Query         psy10762
Match_columns 126
No_of_seqs    123 out of 2490
Neff          11.6
Searched_HMMs 46136
Date          Fri Aug 16 17:52:39 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10762.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10762hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 1.2E-30 2.5E-35  156.1   6.1  107    6-114   159-265 (279)
  2 KOG2462|consensus              100.0 2.3E-30   5E-35  154.9   6.2  117    6-124   128-247 (279)
  3 KOG3576|consensus               99.8 1.2E-21 2.6E-26  113.2   3.0  113    5-117   114-237 (267)
  4 KOG1074|consensus               99.8 9.5E-22 2.1E-26  132.5   1.1   51   66-116   607-657 (958)
  5 KOG1074|consensus               99.8 1.4E-19 3.1E-24  122.2   2.0   52   66-117   881-932 (958)
  6 KOG3623|consensus               99.7 1.2E-18 2.6E-23  116.6   2.3  106    9-114   211-331 (1007)
  7 KOG3608|consensus               99.7 2.2E-17 4.8E-22  102.8   5.5   79   37-116   264-345 (467)
  8 KOG3623|consensus               99.7 3.4E-18 7.3E-23  114.5   1.5   80   34-113   892-971 (1007)
  9 KOG3576|consensus               99.7 6.2E-18 1.3E-22   98.0   0.9   81   34-114   115-195 (267)
 10 KOG3608|consensus               99.6 2.4E-16 5.2E-21   98.2   5.3  113    2-116   201-316 (467)
 11 PLN03086 PRLI-interacting fact  99.5   7E-14 1.5E-18   93.3   8.0  103    6-115   451-563 (567)
 12 PHA00733 hypothetical protein   99.5 5.9E-14 1.3E-18   77.9   5.0  112    4-117     7-124 (128)
 13 PHA02768 hypothetical protein;  99.3 2.2E-12 4.9E-17   60.2   1.7   44   64-109     5-48  (55)
 14 PHA00733 hypothetical protein   99.3   1E-11 2.3E-16   68.9   4.3   82    6-89     38-124 (128)
 15 PLN03086 PRLI-interacting fact  99.1 1.7E-10 3.6E-15   77.5   5.3  101    9-115   408-537 (567)
 16 PHA02768 hypothetical protein;  99.1 1.1E-10 2.3E-15   54.6   2.1   39    9-49      6-44  (55)
 17 PF13465 zf-H2C2_2:  Zinc-finge  99.1 1.3E-10 2.9E-15   46.7   2.1   25   79-103     1-25  (26)
 18 PF13465 zf-H2C2_2:  Zinc-finge  98.9 1.3E-09 2.9E-14   43.7   1.9   24   52-75      2-25  (26)
 19 KOG3993|consensus               98.8   1E-09 2.2E-14   70.5   1.4  114    8-121   295-487 (500)
 20 KOG3993|consensus               98.8 8.9E-10 1.9E-14   70.8   0.5   27   91-117   355-381 (500)
 21 PHA00616 hypothetical protein   98.8 2.5E-09 5.3E-14   47.7   1.7   29   92-120     1-29  (44)
 22 PHA00616 hypothetical protein   98.7 1.4E-08   3E-13   45.3   1.7   33    8-40      1-33  (44)
 23 PHA00732 hypothetical protein   98.7 2.3E-08 4.9E-13   50.9   2.6   45   36-86      1-46  (79)
 24 PF05605 zf-Di19:  Drought indu  98.7 8.6E-08 1.9E-12   45.4   4.4   50   64-116     2-53  (54)
 25 PF00096 zf-C2H2:  Zinc finger,  98.6 2.9E-08 6.2E-13   38.7   2.0   23   93-115     1-23  (23)
 26 PF13894 zf-C2H2_4:  C2H2-type   98.4 3.1E-07 6.8E-12   35.9   2.2   24   93-116     1-24  (24)
 27 PHA00732 hypothetical protein   98.4 3.4E-07 7.3E-12   46.6   2.7   46    8-59      1-47  (79)
 28 PF12756 zf-C2H2_2:  C2H2 type   98.3 5.6E-07 1.2E-11   47.9   2.5   23   92-114    50-72  (100)
 29 PF00096 zf-C2H2:  Zinc finger,  98.3 7.8E-07 1.7E-11   34.5   2.2   23    9-31      1-23  (23)
 30 PF13912 zf-C2H2_6:  C2H2-type   98.3 4.7E-07   1E-11   36.5   1.5   25   92-116     1-25  (27)
 31 PF05605 zf-Di19:  Drought indu  98.3   3E-06 6.5E-11   40.1   4.2   48    9-59      3-52  (54)
 32 PF09237 GAGA:  GAGA factor;  I  98.0 3.7E-06   8E-11   38.4   1.8   33   88-120    20-52  (54)
 33 PF13912 zf-C2H2_6:  C2H2-type   98.0 5.1E-06 1.1E-10   33.4   1.9   25    8-32      1-25  (27)
 34 COG5189 SFP1 Putative transcri  98.0 1.4E-06 3.1E-11   54.7   0.1   52   62-113   347-419 (423)
 35 smart00355 ZnF_C2H2 zinc finge  98.0 8.3E-06 1.8E-10   32.2   2.3   24   93-116     1-24  (26)
 36 PF13894 zf-C2H2_4:  C2H2-type   98.0 9.7E-06 2.1E-10   31.4   2.4   23    9-31      1-23  (24)
 37 PF12756 zf-C2H2_2:  C2H2 type   97.7 3.6E-05 7.7E-10   40.9   2.7   74   10-88      1-74  (100)
 38 PF12874 zf-met:  Zinc-finger o  97.7 2.3E-05   5E-10   30.8   1.5   23   93-115     1-23  (25)
 39 COG5189 SFP1 Putative transcri  97.7 1.1E-05 2.4E-10   50.9   0.1   69    6-84    347-418 (423)
 40 PF13909 zf-H2C2_5:  C2H2-type   97.6 7.3E-05 1.6E-09   29.1   2.0   23   93-116     1-23  (24)
 41 PRK04860 hypothetical protein;  97.6 5.6E-05 1.2E-09   43.8   2.1   38   64-105   119-156 (160)
 42 PF09237 GAGA:  GAGA factor;  I  97.5 0.00021 4.5E-09   32.8   3.2   32   33-64     21-52  (54)
 43 smart00355 ZnF_C2H2 zinc finge  97.5 0.00012 2.7E-09   28.6   2.0   23    9-31      1-23  (26)
 44 PF12874 zf-met:  Zinc-finger o  97.3  0.0002 4.3E-09   28.1   1.8   22    9-30      1-22  (25)
 45 PF12171 zf-C2H2_jaz:  Zinc-fin  97.2 8.9E-05 1.9E-09   29.7   0.0   22   93-114     2-23  (27)
 46 PRK04860 hypothetical protein;  97.0 0.00067 1.4E-08   39.4   2.5   38   36-77    119-156 (160)
 47 PF13913 zf-C2HC_2:  zinc-finge  96.9  0.0012 2.6E-08   25.9   2.1   21   93-114     3-23  (25)
 48 PF13909 zf-H2C2_5:  C2H2-type   96.7  0.0022 4.8E-08   24.7   2.1   21    9-30      1-21  (24)
 49 PF12171 zf-C2H2_jaz:  Zinc-fin  96.5  0.0008 1.7E-08   26.9   0.1   22    9-30      2-23  (27)
 50 smart00451 ZnF_U1 U1-like zinc  96.2  0.0046 9.9E-08   26.1   1.7   23   92-114     3-25  (35)
 51 COG4049 Uncharacterized protei  96.1  0.0038 8.2E-08   29.2   1.4   28   89-116    14-41  (65)
 52 KOG4173|consensus               96.0  0.0031 6.7E-08   37.7   1.1   76   36-114    79-168 (253)
 53 cd00350 rubredoxin_like Rubred  95.8  0.0063 1.4E-07   25.6   1.2    8   92-99     17-24  (33)
 54 smart00451 ZnF_U1 U1-like zinc  95.6   0.015 3.2E-07   24.5   2.1   22    8-29      3-24  (35)
 55 KOG2231|consensus               95.5   0.052 1.1E-06   38.5   5.4   97   17-116   123-236 (669)
 56 KOG2893|consensus               95.0  0.0048   1E-07   37.9  -0.5   46   67-116    13-59  (341)
 57 KOG2785|consensus               94.9    0.16 3.5E-06   33.5   6.0   50   65-114   167-242 (390)
 58 TIGR00622 ssl1 transcription f  94.9   0.064 1.4E-06   29.2   3.5   48   67-116    58-105 (112)
 59 COG5048 FOG: Zn-finger [Genera  94.5  0.0062 1.3E-07   40.5  -1.1   58   64-121   289-352 (467)
 60 PF10571 UPF0547:  Uncharacteri  94.5   0.027 5.8E-07   22.3   1.2   10   94-103    16-25  (26)
 61 KOG1146|consensus               94.5    0.01 2.3E-07   44.6  -0.0   75   31-114   460-540 (1406)
 62 COG4049 Uncharacterized protei  94.2   0.034 7.3E-07   26.1   1.4   27    4-30     13-39  (65)
 63 KOG1146|consensus               94.2  0.0076 1.7E-07   45.3  -1.2  103    9-116  1229-1352(1406)
 64 COG2888 Predicted Zn-ribbon RN  93.9   0.056 1.2E-06   25.8   1.8   11   90-100    48-58  (61)
 65 PF13719 zinc_ribbon_5:  zinc-r  93.7    0.05 1.1E-06   23.5   1.4   32   66-102     4-35  (37)
 66 PF13717 zinc_ribbon_4:  zinc-r  93.5   0.061 1.3E-06   23.0   1.5   32   66-102     4-35  (36)
 67 KOG2186|consensus               93.5   0.052 1.1E-06   33.8   1.6   48   36-86      3-50  (276)
 68 COG5236 Uncharacterized conser  93.4    0.11 2.4E-06   34.0   3.1   74   38-116   222-305 (493)
 69 PF06524 NOA36:  NOA36 protein;  93.4   0.034 7.4E-07   34.7   0.7   42    2-44    136-179 (314)
 70 PF09538 FYDLN_acid:  Protein o  93.0   0.062 1.3E-06   29.2   1.3   12    9-20     10-21  (108)
 71 TIGR02098 MJ0042_CXXC MJ0042 f  92.7   0.073 1.6E-06   22.9   1.1   10   93-102    26-35  (38)
 72 PF09986 DUF2225:  Uncharacteri  92.6   0.019   4E-07   35.2  -1.1   44    6-49      3-61  (214)
 73 PF12013 DUF3505:  Protein of u  92.6    0.42 9.1E-06   25.9   4.2   26   92-117    80-109 (109)
 74 cd00729 rubredoxin_SM Rubredox  92.4   0.091   2E-06   22.2   1.2    9   65-73      3-11  (34)
 75 TIGR00622 ssl1 transcription f  92.2    0.32   7E-06   26.6   3.4   86    6-99     13-110 (112)
 76 COG5048 FOG: Zn-finger [Genera  92.1   0.043 9.2E-07   36.6   0.0   57   37-93    290-352 (467)
 77 KOG2231|consensus               92.1    0.22 4.7E-06   35.6   3.3   74   39-116   118-206 (669)
 78 smart00659 RPOLCX RNA polymera  92.0    0.14 3.1E-06   23.0   1.6   29    8-47      2-30  (44)
 79 TIGR00373 conserved hypothetic  92.0    0.17 3.6E-06   29.6   2.3   33   61-102   106-138 (158)
 80 TIGR02605 CxxC_CxxC_SSSS putat  91.8    0.05 1.1E-06   25.3   0.0   12    9-20      6-17  (52)
 81 TIGR00373 conserved hypothetic  91.8    0.21 4.5E-06   29.2   2.6   37   30-75    103-139 (158)
