDB: 2BPS_B.
Probab=25.17  E-value=64  Score=17.91  Aligned_cols=26  Identities=27%  Similarity=0.148  Sum_probs=18.7

Q ss_pred             eeeEEEecCCCCCcccHHHHHHHHHHhcc
Q psy10732         18 VKNHDLDLPTGEKPWTIKGLIEWLKLNKL   46 (58)
Q Consensus        18 ~k~h~v~l~~~~~~~ti~~Li~~i~~nll   46 (58)
                      .+..++.||.+   .+++.|+.-|.+-+-
T Consensus        12 ~~~~Dl~lP~~---vpv~~li~~l~~~~~   37 (79)
T PF08817_consen   12 GRQVDLALPAD---VPVAELIPELVELLG   37 (79)
T ss_dssp             --EEEEEEETT---SBTTHHHHHHHHHS-
T ss_pred             CcEEEEEcCCC---CcHHHHHHHHHHHhC
Confidence            46889999943   789999998887543


No 77 
>TIGR00517 acyl_carrier acyl carrier protein. S (Ser) at position 37 in the seed alignment, in the motif DSLD, is the phosphopantetheine attachment site.
Probab=24.50  E-value=61  Score=17.57  Aligned_cols=34  Identities=24%  Similarity=0.475  Sum_probs=23.0

Q ss_pred             hhhhcCCeeeEEEecCCC--CCcccHHHHHHHHHHh
Q psy10732         11 AELLFGKVKNHDLDLPTG--EKPWTIKGLIEWLKLN   44 (58)
Q Consensus        11 lElLF~~~k~h~v~l~~~--~~~~ti~~Li~~i~~n   44 (58)
                      +|++..=.+...+++|..  ..-.|++++++|+..+
T Consensus        41 veli~~lE~~f~i~i~~~~~~~~~tv~~l~~~i~~~   76 (77)
T TIGR00517        41 VELVMALEEEFDIEIPDEEAEKIATVGDAVDYIEEN   76 (77)
T ss_pred             HHHHHHHHHHHCCCCCHHHHHHCCcHHHHHHHHHhc
Confidence            455555556677888832  1236999999999764


No 78 
>TIGR01034 metK S-adenosylmethionine synthetase. Tandem isozymes of this S-adenosylmethionine synthetase in E. coli are designated MetK and MetX.
Probab=24.40  E-value=1.8e+02  Score=21.80  Aligned_cols=41  Identities=22%  Similarity=0.249  Sum_probs=28.8

Q ss_pred             eEEEEeccchhhhcCCeeeEEEecCC-CCCcccHHHHHHHHHHhccC
Q psy10732          2 KITVQFGGGAELLFGKVKNHDLDLPT-GEKPWTIKGLIEWLKLNKLT   47 (58)
Q Consensus         2 ~i~vEF~GGlElLF~~~k~h~v~l~~-~~~~~ti~~Li~~i~~nll~   47 (58)
                      .|+||+..|-     .+|.|+|-+.. ....++..+|-..|++++++
T Consensus       164 QVtveY~~~~-----P~rv~tivvS~QH~~~v~~~~l~~~i~~~vi~  205 (377)
T TIGR01034       164 QVTVQYEDNK-----PVRVDTIVLSTQHDPDISQKDLREAIIEEIIK  205 (377)
T ss_pred             EEEEEEECCc-----eeEEEEEEEecCCCCCCCHHHHHHHHHHHHhH
Confidence            3788886542     57788888773 33458888888888777764


No 79 
>KOG3571|consensus
Probab=24.01  E-value=69  Score=25.34  Aligned_cols=37  Identities=24%  Similarity=0.396  Sum_probs=25.7

Q ss_pred             chhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhcc--CCCCC
Q psy10732         10 GAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNKL--TERPE   51 (58)
Q Consensus        10 GlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nll--~er~e   51 (58)
                      |||  ..+..-.++++|.   ..-=+||+.||.+|+-  .+|++
T Consensus       406 GLe--irdRmWlKItIPn---afiGsDlVdWL~~hVeg~~~Rke  444 (626)
T KOG3571|consen  406 GLE--IRDRMWLKITIPN---AFIGSDLVDWLVDHVEGLHERKE  444 (626)
T ss_pred             cce--eccceeeeeecch---hhcchhHHHHHHHHhhhhhhHHH
Confidence            666  4566778888882   2334789999999984  45553


No 80 
>KOG3954|consensus
Probab=23.89  E-value=59  Score=23.83  Aligned_cols=19  Identities=37%  Similarity=0.643  Sum_probs=15.7

Q ss_pred             HHHHHHHHHHhccC-CCCCc
Q psy10732         34 IKGLIEWLKLNKLT-ERPEL   52 (58)
Q Consensus        34 i~~Li~~i~~nll~-er~el   52 (58)
                      -..|-.|+.+++.| |||||
T Consensus       196 ~~~~se~v~~~ltkseRPdL  215 (336)
T KOG3954|consen  196 PVSLSEWVSQELTKSERPDL  215 (336)
T ss_pred             hhHHHHHHHhhcccccCCcc
Confidence            35678899999997 69986


No 81 
>PRK13021 secF preprotein translocase subunit SecF; Reviewed
Probab=23.54  E-value=1.9e+02  Score=20.50  Aligned_cols=31  Identities=23%  Similarity=0.324  Sum_probs=16.9

Q ss_pred             EEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHh
Q psy10732          3 ITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLN   44 (58)
Q Consensus         3 i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~n   44 (58)
                      .-++|+||..        .+++.+   ++.++.++=+.+.+.
T Consensus        35 ~GIDFtGG~~--------~~~~~~---~~~~~~~vr~~l~~~   65 (297)
T PRK13021         35 WGLDFTGGVV--------TEVQLD---RKITSSELQPLLNAA   65 (297)
T ss_pred             CceeecCceE--------EEEEeC---CCCCHHHHHHHHHhc
Confidence            3489999932        233333   235555555555553


