BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy10759
         (162 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1T5O|A Chain A, Crystal Structure Of The Translation Initiation Factor
           Eif-2b, Subunit Delta, From A. Fulgidus
 pdb|1T5O|B Chain B, Crystal Structure Of The Translation Initiation Factor
           Eif-2b, Subunit Delta, From A. Fulgidus
 pdb|1T5O|C Chain C, Crystal Structure Of The Translation Initiation Factor
           Eif-2b, Subunit Delta, From A. Fulgidus
 pdb|1T5O|D Chain D, Crystal Structure Of The Translation Initiation Factor
           Eif-2b, Subunit Delta, From A. Fulgidus
          Length = 351

 Score = 28.1 bits (61), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 4/48 (8%)

Query: 95  SMINVLLQDSDTVSQHGLFFGYDGLVLTDVLFNALGGLIISLVLKHHD 142
           SM+ +++Q         +  G D +V  D +FN +G   +S+V KHH+
Sbjct: 215 SMVGIVMQKGMV---DKVIVGADRIV-RDAVFNKIGTYTVSVVAKHHN 258


>pdb|1UF2|A Chain A, The Atomic Structure Of Rice Dwarf Virus (Rdv)
 pdb|1UF2|B Chain B, The Atomic Structure Of Rice Dwarf Virus (Rdv)
          Length = 1019

 Score = 28.1 bits (61), Expect = 2.5,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 24/43 (55%)

Query: 33  SASESISRKSDNGNQLIGFGQVILASVSSGFTSVYLERIYKAD 75
           S +  +SR  D    L+G  + ILA+  +   +VY + +Y+AD
Sbjct: 583 SNTALLSRFLDATPNLLGIYEAILANTYANAVNVYCDSVYRAD 625


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.138    0.385 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,693,056
Number of Sequences: 62578
Number of extensions: 111616
Number of successful extensions: 217
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 214
Number of HSP's gapped (non-prelim): 4
length of query: 162
length of database: 14,973,337
effective HSP length: 91
effective length of query: 71
effective length of database: 9,278,739
effective search space: 658790469
effective search space used: 658790469
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)