 82 PRK14890 putative Zn-ribbon RN  91.6    0.18 3.9E-06   24.1   1.8   10   91-100    47-56  (59)
 83 PF12013 DUF3505:  Protein of u  91.5    0.18 3.9E-06   27.4   2.0   26   64-89     80-109 (109)
 84 COG5236 Uncharacterized conser  90.7    0.61 1.3E-05   30.7   4.1   48   66-114   222-273 (493)
 85 PRK06266 transcription initiat  90.6    0.21 4.6E-06   29.7   1.9   33   62-103   115-147 (178)
 86 PRK00464 nrdR transcriptional   90.4   0.059 1.3E-06   31.2  -0.5   13   65-77     29-41  (154)
 87 smart00531 TFIIE Transcription  90.2    0.55 1.2E-05   27.0   3.3   38   61-102    96-133 (147)
 88 COG1592 Rubrerythrin [Energy p  90.1    0.23   5E-06   29.2   1.7   23   64-99    134-156 (166)
 89 KOG4173|consensus               90.1    0.14 3.1E-06   30.9   0.9   75    8-85     79-167 (253)
 90 PRK00398 rpoP DNA-directed RNA  90.1    0.14 2.9E-06   23.2   0.6   11   64-74      3-13  (46)
 91 KOG2186|consensus               90.0    0.29 6.2E-06   30.6   2.1   48    8-58      3-50  (276)
 92 PRK06266 transcription initiat  89.8    0.37 8.1E-06   28.7   2.5   35   33-76    114-148 (178)
 93 smart00834 CxxC_CXXC_SSSS Puta  89.7   0.097 2.1E-06   22.8  -0.0   11    9-19      6-16  (41)
 94 PF05443 ROS_MUCR:  ROS/MUCR tr  89.5    0.27 5.9E-06   27.8   1.6   26   90-118    70-95  (132)
 95 PF02892 zf-BED:  BED zinc fing  89.5    0.43 9.4E-06   21.2   2.1   24   90-113    14-41  (45)
 96 PF02176 zf-TRAF:  TRAF-type zi  88.9    0.26 5.6E-06   23.5   1.1   26   79-104    25-54  (60)
 97 TIGR02300 FYDLN_acid conserved  88.4    0.31 6.8E-06   27.2   1.4   31    8-49      9-39  (129)
 98 smart00614 ZnF_BED BED zinc fi  87.8    0.41 8.8E-06   22.0   1.4   20   94-113    20-44  (50)
 99 smart00734 ZnF_Rad18 Rad18-lik  87.2    0.73 1.6E-05   18.1   1.8   19   94-113     3-21  (26)
100 PRK04023 DNA polymerase II lar  87.0    0.83 1.8E-05   34.4   3.1   10   92-101   663-672 (1121)
101 PF07800 DUF1644:  Protein of u  86.4     4.8 0.00011   23.6   5.5  104   14-122    32-139 (162)
102 KOG3408|consensus               86.0     0.5 1.1E-05   26.1   1.2   26   89-114    54-79  (129)
103 smart00440 ZnF_C2C2 C2C2 Zinc   85.6   0.077 1.7E-06   23.3  -1.6   12   92-103    28-39  (40)
104 PF14353 CpXC:  CpXC protein     85.6    0.73 1.6E-05   25.8   1.9   16   65-80     39-54  (128)
105 PF03604 DNA_RNApol_7kD:  DNA d  84.8    0.41 8.9E-06   19.9   0.5   27    9-46      1-27  (32)
106 COG4957 Predicted transcriptio  84.2    0.52 1.1E-05   26.6   0.8   23   93-118    77-99  (148)
107 COG1997 RPL43A Ribosomal prote  83.5    0.81 1.7E-05   23.8   1.3   12   92-103    53-64  (89)
108 PF04959 ARS2:  Arsenite-resist  83.3    0.82 1.8E-05   28.1   1.5   29   90-118    75-103 (214)
109 COG1198 PriA Primosomal protei  83.2     0.5 1.1E-05   34.4   0.6   12   62-73    473-484 (730)
110 PHA00626 hypothetical protein   82.1    0.71 1.5E-05   21.8   0.7   16   90-105    21-36  (59)
111 PF08790 zf-LYAR:  LYAR-type C2  81.6    0.41 8.8E-06   19.3  -0.1   19    9-28      1-19  (28)
112 PTZ00448 hypothetical protein;  81.4     1.6 3.5E-05   29.1   2.4   34   92-125   314-352 (373)
113 PF08274 PhnA_Zn_Ribbon:  PhnA   81.1    0.55 1.2E-05   19.2   0.2    8   36-43     19-26  (30)
114 PRK03824 hypA hydrogenase nick  80.9    0.71 1.5E-05   26.2   0.6   13    8-20     70-82  (135)
115 KOG2482|consensus               80.9     2.4 5.2E-05   28.1   2.9   50   65-114   280-356 (423)
116 PF15135 UPF0515:  Uncharacteri  80.3     1.8 3.9E-05   27.2   2.2   13    6-18    110-122 (278)
117 PF12907 zf-met2:  Zinc-binding  80.3     1.5 3.3E-05   19.3   1.4   33   93-125     2-38  (40)
118 PF15269 zf-C2H2_7:  Zinc-finge  79.5     1.7 3.6E-05   19.5   1.4   22   93-114    21-42  (54)
119 PF13451 zf-trcl:  Probable zin  79.4     1.6 3.5E-05   20.1   1.4   17    7-23      3-19  (49)
120 PRK09678 DNA-binding transcrip  79.4    0.62 1.3E-05   23.4   0.1    8   38-45      3-10  (72)
121 smart00661 RPOL9 RNA polymeras  79.2     1.5 3.3E-05   20.1   1.4   11   92-102    20-30  (52)
122 KOG2785|consensus               78.6     3.2 6.9E-05   27.9   3.0   27    7-33    165-191 (390)
123 PF07754 DUF1610:  Domain of un  78.6    0.86 1.9E-05   17.6   0.3    8   92-99     16-23  (24)
124 COG3357 Predicted transcriptio  78.0     1.7 3.6E-05   22.8   1.4   13   64-76     58-70  (97)
125 PRK00432 30S ribosomal protein  77.4     1.4 3.1E-05   20.4   0.9   11   91-101    36-46  (50)
126 KOG2893|consensus               77.2    0.69 1.5E-05   28.8  -0.2   43    9-55     11-53  (341)
127 COG3677 Transposase and inacti  77.2    0.72 1.6E-05   26.0  -0.1   13   64-76     53-65  (129)
128 PF12760 Zn_Tnp_IS1595:  Transp  77.1     2.7 5.9E-05   18.9   1.8   11   90-100    35-45  (46)
129 PF13453 zf-TFIIB:  Transcripti  76.8     1.1 2.3E-05   19.7   0.4   15   38-52     21-35  (41)
130 KOG2907|consensus               76.5     1.2 2.6E-05   24.3   0.6   39   65-104    75-114 (116)
131 COG1996 RPC10 DNA-directed RNA  76.4     1.8 3.8E-05   20.0   1.1   12    7-18      5-16  (49)
132 PF09723 Zn-ribbon_8:  Zinc rib  76.3     1.3 2.8E-05   19.6   0.6   29    9-44      6-34  (42)
133 PF13878 zf-C2H2_3:  zinc-finge  75.1     3.9 8.4E-05   18.0   2.0   24    9-32     14-39  (41)
134 COG4888 Uncharacterized Zn rib  74.1    0.61 1.3E-05   24.9  -0.8   10   93-102    47-56  (104)
135 COG1571 Predicted DNA-binding   74.0     2.5 5.4E-05   28.8   1.7   14   92-105   367-380 (421)
136 PF04959 ARS2:  Arsenite-resist  73.6     1.3 2.9E-05   27.3   0.4   27   36-62     77-103 (214)
137 PF04423 Rad50_zn_hook:  Rad50   73.5     3.2 6.9E-05   19.4   1.6   12   94-105    22-33  (54)
138 KOG2807|consensus               73.3     8.8 0.00019   25.4   3.9   26   91-116   344-369 (378)
139 COG3091 SprT Zn-dependent meta  73.2     1.5 3.2E-05   25.4   0.5   33   64-101   117-149 (156)
140 KOG2071|consensus               73.2     2.2 4.7E-05   30.3   1.3   32   90-121   416-447 (579)
141 PF03811 Zn_Tnp_IS1:  InsA N-te  73.0    0.72 1.6E-05   19.8  -0.6   18   81-98     18-35  (36)
142 PF01096 TFIIS_C:  Transcriptio  72.8   0.046   1E-06   23.9  -4.5   10   93-102    29-38  (39)
143 KOG2482|consensus               72.5     3.8 8.2E-05   27.2   2.2   23   92-114   195-217 (423)
144 PF09845 DUF2072:  Zn-ribbon co  72.4     1.9 4.2E-05   24.3   0.8   13   65-77      2-14  (131)
145 KOG4167|consensus               72.2       1 2.2E-05   32.7  -0.3   27    7-33    791-817 (907)
146 PRK03564 formate dehydrogenase  72.2       1 2.2E-05   29.4  -0.3   75    8-104   187-264 (309)
147 COG2331 Uncharacterized protei  72.1     2.3   5E-05   21.5   1.0   31    8-45     12-42  (82)
148 TIGR00686 phnA alkylphosphonat  71.6     1.9 4.2E-05   23.4   0.7   12   92-103    19-30  (109)
149 KOG1842|consensus               71.3     2.8   6E-05   28.8   1.4   25   92-116    15-39  (505)
150 PHA02998 RNA polymerase subuni  71.0    0.69 1.5E-05   27.5  -1.2   41   65-105   144-184 (195)
151 KOG3408|consensus               70.7     3.5 7.7E-05   22.9   1.6   26    5-30     54-79  (129)
152 PTZ00255 60S ribosomal protein  70.5     1.8 3.9E-05   22.8   0.4   11   64-74     54-64  (90)
153 PF10013 DUF2256:  Uncharacteri  70.4     3.2   7E-05   18.4   1.1   16   94-109    10-25  (42)
154 TIGR00100 hypA hydrogenase nic  70.2     2.5 5.5E-05   23.3   1.0   12   37-48     71-82  (115)
155 COG1656 Uncharacterized conser  69.9       8 0.00017   22.9   2.9   43   66-110    99-148 (165)
156 PRK10220 hypothetical protein;  69.9     2.6 5.7E-05   22.9   0.9   11   93-103    21-31  (111)
157 PRK14714 DNA polymerase II lar  69.7     6.8 0.00015   30.8   3.2   12   64-75    692-703 (1337)
158 COG1594 RPB9 DNA-directed RNA   69.7    0.96 2.1E-05   24.9  -0.7   13   91-103    99-111 (113)
159 KOG2636|consensus               69.0     7.2 0.00016   26.9   3.0   29   84-112   393-422 (497)
160 TIGR01206 lysW lysine biosynth  68.5     2.1 4.6E-05   20.2   0.4    9   38-46      4-12  (54)
161 PF07282 OrfB_Zn_ribbon:  Putat  68.5     3.8 8.2E-05   20.1   1.3   12   91-102    45-56  (69)
162 PRK12380 hydrogenase nickel in  68.4     3.2   7E-05   22.8   1.1   11   37-47     71-81  (113)
163 PRK14873 primosome assembly pr  68.0     1.7 3.7E-05   31.5   0.0   47   10-73    385-431 (665)
164 KOG0717|consensus               67.8     3.4 7.3E-05   28.6   1.3   22   93-114   293-314 (508)
165 COG1655 Uncharacterized protei  66.9    0.94   2E-05   28.1  -1.2   23    6-28     17-39  (267)
166 PF05290 Baculo_IE-1:  Baculovi  66.6     5.6 0.00012   22.6   1.8   13   94-106   123-135 (140)