No 82 
>PF02991 Atg8:  Autophagy protein Atg8 ubiquitin like;  InterPro: IPR004241  Autophagy is generally known as a process involved in the degradation of bulk cytoplasmic components that are non-specifically sequestered into an autophagosome, where they are sequestered into double-membrane vesicles and delivered to the degradative organelle, the lysosome/vacuole, for breakdown and eventual recycling of the resulting macromolecules. The yeast proteins are involved in the autophagosome, and Atg8 binds Atg19, via its N terminus and the C terminus of Atg19.  Light chain 3 is proposed to function primarily as a subunit of microtubule associated proteins 1A and 1B and that its expression may regulate microtubule binding activity [] Related proteins that belong to this group include the human ganglioside expression factor and a symbiosis-related fungal protein.; PDB: 3ECI_A 3D32_B 1GNU_A 1KM7_A 1KLV_A 1KOT_A 3DOW_A 1KJT_A 1V49_A 2ZJD_C ....
Probab=23.38  E-value=1.8e+02  Score=17.55  Aligned_cols=48  Identities=19%  Similarity=0.172  Sum_probs=25.2

Q ss_pred             eEEEEeccchhhhcCCeeeEEEecCCCCCcccHHHHHHHHHHhccCCCC-Ccee
Q psy10732          2 KITVQFGGGAELLFGKVKNHDLDLPTGEKPWTIKGLIEWLKLNKLTERP-ELFV   54 (58)
Q Consensus         2 ~i~vEF~GGlElLF~~~k~h~v~l~~~~~~~ti~~Li~~i~~nll~er~-elFv   54 (58)
                      .|.||=..+.-+=.-++++. + +|   +..|+++++..||.++--+.. -+|+
T Consensus        18 PVIvEr~~~s~lp~ldk~Kf-L-vp---~~~tv~qf~~~ir~rl~l~~~~alfl   66 (104)
T PF02991_consen   18 PVIVERYPKSKLPDLDKKKF-L-VP---KDLTVGQFVYIIRKRLQLSPEQALFL   66 (104)
T ss_dssp             EEEEEE-TTSSS---SSSEE-E-EE---TTSBHHHHHHHHHHHTT--TTS-EEE
T ss_pred             EEEEEEccCCChhhcCccEE-E-Ec---CCCchhhHHHHhhhhhcCCCCceEEE
Confidence            45566655544222222222 2 45   338999999999999854433 3444


No 83 
>cd00166 SAM Sterile alpha motif.; Widespread domain in signalling and nuclear proteins. In EPH-related tyrosine kinases, appears to mediate cell-cell initiated signal transduction via the binding of SH2-containing proteins to a conserved tyrosine that is phosphorylated. In many cases mediates homodimerization.
Probab=23.21  E-value=79  Score=15.77  Aligned_cols=15  Identities=33%  Similarity=0.804  Sum_probs=12.3

Q ss_pred             ccHHHHHHHHHHhcc
Q psy10732         32 WTIKGLIEWLKLNKL   46 (58)
Q Consensus        32 ~ti~~Li~~i~~nll   46 (58)
                      ||..++..|++..=+
T Consensus         2 w~~~~V~~wL~~~~~   16 (63)
T cd00166           2 WSPEDVAEWLESLGL   16 (63)
T ss_pred             CCHHHHHHHHHHcCh
Confidence            789999999987654


No 84 
>PF00034 Cytochrom_C:  Cytochrome c;  InterPro: IPR003088 Cytochromes c (cytC) can be defined as electron-transfer proteins having one or several haem c groups, bound to the protein by one or, more generally, two thioether bonds involving sulphydryl groups of cysteine residues. The fifth haem iron ligand is always provided by a histidine residue. CytC possess a wide range of properties and function in a large number of different redox processes. Ambler [] recognised four classes of cytC. Class I includes the low-spin soluble cytC of mitochondria and bacteria, with the haem-attachment site towards the N terminus, and the sixth ligand provided by a methionine residue about 40 residues further on towards the C terminus. On the basis of sequence similarity, class I cytC were further subdivided into five classes, IA to IE. Class IB includes the eukaryotic mitochondrial cytC and prokaryotic 'short' cyt c2 exemplified by Rhodopila globiformis cyt c2; class IA includes 'long' cyt c2, such as Rhodospirillum rubrum cyt c2 and Aquaspirillum itersonii cyt c-550, which have several extra loops by comparison with class IB cytC.; GO: 0005506 iron ion binding, 0009055 electron carrier activity, 0020037 heme binding; PDB: 1YNR_B 2AI5_A 1AYG_A 3O5C_C 1YEA_A 3CXH_W 1YTC_A 1YEB_A 2YBB_Y 2B4Z_A ....
Probab=22.79  E-value=74  Score=16.40  Aligned_cols=12  Identities=25%  Similarity=0.313  Sum_probs=9.7

Q ss_pred             ccHHHHHHHHHH
Q psy10732         32 WTIKGLIEWLKL   43 (58)
Q Consensus        32 ~ti~~Li~~i~~   43 (58)
                      -.+.+|+.||+.
T Consensus        78 ~e~~~l~ayl~s   89 (91)
T PF00034_consen   78 EEIADLAAYLRS   89 (91)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHH
Confidence            358999999975


No 85 
>PRK08172 putative acyl carrier protein IacP; Validated
Probab=22.71  E-value=72  Score=18.16  Aligned_cols=28  Identities=11%  Similarity=0.067  Sum_probs=19.1

Q ss_pred             eeeEEEecCCC--CCcccHHHHHHHHHHhc
Q psy10732         18 VKNHDLDLPTG--EKPWTIKGLIEWLKLNK   45 (58)
Q Consensus        18 ~k~h~v~l~~~--~~~~ti~~Li~~i~~nl   45 (58)
                      .....+.+|.+  .+-.|+++++.|+++++
T Consensus        49 Ee~F~I~i~~~d~~~i~Tv~di~~~v~~~~   78 (82)
T PRK08172         49 SEEFDISCNENDLPDMTTFADICRVVKKSL   78 (82)
T ss_pred             HHHHCCCcCHHHHHHCCCHHHHHHHHHHHH
Confidence            34455667732  23579999999999854


