BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy10759
(162 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1T5O|A Chain A, Crystal Structure Of The Translation Initiation Factor
Eif-2b, Subunit Delta, From A. Fulgidus
pdb|1T5O|B Chain B, Crystal Structure Of The Translation Initiation Factor
Eif-2b, Subunit Delta, From A. Fulgidus
pdb|1T5O|C Chain C, Crystal Structure Of The Translation Initiation Factor
Eif-2b, Subunit Delta, From A. Fulgidus
pdb|1T5O|D Chain D, Crystal Structure Of The Translation Initiation Factor
Eif-2b, Subunit Delta, From A. Fulgidus
Length = 351
Score = 28.1 bits (61), Expect = 2.0, Method: Compositional matrix adjust.
Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 4/48 (8%)
Query: 95 SMINVLLQDSDTVSQHGLFFGYDGLVLTDVLFNALGGLIISLVLKHHD 142
SM+ +++Q + G D +V D +FN +G +S+V KHH+
Sbjct: 215 SMVGIVMQKGMV---DKVIVGADRIV-RDAVFNKIGTYTVSVVAKHHN 258
>pdb|1UF2|A Chain A, The Atomic Structure Of Rice Dwarf Virus (Rdv)
pdb|1UF2|B Chain B, The Atomic Structure Of Rice Dwarf Virus (Rdv)
Length = 1019
Score = 28.1 bits (61), Expect = 2.5, Method: Composition-based stats.
Identities = 14/43 (32%), Positives = 24/43 (55%)
Query: 33 SASESISRKSDNGNQLIGFGQVILASVSSGFTSVYLERIYKAD 75
S + +SR D L+G + ILA+ + +VY + +Y+AD
Sbjct: 583 SNTALLSRFLDATPNLLGIYEAILANTYANAVNVYCDSVYRAD 625
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.138 0.385
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,693,056
Number of Sequences: 62578
Number of extensions: 111616
Number of successful extensions: 217
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 214
Number of HSP's gapped (non-prelim): 4
length of query: 162
length of database: 14,973,337
effective HSP length: 91
effective length of query: 71
effective length of database: 9,278,739
effective search space: 658790469
effective search space used: 658790469
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)