167 PF05191 ADK_lid:  Adenylate ki  66.0     1.9 4.1E-05   18.4  -0.0   10   10-19      3-12  (36)
168 TIGR00280 L37a ribosomal prote  65.3       2 4.3E-05   22.6  -0.1   11   64-74     53-63  (91)
169 PF01780 Ribosomal_L37ae:  Ribo  65.0     1.5 3.3E-05   23.0  -0.5   10   93-102    54-63  (90)
170 TIGR00595 priA primosomal prot  64.7     2.5 5.4E-05   29.7   0.3   34   10-44    215-248 (505)
171 smart00154 ZnF_AN1 AN1-like Zi  64.5     3.7   8E-05   17.8   0.7   14    8-21     12-25  (39)
172 KOG2593|consensus               64.3     6.3 0.00014   27.0   2.0   12    9-20    129-140 (436)
173 COG4338 Uncharacterized protei  64.0     2.8 6.2E-05   19.1   0.3   17   94-110    14-30  (54)
174 PF04780 DUF629:  Protein of un  63.5     6.8 0.00015   27.3   2.1   23   92-114    57-79  (466)
175 KOG1280|consensus               62.4      11 0.00023   25.2   2.7   38    6-43     77-116 (381)
176 KOG1280|consensus               62.1     9.5 0.00021   25.4   2.5   37   64-100    79-117 (381)
177 COG1326 Uncharacterized archae  61.9     8.4 0.00018   23.4   2.1   11   92-102    30-40  (201)
178 COG1675 TFA1 Transcription ini  61.2      12 0.00026   22.5   2.6   33   61-102   110-142 (176)
179 PRK03976 rpl37ae 50S ribosomal  60.1     2.6 5.7E-05   22.2  -0.2   11   64-74     54-64  (90)
180 KOG2593|consensus               60.0     8.7 0.00019   26.4   2.1   38   60-101   124-162 (436)
181 COG4530 Uncharacterized protei  59.9     6.3 0.00014   21.5   1.2   11   64-74     26-36  (129)
182 COG1773 Rubredoxin [Energy pro  59.7     3.9 8.4E-05   19.4   0.4   12   92-103     3-14  (55)
183 COG3364 Zn-ribbon containing p  59.6     3.6 7.8E-05   22.1   0.3   13   64-76      2-14  (112)
184 PRK04351 hypothetical protein;  59.6     3.1 6.7E-05   24.2   0.0   32   64-103   112-143 (149)
185 COG5188 PRP9 Splicing factor 3  59.2      20 0.00043   24.2   3.5   30   84-113   366-396 (470)
186 PRK00564 hypA hydrogenase nick  58.7       6 0.00013   21.9   1.1   11   37-47     72-82  (117)
187 COG1998 RPS31 Ribosomal protei  58.5     4.7  0.0001   18.6   0.5   10   92-101    37-46  (51)
188 PF06397 Desulfoferrod_N:  Desu  58.4       5 0.00011   17.2   0.6   12    7-18      5-16  (36)
189 PF10263 SprT-like:  SprT-like   58.4     2.6 5.6E-05   24.3  -0.4   32   64-103   123-154 (157)
190 PF01428 zf-AN1:  AN1-like Zinc  58.3     4.6  0.0001   17.9   0.5   15    7-21     12-26  (43)
191 PF01155 HypA:  Hydrogenase exp  57.6     4.7  0.0001   22.2   0.5   11   37-47     71-81  (113)
192 TIGR01562 FdhE formate dehydro  55.9     3.4 7.3E-05   27.0  -0.2   13   91-103   251-263 (305)
193 PRK03681 hypA hydrogenase nick  55.6     4.7  0.0001   22.2   0.3   11   37-47     71-81  (114)
194 PLN02294 cytochrome c oxidase   55.3     5.8 0.00013   23.5   0.7   16   89-104   138-153 (174)
195 KOG4167|consensus               55.0     3.3 7.2E-05   30.3  -0.4   26   92-117   792-817 (907)
196 COG1327 Predicted transcriptio  54.4     3.4 7.4E-05   24.0  -0.3   13   65-77     29-41  (156)
197 cd00924 Cyt_c_Oxidase_Vb Cytoc  54.3     6.1 0.00013   21.2   0.6   15   90-104    77-91  (97)
198 KOG0978|consensus               53.0     7.5 0.00016   28.5   1.0   17   91-107   677-693 (698)
199 PF13824 zf-Mss51:  Zinc-finger  52.6      14  0.0003   17.5   1.6    8   64-71     14-21  (55)
200 KOG4124|consensus               52.0     1.4 3.1E-05   29.1  -2.3   49   63-111   348-417 (442)
201 cd00065 FYVE FYVE domain; Zinc  52.0      12 0.00027   17.3   1.4   13   64-76     18-30  (57)
202 PRK12496 hypothetical protein;  51.7      13 0.00027   22.0   1.7   27   65-103   128-154 (164)
203 PF14311 DUF4379:  Domain of un  51.6      13 0.00027   17.4   1.4    9   65-73     29-37  (55)
204 PF04810 zf-Sec23_Sec24:  Sec23  51.5       6 0.00013   17.2   0.3   12   89-100    21-32  (40)
205 KOG3002|consensus               50.7      25 0.00054   23.1   3.0   76   35-115    79-162 (299)
206 smart00731 SprT SprT homologue  49.7     9.1  0.0002   22.0   0.9   33   64-103   112-144 (146)
207 PF01363 FYVE:  FYVE zinc finge  49.5     8.8 0.00019   18.7   0.7   27   38-76     11-37  (69)
208 PF08209 Sgf11:  Sgf11 (transcr  49.4      20 0.00044   15.0   1.7   22   65-87      5-26  (33)
209 PLN03238 probable histone acet  49.4      19 0.00042   23.4   2.3   27   90-116    46-72  (290)
210 TIGR01384 TFS_arch transcripti  49.3     1.9   4E-05   23.2  -1.9   40   65-104    63-102 (104)
211 smart00064 FYVE Protein presen  48.6      14  0.0003   17.9   1.4   28   37-76     11-38  (68)
212 KOG3507|consensus               48.6     9.9 0.00021   18.2   0.8   12   36-47     37-48  (62)
213 cd00730 rubredoxin Rubredoxin;  48.3       8 0.00017   17.9   0.4   12   93-104     2-13  (50)
214 PF04780 DUF629:  Protein of un  47.6      16 0.00034   25.6   1.9   25   36-60     57-81  (466)
215 COG0068 HypF Hydrogenase matur  47.3     3.5 7.5E-05   30.1  -1.2   79    9-100   102-181 (750)
216 KOG4727|consensus               46.7      12 0.00027   22.2   1.1   23    7-29     74-96  (193)
217 PF07975 C1_4:  TFIIH C1-like d  45.7       4 8.6E-05   19.0  -0.8   14   64-77     21-34  (51)
218 PF12230 PRP21_like_P:  Pre-mRN  45.7     6.9 0.00015   24.4   0.0   26   90-116   166-191 (229)
219 PRK00762 hypA hydrogenase nick  45.6     8.8 0.00019   21.5   0.4    7   65-71     93-99  (124)
220 PF00301 Rubredoxin:  Rubredoxi  45.4      11 0.00023   17.3   0.6   12    9-20      2-13  (47)
221 PRK05978 hypothetical protein;  45.2      16 0.00035   21.3   1.4   10   94-103    54-63  (148)
222 KOG3214|consensus               43.8     5.9 0.00013   21.2  -0.4   11   94-104    49-59  (109)
223 TIGR00319 desulf_FeS4 desulfof  43.5      13 0.00029   15.3   0.7   12    7-18      6-17  (34)
224 TIGR03829 YokU_near_AblA uncha  43.3      30 0.00066   18.3   2.1   15   65-79     36-50  (89)
225 PF10537 WAC_Acf1_DNA_bd:  ATP-  43.2      56  0.0012   17.7   3.3   39    8-47      3-41  (102)
226 PF02891 zf-MIZ:  MIZ/SP-RING z  43.0      11 0.00023   17.4   0.4    8   93-100    42-49  (50)
227 cd00974 DSRD Desulforedoxin (D  43.0      14 0.00029   15.3   0.7   12    7-18      3-14  (34)
228 COG5216 Uncharacterized conser  42.5      15 0.00033   17.6   0.9   10   61-70     41-50  (67)
229 PF15616 TerY-C:  TerY-C metal   42.5     3.4 7.5E-05   23.4  -1.5   14   61-74    102-115 (131)
230 COG5151 SSL1 RNA polymerase II  41.8      24 0.00052   23.3   1.9   27   90-116   386-412 (421)
231 PF11672 DUF3268:  Protein of u  41.6      12 0.00026   20.3   0.5   10   36-45      2-11  (102)
232 PRK11823 DNA repair protein Ra  41.5      18 0.00039   25.1   1.5   24    6-43      5-28  (446)
233 PF02591 DUF164:  Putative zinc  41.2      30 0.00065   16.1   1.8    7   65-71     47-53  (56)
234 PF11931 DUF3449:  Domain of un  40.7     9.1  0.0002   23.4   0.0   23   89-111    98-121 (196)
235 PF14787 zf-CCHC_5:  GAG-polypr  40.6      13 0.00029   15.9   0.5   14   94-107     4-17  (36)
236 PRK00420 hypothetical protein;  40.3      18  0.0004   20.0   1.1   10   65-74     41-50  (112)
237 PF01286 XPA_N:  XPA protein N-  39.9      14 0.00031   15.6   0.5   13    9-21      4-16  (34)
238 PF14634 zf-RING_5:  zinc-RING   39.7      32 0.00068   15.0   1.7    7   65-71     37-43  (44)
239 COG0675 Transposase and inacti  39.5      16 0.00036   23.7   1.0   14   90-103   320-333 (364)
240 PF11781 RRN7:  RNA polymerase   39.1      14 0.00031   15.7   0.5    9    9-17      9-17  (36)
241 TIGR00416 sms DNA repair prote  38.9      21 0.00046   24.9   1.5   12    7-18      6-17  (454)
242 KOG0317|consensus               38.9      16 0.00035   23.7   0.9   32   66-103   253-284 (293)
243 PRK14892 putative transcriptio  38.8      11 0.00023   20.4   0.0    8   36-43     21-28  (99)
244 PF08792 A2L_zn_ribbon:  A2L zi  38.7      14  0.0003   15.4   0.4   11   93-103    22-32  (33)
245 PF06676 DUF1178:  Protein of u  38.5      24 0.00052   20.6   1.5   30   17-50     17-46  (148)
246 TIGR03831 YgiT_finger YgiT-typ  38.0      13 0.00029   16.2   0.3   12    9-20     33-44  (46)
247 TIGR00515 accD acetyl-CoA carb  37.7      22 0.00047   23.2   1.3   11   65-75     46-56  (285)
248 KOG1994|consensus               37.7      24 0.00052   22.2   1.4   26   87-112   234-259 (268)
249 PTZ00043 cytochrome c oxidase   37.6      16 0.00034   22.9   0.7   17    5-21    178-194 (268)
250 TIGR01385 TFSII transcription   37.4     6.4 0.00014   25.7  -1.1   38   64-103   258-297 (299)