No 86 
>cd04439 DEP_1_P-Rex DEP (Dishevelled, Egl-10, and Pleckstrin) domain 1 found in P-Rex-like proteins. The P-Rex family is the guanine-nucleotide exchange factor (GEF) for the small GTPase Rac that contains an N-terminal RhoGEF domain, two DEP and PDZ domains. Rac-GEF activity is stimulated by phosphatidylinositol (3,4,5)-trisphosphate (PtdIns(3,4,5)P3), a lipid second messenger, and by the G beta-gamma subunits of heterotrimeric G proteins. The DEP domains are not involved in mediating these stimuli, but may be of importance for basal and stimulated levels Rac-GEF activity.
Probab=22.62  E-value=54  Score=18.90  Aligned_cols=32  Identities=13%  Similarity=0.185  Sum_probs=20.3

Q ss_pred             cCCeeeEEEecCCCCCcccHHHHHHHHHHhccCCC
Q psy10732         15 FGKVKNHDLDLPTGEKPWTIKGLIEWLKLNKLTER   49 (58)
Q Consensus        15 F~~~k~h~v~l~~~~~~~ti~~Li~~i~~nll~er   49 (58)
                      +.+.+.|--+.|   .-.+=.+|++||.+|...+.
T Consensus        15 ikdr~~~~~~~~---~cF~GselVdWL~~~~~~~~   46 (81)
T cd04439          15 IKDRRRKLSTFP---KCFLGNEFVSWLLEIGEISK   46 (81)
T ss_pred             eEeeEECcEEcC---ceeEhHHHHHHHHHcCCCCC
Confidence            334344444455   23677899999999887643


No 87 
>cd04371 DEP DEP domain, named after Dishevelled, Egl-10, and Pleckstrin, where this domain was first discovered. The function of this domain is still not clear, but it is believed to be important for the membrane association of the signaling proteins in which it is present. New studies show that the DEP domain of Sst2, a yeast RGS protein is necessary and sufficient for receptor interaction.
Probab=22.57  E-value=67  Score=17.30  Aligned_cols=16  Identities=31%  Similarity=0.389  Sum_probs=13.8

Q ss_pred             cccHHHHHHHHHHhcc
Q psy10732         31 PWTIKGLIEWLKLNKL   46 (58)
Q Consensus        31 ~~ti~~Li~~i~~nll   46 (58)
                      ..+=+++++||.++.-
T Consensus        28 ~F~G~e~v~WL~~~~~   43 (81)
T cd04371          28 CFTGSELVDWLLDNLE   43 (81)
T ss_pred             eeEcHHHHHHHHHhCC
Confidence            3678999999999986


No 88 
>PF09467 Yopt:  Hypothetical protein Yopt;  InterPro: IPR018572 This entry is represented by Bacteriophage SP-beta, YopT. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. The gene, yopT, is expressed in Bacillus subtilis; it forms homo-dimers, with each monomer consisting of one alpha helix and three beta strands. ; PDB: 2DLB_A.
Probab=22.54  E-value=83  Score=18.25  Aligned_cols=22  Identities=18%  Similarity=0.240  Sum_probs=17.2

Q ss_pred             HHHHHHHHHHhccCCCCCceec
Q psy10732         34 IKGLIEWLKLNKLTERPELFVQ   55 (58)
Q Consensus        34 i~~Li~~i~~nll~er~elFv~   55 (58)
                      -+.+..-|++++|..|.=.|++
T Consensus        25 S~~~~ericEkLm~a~eV~F~k   46 (71)
T PF09467_consen   25 SRNLAERICEKLMVAREVSFLK   46 (71)
T ss_dssp             HHHHHHHHHHTTTT-SEEEEE-
T ss_pred             hHHHHHHHHHHHHHHheeEEEe
Confidence            3567889999999999989986


No 89 
>COG0137 ArgG Argininosuccinate synthase [Amino acid transport and metabolism]
Probab=22.51  E-value=54  Score=24.72  Aligned_cols=12  Identities=25%  Similarity=0.745  Sum_probs=9.3

Q ss_pred             eEEEEeccchhh
Q psy10732          2 KITVQFGGGAEL   13 (58)
Q Consensus         2 ~i~vEF~GGlEl   13 (58)
                      +|-+-||||||+
T Consensus         6 kvvLAYSGGLDT   17 (403)
T COG0137           6 KVVLAYSGGLDT   17 (403)
T ss_pred             EEEEEecCCccH
Confidence            466788999886


No 90 
>PF10827 DUF2552:  Protein of unknown function (DUF2552) ;  InterPro: IPR020157 This entry contains proteins with no known function.
Probab=22.48  E-value=72  Score=18.88  Aligned_cols=16  Identities=19%  Similarity=0.200  Sum_probs=13.8

Q ss_pred             CcccHHHHHHHHHHhc
Q psy10732         30 KPWTIKGLIEWLKLNK   45 (58)
Q Consensus        30 ~~~ti~~Li~~i~~nl   45 (58)
                      +=.|+..-|+||.+|+
T Consensus        57 eF~tld~Ai~Wi~e~M   72 (79)
T PF10827_consen   57 EFPTLDLAIAWIGEHM   72 (79)
T ss_pred             ccccHHHHHHHHHhcc
Confidence            3478999999999987


No 91 
>PF02350 Epimerase_2:  UDP-N-acetylglucosamine 2-epimerase;  InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5.1.3.14 from EC catalyses the production of UDP-ManNAc from UDP-GlcNAc. Some of the enzymes is this family are bifunctional. In microorganisms the epimerase is involved in in the synthesis of the capsule precursor UDP-ManNAcA [, ]. The protein from rat liver displays both epimerase and kinase activity [].; GO: 0008761 UDP-N-acetylglucosamine 2-epimerase activity, 0006047 UDP-N-acetylglucosamine metabolic process, 0009103 lipopolysaccharide biosynthetic process; PDB: 1V4V_B 3BEO_B 3DZC_B 3OT5_B 1O6C_B 1VGV_D 1F6D_C.
Probab=22.23  E-value=50  Score=23.31  Aligned_cols=39  Identities=23%  Similarity=0.178  Sum_probs=24.7

Q ss_pred             eEEEecCCCCC--cccHHHHHHHHHHhccCCCCC-ceecCCC
Q psy10732         20 NHDLDLPTGEK--PWTIKGLIEWLKLNKLTERPE-LFVQGDS   58 (58)
Q Consensus        20 ~h~v~l~~~~~--~~ti~~Li~~i~~nll~er~e-lFv~~~t   58 (58)
                      +-.+.|+.++.  ...++.++.++.+-+-+.+|| ++|.||+
T Consensus        36 ~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~Pd~Vlv~GD~   77 (346)
T PF02350_consen   36 KPDYLLDSDSQSMAKSTGLAIIELADVLEREKPDAVLVLGDR   77 (346)
T ss_dssp             SEEEE--STTS-HHHHHHHHHHHHHHHHHHHT-SEEEEETTS
T ss_pred             CCCcccccccchHHHHHHHHHHHHHHHHHhcCCCEEEEEcCC
Confidence            33444552222  456888899999988889999 4558885


No 92 
>PRK08364 sulfur carrier protein ThiS; Provisional
Probab=22.09  E-value=97  Score=16.91  Aligned_cols=19  Identities=0%  Similarity=0.190  Sum_probs=13.5

Q ss_pred             EEEecCCCCCcccHHHHHHHHH
Q psy10732         21 HDLDLPTGEKPWTIKGLIEWLK   42 (58)
Q Consensus        21 h~v~l~~~~~~~ti~~Li~~i~   42 (58)
                      .+++++.   ..|+++|++.+.
T Consensus        16 ~~~~~~~---~~tv~~ll~~l~   34 (70)
T PRK08364         16 KEIEWRK---GMKVADILRAVG   34 (70)
T ss_pred             eEEEcCC---CCcHHHHHHHcC
Confidence            4566662   379999998773


No 93 
>PRK12459 S-adenosylmethionine synthetase; Provisional
Probab=21.39  E-value=1.8e+02  Score=21.90  Aligned_cols=41  Identities=15%  Similarity=0.250  Sum_probs=28.1

Q ss_pred             eEEEEeccchhhhcCCeeeEEEecCC-CCCcccHHHHHHHHHHhccC
Q psy10732          2 KITVQFGGGAELLFGKVKNHDLDLPT-GEKPWTIKGLIEWLKLNKLT   47 (58)
Q Consensus         2 ~i~vEF~GGlElLF~~~k~h~v~l~~-~~~~~ti~~Li~~i~~nll~   47 (58)
                      .|+||+.+|     ..+|.|+|-+.. ....++...|-..|++.+++
T Consensus       171 QVtv~Y~~~-----~P~rv~tivvS~QH~~~v~~~~~~~~i~e~vi~  212 (386)
T PRK12459        171 QVTVEYEDG-----RPVRVDTIVVSAQHDESVDLETLRRDVIENVIK  212 (386)
T ss_pred             EEEEEeeCC-----ceeEEEEEEEeeccCCCCCHHHHHHHHHHHHHH
Confidence            378888665     256788888773 33357877777777777663


No 94 
>COG1365 Predicted ATPase (PP-loop superfamily) [General function prediction only]
Probab=21.23  E-value=61  Score=23.01  Aligned_cols=13  Identities=38%  Similarity=0.718  Sum_probs=11.3

Q ss_pred             CeEEEEeccchhh
Q psy10732          1 MKITVQFGGGAEL   13 (58)
Q Consensus         1 ~~i~vEF~GGlEl   13 (58)
                      +++.|-||||.|.
T Consensus        61 ~kiaVA~SGG~DS   73 (255)
T COG1365          61 PKIAVAYSGGVDS   73 (255)
T ss_pred             ceEEEEecCCcch
Confidence            4688999999997


No 95 
>cd04449 DEP_DEPDC5-like DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in DEPDC5-like proteins. DEPDC5, in human also known as KIAA0645, is a DEP domain containing protein of unknown function.
Probab=21.11  E-value=49  Score=18.88  Aligned_cols=20  Identities=25%  Similarity=0.385  Sum_probs=15.4

Q ss_pred             ccHHHHHHHHHHhc--cCCCCC
Q psy10732         32 WTIKGLIEWLKLNK--LTERPE   51 (58)
Q Consensus        32 ~ti~~Li~~i~~nl--l~er~e   51 (58)
                      .+=.++++||.+|.  ...|.|
T Consensus        30 F~G~e~VdWL~~~~~~~~~r~e   51 (83)
T cd04449          30 FIGSEAVSWLINNFEDVDTREE   51 (83)
T ss_pred             eEhHHHHHHHHHhCCCCCCHHH
Confidence            67789999999985  355654


No 96 
>cd01712 ThiI ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway. It belongs to the Adenosine Nucleotide Hydrolysis suoerfamily and predicted to bind to Adenosine nucleotide.
Probab=21.08  E-value=62  Score=20.14  Aligned_cols=14  Identities=21%  Similarity=0.306  Sum_probs=10.5

Q ss_pred             eEEEEeccchhhhc
Q psy10732          2 KITVQFGGGAELLF   15 (58)
Q Consensus         2 ~i~vEF~GGlElLF   15 (58)
                      ++-|=||||.|..+
T Consensus         1 ~vlv~~SGG~DS~~   14 (177)
T cd01712           1 KALALLSGGIDSPV   14 (177)
T ss_pred             CEEEEecCChhHHH
Confidence            35678999999743