251 PF07503 zf-HYPF:  HypF finger;  37.3     3.9 8.5E-05   17.4  -1.4   10   37-46     22-31  (35)
252 COG5112 UFD2 U1-like Zn-finger  37.3      19  0.0004   19.7   0.8   24   91-114    54-77  (126)
253 cd01121 Sms Sms (bacterial rad  36.9      21 0.00045   24.2   1.2   11    9-19      1-11  (372)
254 KOG1842|consensus               36.8      24 0.00051   24.6   1.4   26    7-32     14-39  (505)
255 KOG0717|consensus               36.7      22 0.00047   24.9   1.2   22   65-86    293-314 (508)
256 PLN00104 MYST -like histone ac  36.6      28  0.0006   24.4   1.7   27   90-116   196-222 (450)
257 KOG2272|consensus               35.8      12 0.00026   23.9  -0.0   16   36-51     99-114 (332)
258 PLN03239 histone acetyltransfe  35.7      30 0.00065   23.3   1.7   25   90-114   104-128 (351)
259 smart00132 LIM Zinc-binding do  35.6     6.3 0.00014   16.3  -1.0   10   93-102    28-37  (39)
260 PTZ00064 histone acetyltransfe  35.4      33 0.00072   24.4   1.9   27   90-116   278-304 (552)
261 PF04438 zf-HIT:  HIT zinc fing  35.0      39 0.00086   13.7   1.5   15    7-21     12-26  (30)
262 PF12773 DZR:  Double zinc ribb  34.9      31 0.00067   15.5   1.3    9   65-73     30-38  (50)
263 PRK12722 transcriptional activ  34.5      31 0.00068   21.0   1.6   28   65-100   135-162 (187)
264 smart00647 IBR In Between Ring  34.3      23  0.0005   16.6   0.9    9   66-74     42-50  (64)
265 PF01215 COX5B:  Cytochrome c o  33.7      12 0.00026   21.4  -0.2   15   90-104   110-124 (136)
266 COG1379 PHP family phosphoeste  33.7      46 0.00099   22.4   2.3   32   66-106   248-279 (403)
267 PRK12860 transcriptional activ  33.5      33 0.00072   20.9   1.5   27   65-99    135-161 (189)
268 PF08882 Acetone_carb_G:  Aceto  33.3      12 0.00026   20.6  -0.2   12   64-75     74-85  (112)
269 PF10083 DUF2321:  Uncharacteri  33.0      20 0.00043   21.1   0.6   14   91-104    67-80  (158)
270 PF08271 TF_Zn_Ribbon:  TFIIB z  32.9      19 0.00041   15.8   0.4    7   94-100     2-8   (43)
271 PRK06260 threonine synthase; V  32.8      32 0.00069   23.5   1.6   26   37-74      4-29  (397)
272 TIGR03830 CxxCG_CxxCG_HTH puta  32.7      47   0.001   18.2   2.0   23    7-29     30-52  (127)
273 PF10276 zf-CHCC:  Zinc-finger   32.3      34 0.00073   15.0   1.1   11    8-18     29-39  (40)
274 PRK14559 putative protein seri  32.1      33 0.00071   25.3   1.6    8   10-17      3-10  (645)
275 TIGR00627 tfb4 transcription f  31.8      40 0.00087   22.0   1.8   11   65-75    256-266 (279)
276 PLN02748 tRNA dimethylallyltra  31.6      41 0.00089   23.7   1.9   24   91-114   417-441 (468)
277 CHL00174 accD acetyl-CoA carbo  31.6      32  0.0007   22.6   1.4   11   93-103    58-68  (296)
278 COG4391 Uncharacterized protei  31.4     7.9 0.00017   18.8  -1.0   45   55-103    15-59  (62)
279 PF05495 zf-CHY:  CHY zinc fing  31.4     7.2 0.00016   19.4  -1.2   12    9-20     11-22  (71)
280 KOG0782|consensus               31.2     9.2  0.0002   27.5  -1.1   51   50-106   239-290 (1004)
281 PRK01343 zinc-binding protein;  30.5      27 0.00059   16.7   0.7   11   93-103    10-20  (57)
282 PRK14138 NAD-dependent deacety  28.7      89  0.0019   19.8   2.9   11    9-19    120-130 (244)
283 TIGR00310 ZPR1_znf ZPR1 zinc f  28.7     6.1 0.00013   24.0  -2.0   38   10-48      2-42  (192)
284 PF01927 Mut7-C:  Mut7-C RNAse   28.6      40 0.00087   19.4   1.3   46   65-110    92-142 (147)
285 PRK05654 acetyl-CoA carboxylas  28.5      31 0.00067   22.6   0.9   10   65-74     47-56  (292)
286 PF14369 zf-RING_3:  zinc-finge  28.3      27 0.00058   14.7   0.4   10   94-103    23-32  (35)
287 KOG2906|consensus               28.3     6.1 0.00013   21.1  -1.8   38   66-103    67-104 (105)
288 KOG2747|consensus               28.1      39 0.00085   23.2   1.4   29   90-118   156-184 (396)
289 KOG2857|consensus               28.1      28  0.0006   20.1   0.6   23    7-29     16-38  (157)
290 PF07295 DUF1451:  Protein of u  26.9      21 0.00046   20.7  -0.0   27   36-72    112-138 (146)
291 PF09855 DUF2082:  Nucleic-acid  26.7      29 0.00063   17.0   0.5    8   93-100     1-8   (64)
292 PRK07218 replication factor A;  26.7      41  0.0009   23.4   1.3   10   65-74    298-307 (423)
293 cd04476 RPA1_DBD_C RPA1_DBD_C:  26.7      29 0.00063   20.3   0.6   12   63-74     50-61  (166)
294 COG1066 Sms Predicted ATP-depe  26.5      39 0.00084   23.6   1.1   13    7-19      6-18  (456)
295 PF03107 C1_2:  C1 domain;  Int  26.3      36 0.00078   13.6   0.7    8   94-101     2-9   (30)
296 KOG1729|consensus               26.2      17 0.00037   23.7  -0.5    9    9-17    169-177 (288)
297 COG5432 RAD18 RING-finger-cont  26.2      44 0.00095   22.0   1.3   14   57-71     53-66  (391)
298 PF14205 Cys_rich_KTR:  Cystein  26.1      21 0.00045   16.9  -0.1    9   92-100    28-36  (55)
299 PF02748 PyrI_C:  Aspartate car  26.0      30 0.00066   16.1   0.4   16    5-20     32-47  (52)
300 KOG2932|consensus               25.8      80  0.0017   21.1   2.4   29   88-116   140-171 (389)
301 PF04606 Ogr_Delta:  Ogr/Delta-  25.8      13 0.00028   16.8  -0.8    6   98-103    33-38  (47)
302 cd01410 SIRT7 SIRT7: Eukaryoti  25.3 1.2E+02  0.0027   18.6   3.1   11   36-46     95-105 (206)
303 PF05741 zf-nanos:  Nanos RNA b  25.2      24 0.00052   16.8   0.0   11   91-101    32-42  (55)
304 PF14446 Prok-RING_1:  Prokaryo  24.9      29 0.00062   16.4   0.2   12   93-104     6-17  (54)
305 PTZ00409 Sir2 (Silent Informat  24.7 1.1E+02  0.0023   19.9   2.8   14    7-20    136-149 (271)
306 COG4896 Uncharacterized protei  24.7      39 0.00085   16.4   0.7    8   64-71     31-38  (68)
307 PRK14811 formamidopyrimidine-D  24.3      28  0.0006   22.4   0.2   30   66-103   237-266 (269)
308 PF03145 Sina:  Seven in absent  24.0      56  0.0012   19.8   1.4    8   79-86     62-69  (198)
309 KOG1088|consensus               23.8      39 0.00083   18.9   0.6   20   58-77     92-111 (124)
310 KOG4118|consensus               23.8      54  0.0012   16.2   1.1   28   37-64     39-66  (74)
311 PF04216 FdhE:  Protein involve  23.5      19 0.00042   23.3  -0.7   76    9-102   173-248 (290)
312 TIGR00244 transcriptional regu  23.1      34 0.00075   19.9   0.4   15   91-105    27-41  (147)
313 PF04988 AKAP95:  A-kinase anch  23.0      57  0.0012   19.4   1.3   21   37-57      1-21  (165)
314 PRK07591 threonine synthase; V  22.9      59  0.0013   22.5   1.5   25   37-74     19-43  (421)
315 PRK08222 hydrogenase 4 subunit  22.6   1E+02  0.0022   18.6   2.3   21   91-111   113-133 (181)
316 COG4847 Uncharacterized protei  22.5      32 0.00068   18.4   0.1   13   89-101     3-15  (103)
317 cd00122 MBD MeCP2, MBD1, MBD2,  22.5      98  0.0021   14.8   1.9   21   96-116    31-51  (62)
318 PRK11827 hypothetical protein;  22.2      59  0.0013   15.8   1.0   11   93-103    27-37  (60)
319 PF15227 zf-C3HC4_4:  zinc fing  22.1      90   0.002   13.6   1.9    6   93-98     37-42  (42)
320 PF00649 Copper-fist:  Copper f  22.0      27 0.00058   15.4  -0.1   17    3-19      3-19  (40)
321 PRK06450 threonine synthase; V  22.0      64  0.0014   21.6   1.5   10   37-46      4-13  (338)
322 PF13248 zf-ribbon_3:  zinc-rib  21.9      50  0.0011   12.6   0.7    7   66-72      4-10  (26)
323 COG2879 Uncharacterized small   21.9 1.2E+02  0.0026   14.9   2.0   19   46-64     22-40  (65)
324 PF13821 DUF4187:  Domain of un  21.7      60  0.0013   15.3   1.0   21   90-110    25-45  (55)
325 smart00586 ZnF_DBF Zinc finger  21.7      63  0.0014   15.0   1.0   21    6-29      3-23  (49)
326 PF09963 DUF2197:  Uncharacteri  21.7      43 0.00094   16.0   0.5    6   65-70     32-37  (56)
327 KOG3352|consensus               21.5      44 0.00096   19.6   0.6   15   90-104   131-145 (153)
328 PF10164 DUF2367:  Uncharacteri  21.0      50  0.0011   17.8   0.7   13   90-102    86-98  (98)
329 PF02146 SIR2:  Sir2 family;  I  20.8      67  0.0015   19.0   1.3    9   38-46    107-115 (178)
330 PF11494 Ta0938:  Ta0938;  Inte  20.7      55  0.0012   17.6   0.8   11    8-18     14-24  (105)
331 PHA02942 putative transposase;  20.6      83  0.0018   21.6   1.8   14   90-103   340-353 (383)
332 PF03884 DUF329:  Domain of unk  20.3      38 0.00082   16.2   0.2   12   93-104     3-14  (57)
333 PF03966 Trm112p:  Trm112p-like  20.3      41 0.00089   16.4   0.3   13    7-19     52-64  (68)
334 smart00109 C1 Protein kinase C  20.2      68  0.0015   13.8   1.0    9   38-46     13-21  (49)