No 97 
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain). Like PDI, P5 is located in the endoplasmic reticulum (ER) and displays both isomerase and chaperone activities, which are independent of each other. Compared to PDI, the isomerase and chaperone activities of P5 are lower. The first cysteine in the CXXC motif of both redox active domains in P5 is necessary for isomerase activity. The P5 gene was first isolated as an amplified gene from a hydroxyurea-resistant hamster cell line. The zebrafish P5 homolog has been implicated to play a critical role in establishing left/right asymmetries in the embryonic midline. Some members of this subfamily are P5-like proteins containing only one redox active TRX domain.
Probab=21.07  E-value=96  Score=16.83  Aligned_cols=12  Identities=17%  Similarity=0.069  Sum_probs=9.2

Q ss_pred             CcccHHHHHHHH
Q psy10732         30 KPWTIKGLIEWL   41 (58)
Q Consensus        30 ~~~ti~~Li~~i   41 (58)
                      ++.+...|+.|+
T Consensus        91 g~~~~~~l~~~~  102 (103)
T cd03001          91 GGRTAKAIVSAA  102 (103)
T ss_pred             CCCCHHHHHHHh
Confidence            357888888886


No 98 
>PF12140 DUF3588:  Protein of unknown function (DUF3588);  InterPro: IPR021987  This family of proteins is found in eukaryotes. Proteins in this family are typically between 129 and 866 amino acids in length, and the family is found in association with PF02820 from PFAM. The exact function of this family is not known. 
Probab=21.05  E-value=1.3e+02  Score=18.84  Aligned_cols=23  Identities=26%  Similarity=0.458  Sum_probs=14.8

Q ss_pred             CeeeEEEecCCCCCcccHHHHHHHHH
Q psy10732         17 KVKNHDLDLPTGEKPWTIKGLIEWLK   42 (58)
Q Consensus        17 ~~k~h~v~l~~~~~~~ti~~Li~~i~   42 (58)
                      +.|.|.+.||.-.   +..++..|++
T Consensus        77 ~gk~~~~~lp~v~---s~~~v~~Fl~   99 (118)
T PF12140_consen   77 DGKTHTVKLPTVN---SASYVLRFLE   99 (118)
T ss_pred             cCeEEEEEecccc---cHHHHHHHHH
Confidence            5678999999543   4555555543


No 99 
>TIGR01307 pgm_bpd_ind 2,3-bisphosphoglycerate-independent phosphoglycerate mutase. This protein is about double in length of, and devoid of homology to the form of phosphoglycerate mutase that uses 2,3-bisphosphoglycerate as a cofactor.
Probab=21.05  E-value=3.5e+02  Score=20.80  Aligned_cols=53  Identities=19%  Similarity=0.255  Sum_probs=34.6

Q ss_pred             eEEEEeccchhhhcCCeeeEEEecCC----CCC-cccHHHHHHHHHHhccCCCCCcee
Q psy10732          2 KITVQFGGGAELLFGKVKNHDLDLPT----GEK-PWTIKGLIEWLKLNKLTERPELFV   54 (58)
Q Consensus         2 ~i~vEF~GGlElLF~~~k~h~v~l~~----~~~-~~ti~~Li~~i~~nll~er~elFv   54 (58)
                      .||.=|.||-|.-|.+..+.-+.-|.    +.. ..+-..+.+.+.+-+-++++++.+
T Consensus       329 HVTfFfnGg~e~~f~ge~r~lv~sp~v~tyd~~PeMsa~evtd~~i~~I~~~k~dfi~  386 (501)
T TIGR01307       329 HVTFFFNGGVEVPFAGETRTLIPSPKVATYDLQPEMSAKAVTDAVLEAIAQGKFDLIV  386 (501)
T ss_pred             eeeeeecCCccccCCCceeEEeCCCCCCccccCCccCHHHHHHHHHHHHhccCCCEEE
Confidence            36778999999999998887777662    111 244555555555555456777543


No 100
>PF14237 DUF4339:  Domain of unknown function (DUF4339)
Probab=20.86  E-value=1.2e+02  Score=15.09  Aligned_cols=19  Identities=11%  Similarity=0.389  Sum_probs=16.4

Q ss_pred             CcccHHHHHHHHHHhccCC
Q psy10732         30 KPWTIKGLIEWLKLNKLTE   48 (58)
Q Consensus        30 ~~~ti~~Li~~i~~nll~e   48 (58)
                      +|.+..+|.+.+++.-+..
T Consensus        12 GP~s~~el~~l~~~g~i~~   30 (45)
T PF14237_consen   12 GPFSLEELRQLISSGEIDP   30 (45)
T ss_pred             CCcCHHHHHHHHHcCCCCC
Confidence            6999999999999877754


No 101
>PF00610 DEP:  Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP);  InterPro: IPR000591 This entry represents the DEP (Dishevelled, Egl-10 and Pleckstrin) domain, a globular domain of about 80 residues that is found in over 50 proteins involved in G-protein signalling pathways. It was named after the three proteins it was initially found in:   Dishevelled (Dsh and Dvl), which play a key role in the transduction of the Wg/Wnt signal from the cell surface to the nucleus; it is a segment polarity protein required to establish coherent arrays of polarized cells and segments in embryos, and plays a role in wingless signalling. Egl-10, which regulates G-protein signalling in the central nervous system.  Pleckstrin, the major substrate of protein kinase C in platelets; Pleckstrin contains two PH domains flanking the DEP domain.   Mammalian regulators of G-protein signalling also contain these domains, and regulate signal transduction by increasing the GTPase activity of G-protein alpha subunits, thereby driving them into their inactive GDP-bound form. It has been proposed that the DEP domain could play a selective role in targeting DEP domain-containing proteins to specific subcellular membranous sites, perhaps even to specific G protein-coupled signaling pathways [, ]. Nuclear magnetic resonance spectroscopy has revealed that the DEP domain comprises a three-helix bundle, a beta-hairpin 'arm' composed of two beta-strands and two short beta-strands in the C-terminal region [].; GO: 0035556 intracellular signal transduction; PDB: 1UHW_A 1V3F_A 2YSR_A 2CSO_A 1W4M_A 2PBI_C 1O7F_A 2BYV_E 1FSH_A 3ML6_D ....
Probab=20.74  E-value=80  Score=16.88  Aligned_cols=16  Identities=25%  Similarity=0.345  Sum_probs=13.0

Q ss_pred             CcccHHHHHHHHHHhc
Q psy10732         30 KPWTIKGLIEWLKLNK   45 (58)
Q Consensus        30 ~~~ti~~Li~~i~~nl   45 (58)
                      ...+=+++++||.+|.
T Consensus        16 ~~F~G~e~v~WL~~~~   31 (74)
T PF00610_consen   16 NCFTGSEAVDWLMDNF   31 (74)
T ss_dssp             CEEEHHHHHHHHHHTS
T ss_pred             CEeEhHHHHHHHHHhc
Confidence            3477899999999865


No 102
>PTZ00273 oxidase reductase; Provisional
Probab=20.74  E-value=62  Score=22.44  Aligned_cols=39  Identities=18%  Similarity=0.125  Sum_probs=26.4

Q ss_pred             ccchhhhcCCeeeEEEecCCCCC--cccHHHHHHHHHHhccCC
Q psy10732          8 GGGAELLFGKVKNHDLDLPTGEK--PWTIKGLIEWLKLNKLTE   48 (58)
Q Consensus         8 ~GGlElLF~~~k~h~v~l~~~~~--~~ti~~Li~~i~~nll~e   48 (58)
                      .||||++-.+.+-..  +|...+  -++++++++.+....++.
T Consensus       214 ~~GLqV~~~~g~Wi~--V~p~pg~lvVNvGD~l~~~TnG~~kS  254 (320)
T PTZ00273        214 VGGLQVRNLSGEWMD--VPPLEGSFVVNIGDMMEMWSNGRYRS  254 (320)
T ss_pred             CCceEEECCCCCEEe--CCCCCCeEEEEHHHHHHHHHCCeeeC
Confidence            589998654444444  443222  589999999998766653


No 103
>smart00339 FH FORKHEAD. FORKHEAD, also known as a "winged helix"
Probab=20.73  E-value=1e+02  Score=17.92  Aligned_cols=18  Identities=22%  Similarity=0.457  Sum_probs=15.1

Q ss_pred             CCcccHHHHHHHHHHhcc
Q psy10732         29 EKPWTIKGLIEWLKLNKL   46 (58)
Q Consensus        29 ~~~~ti~~Li~~i~~nll   46 (58)
                      ++..|++++-.||.+|.=
T Consensus        19 ~~~ltl~~Iy~~I~~~~p   36 (89)
T smart00339       19 DKRLTLSEIYKWIEDNFP   36 (89)
T ss_pred             CCCeeHHHHHHHHHHhCc
Confidence            356999999999998864


No 104
>PRK11106 queuosine biosynthesis protein QueC; Provisional
Probab=20.71  E-value=67  Score=21.84  Aligned_cols=12  Identities=33%  Similarity=0.689  Sum_probs=10.3

Q ss_pred             eEEEEeccchhh
Q psy10732          2 KITVQFGGGAEL   13 (58)
Q Consensus         2 ~i~vEF~GGlEl   13 (58)
                      ++-|=||||+|.
T Consensus         3 kvvVl~SGG~DS   14 (231)
T PRK11106          3 RAVVVFSGGQDS   14 (231)
T ss_pred             cEEEEeeCcHHH
Confidence            577889999996


No 105
>cd08532 SAM_PNT-PDEF-like Sterile alpha motif (SAM)/Pointed domain of prostate-derived ETS factor. SAM Pointed domain of PDEF-like (Prostate-Derived ETS Factor) subfamily of ETS transcriptional regulators is a putative protein-protein interaction domain. In human males this activator is highly expressed in the prostate gland and enhances androgen-mediated activation of the PSA promoter though interaction with the DNA binding domain of androgen receptor. PDEF may play a role in prostate cancer development as well as in goblet cell formation and mucus production in the epithelial lining of respiratory and intestinal tracts.
Probab=20.70  E-value=75  Score=18.28  Aligned_cols=22  Identities=18%  Similarity=0.460  Sum_probs=16.8

Q ss_pred             EEecCCCCCcccHHHHHHHHHH
Q psy10732         22 DLDLPTGEKPWTIKGLIEWLKL   43 (58)
Q Consensus        22 ~v~l~~~~~~~ti~~Li~~i~~   43 (58)
                      .+.+|.+...||-.+..+||.-
T Consensus         3 ~L~ip~DP~~Ws~~~V~~WL~w   24 (76)
T cd08532           3 LLGISPDPYQWSPANVQKWLLW   24 (76)
T ss_pred             cCCCCCChhhcCHHHHHHHHHH
Confidence            4668865567999999998863


No 106
>COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only]
Probab=20.63  E-value=76  Score=18.46  Aligned_cols=19  Identities=11%  Similarity=0.331  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHhccCCCCCc
Q psy10732         34 IKGLIEWLKLNKLTERPEL   52 (58)
Q Consensus        34 i~~Li~~i~~nll~er~el   52 (58)
                      +.+|+.||..+++..+.++
T Consensus         1 ~~~lv~~ivk~lVd~Pd~v   19 (76)
T COG1837           1 MEELVEFIVKPLVDNPDDV   19 (76)
T ss_pred             CHhHHHHHHHHhcCCccce
Confidence            4689999999998765554