No 1  
>KOG2462|consensus
Probab=99.97  E-value=1.2e-30  Score=156.14  Aligned_cols=107  Identities=37%  Similarity=0.739  Sum_probs=74.7

Q ss_pred             CcceeccccccccCChhHHHHHHHhhcCCCCcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcCCChhhHHHHHH
Q psy10762          6 ETPHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHVR   85 (126)
Q Consensus         6 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~   85 (126)
                      ++.+.|..|+++|-+...|..|+++|.  .+++|.+||+.|...+.|+.|+++|+|||||.|+.|+++|...++|..|++
T Consensus       159 ~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQ  236 (279)
T KOG2462|consen  159 KKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQ  236 (279)
T ss_pred             cccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHH
Confidence            455666666666666666666666665  356677777777777777777777777777777777777777777777777


Q ss_pred             hhcCCCCccCcccccccCCHHHHHHHHHH
Q psy10762         86 RHTGESPHKCTYCMKSFTRKEHLTNHIRQ  114 (126)
Q Consensus        86 ~~~~~~~~~C~~C~~~f~~~~~l~~H~~~  114 (126)
                      +|.+.+.|.|..|+|+|+..+.|.+|...
T Consensus       237 THS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  237 THSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             hhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            77777777777777777777777777544


No 2  
>KOG2462|consensus
Probab=99.96  E-value=2.3e-30  Score=154.88  Aligned_cols=117  Identities=32%  Similarity=0.676  Sum_probs=108.4