No 107
>cd01991 Asn_Synthase_B_C The C-terminal domain of Asparagine Synthase B. This domain is always found associated n-terminal amidotransferase domain. Family members that contain this domain catalyse the conversion of aspartate to asparagine. Asparagine synthetase B  catalyzes the assembly of asparagine from aspartate, Mg(2+)ATP, and glutamine. The three-dimensional architecture of the N-terminal domain of asparagine synthetase B is similar to that observed for glutamine phosphoribosylpyrophosphate amidotransferase while the molecular motif of the C-domain is reminiscent to that observed for GMP synthetase .
Probab=20.56  E-value=63  Score=21.02  Aligned_cols=12  Identities=25%  Similarity=0.506  Sum_probs=9.9

Q ss_pred             eEEEEeccchhh
Q psy10732          2 KITVQFGGGAEL   13 (58)
Q Consensus         2 ~i~vEF~GGlEl   13 (58)
                      +|-+-+|||+|.
T Consensus        17 ~v~~~LSGGlDS   28 (269)
T cd01991          17 PVGVLLSGGLDS   28 (269)
T ss_pred             ceEEeecccHHH
Confidence            466889999996


No 108
>cd01996 Alpha_ANH_like_III This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily  includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which  binds to Adenosine group.  This subfamily   of proteins is predicted to  bind ATP. This domain has  a strongly conserved motif SGGKD at the N terminus.
Probab=20.50  E-value=61  Score=19.49  Aligned_cols=14  Identities=14%  Similarity=0.425  Sum_probs=10.9

Q ss_pred             eEEEEeccchhhhc
Q psy10732          2 KITVQFGGGAELLF   15 (58)
Q Consensus         2 ~i~vEF~GGlElLF   15 (58)
                      ++-|=||||.|...
T Consensus         3 d~~v~lSGG~DSs~   16 (154)
T cd01996           3 DCIIGVSGGKDSSY   16 (154)
T ss_pred             CEEEECCCchhHHH
Confidence            35678999999864


No 109
>CHL00124 acpP acyl carrier protein; Validated
Probab=20.43  E-value=87  Score=17.13  Aligned_cols=34  Identities=21%  Similarity=0.435  Sum_probs=22.1

Q ss_pred             hhhcCCeeeEEEecCCC--CCcccHHHHHHHHHHhc
Q psy10732         12 ELLFGKVKNHDLDLPTG--EKPWTIKGLIEWLKLNK   45 (58)
Q Consensus        12 ElLF~~~k~h~v~l~~~--~~~~ti~~Li~~i~~nl   45 (58)
                      |++..=.+...+++|..  .+-.|++++++|+..++
T Consensus        44 eli~~le~~f~i~i~~~~~~~~~tv~~l~~~i~~~~   79 (82)
T CHL00124         44 ELVMAIEEKFDIEIPDEDAEKISTLQEAVDFISQKI   79 (82)
T ss_pred             HHHHHHHHHHCCccCHHHHHHcCCHHHHHHHHHHHh
Confidence            33444445566777731  23479999999998765


No 110
>PRK09583 mycothiol-dependent maleylpyruvate isomerase; Reviewed
Probab=20.43  E-value=85  Score=21.02  Aligned_cols=23  Identities=22%  Similarity=0.274  Sum_probs=17.1

Q ss_pred             EecCCCCCcccHHHHHHHHHHhc
Q psy10732         23 LDLPTGEKPWTIKGLIEWLKLNK   45 (58)
Q Consensus        23 v~l~~~~~~~ti~~Li~~i~~nl   45 (58)
                      +.-|.....||+++|+.++..|.
T Consensus        36 ~~~PTpcpgWtvr~lv~Hl~~~~   58 (241)
T PRK09583         36 VREPSLLPGWTRGHVLAHLARNA   58 (241)
T ss_pred             hcCCCCCCCCcHHHHHHHHHHhH
Confidence            44565455699999999998754


No 111
>PF00085 Thioredoxin:  Thioredoxin;  InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms. Thioredoxin serves as a general protein disulphide oxidoreductase. It interacts with a broad range of proteins by a redox mechanism based on reversible oxidation of two cysteine thiol groups to a disulphide, accompanied by the transfer of two electrons and two protons. The net result is the covalent interconversion of a disulphide and a dithiol. In the NADPH-dependent protein disulphide reduction, thioredoxin reductase (TR) catalyses the reduction of oxidised thioredoxin (trx) by NADPH using FAD and its redox-active disulphide; reduced thioredoxin then directly reduces the disulphide in the substrate protein [].  Thioredoxin is present in prokaryotes and eukaryotes and the sequence around the redox-active disulphide bond is well conserved. All thioredoxins contain a cis-proline located in a loop preceding beta-strand 4, which makes contact with the active site cysteines, and is important for stability and function []. Thioredoxin belongs to a structural family that includes glutaredoxin, glutathione peroxidase, bacterial protein disulphide isomerase DsbA, and the N-terminal domain of glutathione transferase []. Thioredoxins have a beta-alpha unit preceding the motif common to all these proteins.  A number of eukaryotic proteins contain domains evolutionary related to thioredoxin, most of them are protein disulphide isomerases (PDI). PDI (5.3.4.1 from EC) [, , ] is an endoplasmic reticulum multi-functional enzyme that catalyses the formation and rearrangement of disulphide bonds during protein folding []. All PDI contains two or three (ERp72) copies of the thioredoxin domain, each of which contributes to disulphide isomerase activity, but which are functionally non-equivalent []. Moreover, PDI exhibits chaperone-like activity towards proteins that contain no disulphide bonds, i.e. behaving independently of its disulphide isomerase activity []. The various forms of PDI which are currently known are:   PDI major isozyme; a multifunctional protein that also function as the beta subunit of prolyl 4-hydroxylase (1.14.11.2 from EC), as a component of oligosaccharyl transferase (2.4.1.119 from EC), as thyroxine deiodinase (3.8.1.4 from EC), as glutathione-insulin transhydrogenase (1.8.4.2 from EC) and as a thyroid hormone-binding protein ERp60 (ER-60; 58 Kd microsomal protein). ERp60 was originally thought to be a phosphoinositide-specific phospholipase C isozyme and later to be a protease. ERp72. ERp5.    Bacterial proteins that act as thiol:disulphide interchange proteins that allows disulphide bond formation in some periplasmic proteins also contain a thioredoxin domain. These proteins include:    Escherichia coli DsbA (or PrfA) and its orthologs in Vibrio cholerae (TtcpG) and Haemophilus influenzae (Por). E. coli DsbC (or XpRA) and its orthologues in Erwinia chrysanthemi and H. influenzae. E. coli DsbD (or DipZ) and its H. influenzae orthologue. E. coli DsbE (or CcmG) and orthologues in H. influenzae.  Rhodobacter capsulatus (Rhodopseudomonas capsulata) (HelX), Rhiziobiacae (CycY and TlpA).   This entry represents the thioredoxin domain.; GO: 0045454 cell redox homeostasis; PDB: 3ED3_B 1EP7_A 1EP8_B 1TOF_A 2OE3_B 2OE1_B 2OE0_B 1V98_A 3H79_A 3CXG_A ....
Probab=20.27  E-value=1.2e+02  Score=16.25  Aligned_cols=15  Identities=27%  Similarity=0.545  Sum_probs=12.2