Q ss_pred             CcceeccccccccCChhHHHHHHHhhcC---CCCcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcCCChhhHHH
Q psy10762          6 ETPHRCDYCAKTFTRKEHLVNHVRQHTG---ESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVN   82 (126)
Q Consensus         6 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~---~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~   82 (126)
                      ...|.|.+||+.+...++|..|++.|..   .+.+.|..|++.+.+...|..|+++|.-  +.+|..||+.|.+...|+.
T Consensus       128 ~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l--~c~C~iCGKaFSRPWLLQG  205 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTL--PCECGICGKAFSRPWLLQG  205 (279)
T ss_pred             CCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccCC--CcccccccccccchHHhhc
Confidence            3459999999999999999999999853   5678999999999999999999999984  6899999999999999999


Q ss_pred             HHHhhcCCCCccCcccccccCCHHHHHHHHHHhhhccccCCC
Q psy10762         83 HVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQHTVRRVNDLP  124 (126)
Q Consensus        83 h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~  124 (126)
                      |+++|+|||||.|+.|+|.|..+++|+.|+.+|.+.+..+++
T Consensus       206 HiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~  247 (279)
T KOG2462|consen  206 HIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCP  247 (279)
T ss_pred             ccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCc
Confidence            999999999999999999999999999999999998876654


No 3  
>KOG3576|consensus
Probab=99.84  E-value=1.2e-21  Score=113.19  Aligned_cols=113  Identities=29%  Similarity=0.597  Sum_probs=103.5

Q ss_pred             CCcceeccccccccCChhHHHHHHHhhcCCCCcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcCCChhhHHHHH
Q psy10762          5 GETPHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHV   84 (126)
Q Consensus         5 ~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~   84 (126)
                      +...|.|.+|++.|.....|..|+..|...+.+.|..||+.|.+.-.|.+|+++|+|.+||.|..|+++|.+.-+|..|.
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl  193 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHL  193 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHH
Confidence            45679999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhcC-----------CCCccCcccccccCCHHHHHHHHHHhhh
Q psy10762         85 RRHTG-----------ESPHKCTYCMKSFTRKEHLTNHIRQHTV  117 (126)
Q Consensus        85 ~~~~~-----------~~~~~C~~C~~~f~~~~~l~~H~~~h~~  117 (126)
                      +.-+|           ++.|+|..||.+-.....+..|+..|+.
T Consensus       194 ~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp  237 (267)
T KOG3576|consen  194 KKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHP  237 (267)
T ss_pred             HHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCC
Confidence            75432           5679999999998888899999888764


No 4  
>KOG1074|consensus
Probab=99.83  E-value=9.5e-22  Score=132.49  Aligned_cols=51  Identities=37%  Similarity=0.734  Sum_probs=49.4

Q ss_pred             ccCCCCCcCCChhhHHHHHHhhcCCCCccCcccccccCCHHHHHHHHHHhh
Q psy10762         66 PCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQHT  116 (126)
Q Consensus        66 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  116 (126)
                      +|..|.++++-...|+.|.++|+||+||+|++||+.|..+-+|+.|+-+|.
T Consensus       607 qCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHk  657 (958)
T KOG1074|consen  607 QCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHK  657 (958)
T ss_pred             ceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccc
Confidence            799999999999999999999999999999999999999999999999886


No 5  
>KOG1074|consensus
Probab=99.76  E-value=1.4e-19  Score=122.23  Aligned_cols=52  Identities=35%  Similarity=0.721  Sum_probs=49.8

Q ss_pred             ccCCCCCcCCChhhHHHHHHhhcCCCCccCcccccccCCHHHHHHHHHHhhh
Q psy10762         66 PCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQHTV  117 (126)
Q Consensus        66 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  117 (126)
                      .|..|++.|...+.|+.|+++|+++++|.|..|++.|..+.+|+.||.+|.-
T Consensus       881 ~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w  932 (958)
T KOG1074|consen  881 VCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMW  932 (958)
T ss_pred             hhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhccccc
Confidence            5899999999999999999999999999999999999999999999998873


No 6  
>KOG3623|consensus
Probab=99.73  E-value=1.2e-18  Score=116.60  Aligned_cols=106  Identities=30%  Similarity=0.682  Sum_probs=94.5

Q ss_pred             eeccccccccCChhHHHHHHHhhc--CCCCcccCCcccccCCchHHHHHHhhhcCC-------------CCcccCCCCCc
Q psy10762          9 HRCDYCAKTFTRKEHLVNHVRQHT--GESPHHCNYCAKSFTRKDHMVYHERQHTGE-------------TPFPCQYCPKA   73 (126)
Q Consensus         9 ~~C~~C~~~f~~~~~l~~h~~~h~--~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~-------------~~~~C~~C~~~   73 (126)
                      ..|+.|...+.....++.|+...+  .+..|.|.+|..+|.+...|.+|+.+|...             +.|.|..|+++
T Consensus       211 ltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKA  290 (1007)
T KOG3623|consen  211 LTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKA  290 (1007)
T ss_pred             hcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchh
Confidence            579999999999999999998654  355689999999999999999999877432             45999999999


Q ss_pred             CCChhhHHHHHHhhcCCCCccCcccccccCCHHHHHHHHHH
Q psy10762         74 FTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQ  114 (126)
Q Consensus        74 ~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~  114 (126)
                      |...-.|..|+++|.||+||.|+.|+|+|+.+..+..|+-.
T Consensus       291 FKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  291 FKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             hhhHHHHHhhheeecCCCCcCCcccccccccCCcccccccc
Confidence            99999999999999999999999999999998888888754


No 7  
>KOG3608|consensus
Probab=99.71  E-value=2.2e-17  Score=102.76  Aligned_cols=79  Identities=23%  Similarity=0.537  Sum_probs=40.4

Q ss_pred             cccCCcccccCCchHHHHHHh-hhcCCCCcccCCCCCcCCChhhHHHHHHhhcCCCCccCcc--cccccCCHHHHHHHHH
Q psy10762         37 HHCNYCAKSFTRKDHMVYHER-QHTGETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTY--CMKSFTRKEHLTNHIR  113 (126)
Q Consensus        37 ~~c~~C~~~~~~~~~l~~h~~-~~~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~--C~~~f~~~~~l~~H~~  113 (126)
                      |+|+.|..+....++|..|++ .|...+||.|+.|...+.+...|.+|...|. +..|+|..  |..+|.+...|++|++
T Consensus       264 ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~  342 (467)
T KOG3608|consen  264 YKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFL  342 (467)
T ss_pred             ccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHH
Confidence            445555555555555555544 2334455555555555555555555555444 34455543  5555555555555554


Q ss_pred             Hhh
Q psy10762        114 QHT  116 (126)
Q Consensus       114 ~h~  116 (126)
                      .++
T Consensus       343 evh  345 (467)
T KOG3608|consen  343 EVH  345 (467)
T ss_pred             Hhc
Confidence            433


No 8  
>KOG3623|consensus
Probab=99.70  E-value=3.4e-18  Score=114.54  Aligned_cols=80  Identities=34%  Similarity=0.833  Sum_probs=72.1

Q ss_pred             CCCcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcCCChhhHHHHHHhhcCCCCccCcccccccCCHHHHHHHHH
Q psy10762         34 ESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIR  113 (126)
Q Consensus        34 ~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~  113 (126)
                      +..|.|++|.++|.-.++|.+|.-.|.|.+||+|..|.++|...-.|..|.+.|.||+||.|..|+|+|+.+..+..||.
T Consensus       892 ~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  892 DGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             cccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhhc
Confidence            34689999999999999999999999999999999999999999999999999999999999999999998877777764


No 9  
>KOG3576|consensus
Probab=99.68  E-value=6.2e-18  Score=98.01  Aligned_cols=81  Identities=31%  Similarity=0.658  Sum_probs=76.9

Q ss_pred             CCCcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcCCChhhHHHHHHhhcCCCCccCcccccccCCHHHHHHHHH
Q psy10762         34 ESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIR  113 (126)
Q Consensus        34 ~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~  113 (126)
                      ...|.|.+|++.|.....|.+|++.|...+.+-|..||++|...-.|.+|.++|+|.+||+|..|++.|.++-.|..|++
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~  194 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLK  194 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHH
Confidence            44689999999999999999999999999999999999999999999999999999999999999999999999999976


Q ss_pred             H
Q psy10762        114 Q  114 (126)
Q Consensus       114 ~  114 (126)
                      .
T Consensus       195 k  195 (267)
T KOG3576|consen  195 K  195 (267)
T ss_pred             H
Confidence            5


No 10 
>KOG3608|consensus
Probab=99.65  E-value=2.4e-16  Score=98.21  Aligned_cols=113  Identities=26%  Similarity=0.590  Sum_probs=86.0

Q ss_pred             CCCCCcceeccccccccCChhHHHHHHHhh--cCCCCcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcCCChhh
Q psy10762          2 WHTGETPHRCDYCAKTFTRKEHLVNHVRQH--TGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDH   79 (126)
Q Consensus         2 ~~~~~~~~~C~~C~~~f~~~~~l~~h~~~h--~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~   79 (126)
                      .|+++|...|+.||..|.....|-.|.+.-  ....+|.|..|.+.|.....|..|+..|..  -|.||.|..+....++
T Consensus       201 ~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn--~ykCplCdmtc~~~ss  278 (467)
T KOG3608|consen  201 THSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVN--CYKCPLCDMTCSSASS  278 (467)
T ss_pred             hcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhh--cccccccccCCCChHH
Confidence            577788888888888888887777776532  344577888888888888888888777766  4788888888888888


Q ss_pred             HHHHHHh-hcCCCCccCcccccccCCHHHHHHHHHHhh
Q psy10762         80 LVNHVRR-HTGESPHKCTYCMKSFTRKEHLTNHIRQHT  116 (126)
Q Consensus        80 l~~h~~~-~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  116 (126)
                      |..|++. |...+||+|..|.+.|...++|.+|..+|.
T Consensus       279 L~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS  316 (467)
T KOG3608|consen  279 LTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS  316 (467)
T ss_pred             HHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc
Confidence            8888875 666778888888888888888888877766


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.52  E-value=7e-14  Score=93.28  Aligned_cols=103  Identities=19%  Similarity=0.459  Sum_probs=87.1

Q ss_pred             CcceeccccccccCChhHHHHHHHhhcCCCCcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcCCC---------
Q psy10762          6 ETPHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTR---------   76 (126)
Q Consensus         6 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~---------   76 (126)
                      +..+.|+.|++.|. ...|..|+..++  .++.|+ |+..+ ....|..|+..+.+.+++.|+.|+..+..         
T Consensus       451 ~~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d  525 (567)
T PLN03086        451 KNHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRD  525 (567)
T ss_pred             ccCccCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhh
Confidence            45678999999996 578999999975  679999 99654 66889999999999999999999998852         


Q ss_pred             -hhhHHHHHHhhcCCCCccCcccccccCCHHHHHHHHHHh
Q psy10762         77 -KDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQH  115 (126)
Q Consensus        77 -~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h  115 (126)
                       ...|..|...+ +.+++.|..||+.+..+ .|..|+-.-
T Consensus       526 ~~s~Lt~HE~~C-G~rt~~C~~Cgk~Vrlr-dm~~H~~~~  563 (567)
T PLN03086        526 RLRGMSEHESIC-GSRTAPCDSCGRSVMLK-EMDIHQIAV  563 (567)
T ss_pred             hhhhHHHHHHhc-CCcceEccccCCeeeeh-hHHHHHHHh
Confidence             34788898885 88999999999999988 788886553


No 12 
>PHA00733 hypothetical protein
Probab=99.49  E-value=5.9e-14  Score=77.85  Aligned_cols=112  Identities=14%  Similarity=0.199  Sum_probs=78.8

Q ss_pred             CCCcceeccccccccC-ChhHHHHHHHhhcCCCCcccCCcccccCCchHHHHH--H---hhhcCCCCcccCCCCCcCCCh
Q psy10762          4 TGETPHRCDYCAKTFT-RKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYH--E---RQHTGETPFPCQYCPKAFTRK   77 (126)
Q Consensus         4 ~~~~~~~C~~C~~~f~-~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h--~---~~~~~~~~~~C~~C~~~~~~~   77 (126)
                      +|.+.|.-+.=|..|- +.+.|..+-......+++.|.+|...+.....|..+  +   ....+.+||.|+.|++.|.+.
T Consensus         7 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~   86 (128)
T PHA00733          7 SGSKKYLSNHKGIFIHVTLEELKRYHSLTPEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSS   86 (128)
T ss_pred             cchHhhcccCCCeEEecCHHHhhhhhcCChhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCH
Confidence            3444444333333322 223344333333345678899998887776666554  1   133457899999999999999


Q ss_pred             hhHHHHHHhhcCCCCccCcccccccCCHHHHHHHHHHhhh
Q psy10762         78 DHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQHTV  117 (126)
Q Consensus        78 ~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  117 (126)
                      ..|..|++.+  +.+|.|.+|++.|.....|.+|+...++
T Consensus        87 s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         87 VSLKQHIRYT--EHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHhcC--CcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            9999999876  4679999999999999999999887664


No 13 
>PHA02768 hypothetical protein; Provisional
Probab=99.26  E-value=2.2e-12  Score=60.17  Aligned_cols=44  Identities=18%  Similarity=0.557  Sum_probs=35.3

Q ss_pred             CcccCCCCCcCCChhhHHHHHHhhcCCCCccCcccccccCCHHHHH
Q psy10762         64 PFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLT  109 (126)
Q Consensus        64 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~  109 (126)
                      .|+|+.||+.|...+.|..|+++|+  ++|.|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            3788888888888888888888887  6888888888888766553


No 14 
>PHA00733 hypothetical protein
Probab=99.25  E-value=1e-11  Score=68.92  Aligned_cols=82  Identities=20%  Similarity=0.300  Sum_probs=67.2

Q ss_pred             CcceeccccccccCChhHHHHH--HH---hhcCCCCcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcCCChhhH
Q psy10762          6 ETPHRCDYCAKTFTRKEHLVNH--VR---QHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHL   80 (126)
Q Consensus         6 ~~~~~C~~C~~~f~~~~~l~~h--~~---~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l   80 (126)
                      ++.+.|.+|...|.....+..+  +.   .+.+..+|.|+.|+..|.....|..|+..+  ..+|.|+.|++.|.....|
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL  115 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDST  115 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHH
Confidence            4678899999988887776665  11   233467899999999999999999999875  4579999999999999999


Q ss_pred             HHHHHhhcC
Q psy10762         81 VNHVRRHTG   89 (126)
Q Consensus        81 ~~h~~~~~~   89 (126)
                      ..|+...++
T Consensus       116 ~~H~~~~h~  124 (128)
T PHA00733        116 LDHVCKKHN  124 (128)
T ss_pred             HHHHHHhcC
Confidence            999876543


No 15 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.10  E-value=1.7e-10  Score=77.51  Aligned_cols=101  Identities=18%  Similarity=0.424  Sum_probs=76.0

Q ss_pred             eeccccccccCChhHHHHHHHhhcC-------------------CCCcccCCcccccCCchHHHHHHhhhcCCCCcccCC
Q psy10762          9 HRCDYCAKTFTRKEHLVNHVRQHTG-------------------ESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQY   69 (126)
Q Consensus         9 ~~C~~C~~~f~~~~~l~~h~~~h~~-------------------~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~   69 (126)
                      -.|.-|...... .+|..|......                   +..+.|+.|+..|. ...|..|+..++  +++.|+ 
T Consensus       408 V~C~NC~~~i~l-~~l~lHe~~C~r~~V~Cp~~~Cg~v~~r~el~~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-  482 (567)
T PLN03086        408 VECRNCKHYIPS-RSIALHEAYCSRHNVVCPHDGCGIVLRVEEAKNHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-  482 (567)
T ss_pred             EECCCCCCccch-hHHHHHHhhCCCcceeCCcccccceeeccccccCccCCCCCCccc-hHHHHHHHHhcC--CCccCC-
Confidence            356667665544 345566543221                   23467899999885 677999999875  789999 