Q ss_pred             CcccHHHHHHHHHHh
Q psy10732         30 KPWTIKGLIEWLKLN   44 (58)
Q Consensus        30 ~~~ti~~Li~~i~~n   44 (58)
                      ++.+..+|.+||++|
T Consensus        89 g~~~~~~l~~~i~~~  103 (103)
T PF00085_consen   89 GPRNAESLIEFIEKH  103 (103)
T ss_dssp             SSSSHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHcC
Confidence            347899999999875


No 112
>PLN02639 oxidoreductase, 2OG-Fe(II) oxygenase family protein
Probab=20.17  E-value=62  Score=22.79  Aligned_cols=37  Identities=14%  Similarity=0.082  Sum_probs=25.1

Q ss_pred             ccchhhhcCCeeeEEEecCCCCC--cccHHHHHHHHHHhccC
Q psy10732          8 GGGAELLFGKVKNHDLDLPTGEK--PWTIKGLIEWLKLNKLT   47 (58)
Q Consensus         8 ~GGlElLF~~~k~h~v~l~~~~~--~~ti~~Li~~i~~nll~   47 (58)
                      .||||++ .+.+-  +.+|...+  -++++|+++.+....++
T Consensus       227 v~GLQV~-~~g~W--i~V~p~pg~lVVNiGD~L~~~TNG~~k  265 (337)
T PLN02639        227 VAGLQVL-KDGKW--VAVNPHPGAFVINIGDQLQALSNGRYK  265 (337)
T ss_pred             cCceEee-cCCeE--EeccCCCCeEEEechhHHHHHhCCeee
Confidence            4899997 44444  44443222  68999999998876664


No 113
>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase. PAPS reductase is part of the adenine nucleotide alpha hydrolases superfamily also including N type ATP PPases and ATP sulphurylases. A highly modified version of the P loop, the fingerprint peptide of mononucleotide-binding proteins, is present in the active site of the protein, which appears to be a positively charged cleft containing a number of conserved arginine and lysine residues. Although PAPS reductase has no ATPase activity, it shows a striking similarity to the structure of the ATP pyrophosphatase (ATP PPase) domain of GMP synthetase, indicating that both enzyme families have evolved from a common ancestral nucleotide-binding fold.   The enzyme uses thioredoxin as an electron donor for the reduction of PAPS to phospho-adenosine-phosphate (PAP) . It is also found in NodP nodulation protein P from Rhizobium meliloti which has ATP sulphurylase acti
Probab=20.14  E-value=70  Score=18.73  Aligned_cols=13  Identities=31%  Similarity=0.693  Sum_probs=9.7

Q ss_pred             eEEEEeccchhhh
Q psy10732          2 KITVQFGGGAELL   14 (58)
Q Consensus         2 ~i~vEF~GGlElL   14 (58)
                      +|-|-||||.|..
T Consensus         1 ~i~v~~SGGkDS~   13 (173)
T cd01713           1 NVVVSFSGGKDST   13 (173)
T ss_pred             CeEEEecCChHHH
Confidence            3567899998863


No 114
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS). ACT_AHAS: N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS). AHAS catalyses the first common step in the biosynthesis of the three branched-chain amino acids. The first step involves the condensation of either pyruvate or 2-ketobutyrate with the two-carbon hydroxyethyl fragment derived from another pyruvate molecule, covalently bound to the coenzyme thiamine diphosphate. Bacterial AHASs generally consist of regulatory and catalytic subunits. The effector (valine) binding sites are proposed to be located in two symmetrically related positions in the interface between a pair of N-terminal ACT domains with the C-terminal domain of IlvH contacting the catalytic dimer. Plants Arabidopsis and Oryza have tandem IlvH subunits; both the first and second ACT domain sequences are present in this CD. Members of
Probab=20.10  E-value=90  Score=15.48  Aligned_cols=24  Identities=13%  Similarity=0.234  Sum_probs=15.3

Q ss_pred             EEEecCCCCCcccHHHHHHHHHHh
Q psy10732         21 HDLDLPTGEKPWTIKGLIEWLKLN   44 (58)
Q Consensus        21 h~v~l~~~~~~~ti~~Li~~i~~n   44 (58)
                      |.+.+...+.|-.+.++..++.++
T Consensus         1 ~~l~i~~~d~~g~l~~i~~~l~~~   24 (72)
T cd04878           1 HTLSVLVENEPGVLNRISGLFARR   24 (72)
T ss_pred             CEEEEEEcCCCcHHHHHHHHHHhC
Confidence            445544333455688999988776


Done!