Q ss_pred             CCCcCCChhhHHHHHHhhcCCCCccCcccccccCC----------HHHHHHHHHHh
Q psy10762         70 CPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTR----------KEHLTNHIRQH  115 (126)
Q Consensus        70 C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~----------~~~l~~H~~~h  115 (126)
                      |+..+ ....|..|+.++...+++.|..|++.|..          .+.|..|..+.
T Consensus       483 Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C  537 (567)
T PLN03086        483 CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC  537 (567)
T ss_pred             CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc
Confidence            99765 56899999999999999999999999852          45788998875


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=99.06  E-value=1.1e-10  Score=54.59  Aligned_cols=39  Identities=18%  Similarity=0.588  Sum_probs=21.5

Q ss_pred             eeccccccccCChhHHHHHHHhhcCCCCcccCCcccccCCc
Q psy10762          9 HRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRK   49 (126)
Q Consensus         9 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~   49 (126)
                      |.|+.||+.|....+|..|++.|+  ++++|..|++.|...
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~   44 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRT   44 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccc
Confidence            555555555555555555555555  345555555555443


No 17 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.05  E-value=1.3e-10  Score=46.69  Aligned_cols=25  Identities=60%  Similarity=1.123  Sum_probs=18.1

Q ss_pred             hHHHHHHhhcCCCCccCcccccccC
Q psy10762         79 HLVNHVRRHTGESPHKCTYCMKSFT  103 (126)
Q Consensus        79 ~l~~h~~~~~~~~~~~C~~C~~~f~  103 (126)
                      +|.+|+++|+++++|.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            3567777777777777777777775


No 18 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.88  E-value=1.3e-09  Score=43.75  Aligned_cols=24  Identities=50%  Similarity=1.115  Sum_probs=16.1

Q ss_pred             HHHHHhhhcCCCCcccCCCCCcCC
Q psy10762         52 MVYHERQHTGETPFPCQYCPKAFT   75 (126)
Q Consensus        52 l~~h~~~~~~~~~~~C~~C~~~~~   75 (126)
                      |..|+++|.|++||.|+.|++.|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            566666777777777777766654


No 19 
>KOG3993|consensus
Probab=98.84  E-value=1e-09  Score=70.54  Aligned_cols=114  Identities=25%  Similarity=0.388  Sum_probs=82.1

Q ss_pred             ceeccccccccCChhHHHHHHHhhcC---------------------------------CCCcccCCcccccCCchHHHH
Q psy10762          8 PHRCDYCAKTFTRKEHLVNHVRQHTG---------------------------------ESPHHCNYCAKSFTRKDHMVY   54 (126)
Q Consensus         8 ~~~C~~C~~~f~~~~~l~~h~~~h~~---------------------------------~~~~~c~~C~~~~~~~~~l~~   54 (126)
                      -|+|++|+++|....||.+|.+.|-.                                 +..|.|..|++.|.....|.+
T Consensus       295 EYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrK  374 (500)
T KOG3993|consen  295 EYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRK  374 (500)
T ss_pred             eecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHH
Confidence            59999999999999999999987732                                 123789999999999999999


Q ss_pred             HHhhhcCCC------C----------------------------------------cccCCCCCcCCChhhHHHHHHhhc
Q psy10762         55 HERQHTGET------P----------------------------------------FPCQYCPKAFTRKDHLVNHVRRHT   88 (126)
Q Consensus        55 h~~~~~~~~------~----------------------------------------~~C~~C~~~~~~~~~l~~h~~~~~   88 (126)
                      |+..|....      +                                        -.++.++..+.++..--.+.+...
T Consensus       375 Hqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~sael~~pp~~~~ppsss~~sgg~~rlg~  454 (500)
T KOG3993|consen  375 HQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAGSAELELPPYDGSPPSSSGSSGGYGRLGI  454 (500)
T ss_pred             hHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeeeccccccCCCCCCCCcccCCCCCccccccc
Confidence            987664220      0                                        123445544444433333334444


Q ss_pred             CCCCccCcccccccCCHHHHHHHHHHhhhcccc
Q psy10762         89 GESPHKCTYCMKSFTRKEHLTNHIRQHTVRRVN  121 (126)
Q Consensus        89 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~  121 (126)
                      .+.-|.|..|.-.|-++..|.+|+..-|....+
T Consensus       455 ~~q~f~~ky~~atfyss~~ltrhin~~Hpse~r  487 (500)
T KOG3993|consen  455 AEQGFTCKYCPATFYSSPGLTRHINKCHPSELR  487 (500)
T ss_pred             hhhccccccchHhhhcCcchHhHhhhcChHHhh
Confidence            456789999999999999999998886655444


No 20 
>KOG3993|consensus
Probab=98.81  E-value=8.9e-10  Score=70.80  Aligned_cols=27  Identities=30%  Similarity=0.491  Sum_probs=23.8

Q ss_pred             CCccCcccccccCCHHHHHHHHHHhhh
Q psy10762         91 SPHKCTYCMKSFTRKEHLTNHIRQHTV  117 (126)
Q Consensus        91 ~~~~C~~C~~~f~~~~~l~~H~~~h~~  117 (126)
                      ..|.|..|+|.|.....|++|+-.|..
T Consensus       355 gi~~C~~C~KkFrRqAYLrKHqlthq~  381 (500)
T KOG3993|consen  355 GIFSCHTCGKKFRRQAYLRKHQLTHQR  381 (500)
T ss_pred             ceeecHHhhhhhHHHHHHHHhHHhhhc
Confidence            359999999999999999999888763


No 21 
>PHA00616 hypothetical protein
Probab=98.81  E-value=2.5e-09  Score=47.71  Aligned_cols=29  Identities=17%  Similarity=0.343  Sum_probs=17.0

Q ss_pred             CccCcccccccCCHHHHHHHHHHhhhccc
Q psy10762         92 PHKCTYCMKSFTRKEHLTNHIRQHTVRRV  120 (126)
Q Consensus        92 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  120 (126)
                      +|.|+.||+.|...+.|.+|++.|++++.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~   29 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNK   29 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCc
Confidence            35566666666666666666666655543


No 22 
>PHA00616 hypothetical protein
Probab=98.66  E-value=1.4e-08  Score=45.30  Aligned_cols=33  Identities=15%  Similarity=0.351  Sum_probs=19.1

Q ss_pred             ceeccccccccCChhHHHHHHHhhcCCCCcccC
Q psy10762          8 PHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCN   40 (126)
Q Consensus         8 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~   40 (126)
                      ||.|..||+.|....+|..|++.|++++++.|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            355666666666666666666665555555443


No 23 
>PHA00732 hypothetical protein
Probab=98.66  E-value=2.3e-08  Score=50.90  Aligned_cols=45  Identities=24%  Similarity=0.450  Sum_probs=29.0

Q ss_pred             CcccCCcccccCCchHHHHHHhh-hcCCCCcccCCCCCcCCChhhHHHHHHh
Q psy10762         36 PHHCNYCAKSFTRKDHMVYHERQ-HTGETPFPCQYCPKAFTRKDHLVNHVRR   86 (126)
Q Consensus        36 ~~~c~~C~~~~~~~~~l~~h~~~-~~~~~~~~C~~C~~~~~~~~~l~~h~~~   86 (126)
                      +|.|+.|++.|.....|..|++. |.   ++.|+.|++.|.   .+..|..+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~   46 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYS   46 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhhcc
Confidence            35677777777777777777764 33   246777777775   34555543


No 24 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.65  E-value=8.6e-08  Score=45.42  Aligned_cols=50  Identities=28%  Similarity=0.584  Sum_probs=37.2

Q ss_pred             CcccCCCCCcCCChhhHHHHHHhhcC-C-CCccCcccccccCCHHHHHHHHHHhh
Q psy10762         64 PFPCQYCPKAFTRKDHLVNHVRRHTG-E-SPHKCTYCMKSFTRKEHLTNHIRQHT  116 (126)
Q Consensus        64 ~~~C~~C~~~~~~~~~l~~h~~~~~~-~-~~~~C~~C~~~f~~~~~l~~H~~~h~  116 (126)
                      .|.||.|++ ..+...|..|...... + +.+.|++|...+.  .+|..|+..++
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            378999998 4566788889876443 2 4588999988655  48889988765


No 25 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.63  E-value=2.9e-08  Score=38.66  Aligned_cols=23  Identities=48%  Similarity=0.917  Sum_probs=19.6

Q ss_pred             ccCcccccccCCHHHHHHHHHHh
Q psy10762         93 HKCTYCMKSFTRKEHLTNHIRQH  115 (126)
Q Consensus        93 ~~C~~C~~~f~~~~~l~~H~~~h  115 (126)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            67888999999999999998774


No 26 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.39  E-value=3.1e-07  Score=35.86  Aligned_cols=24  Identities=42%  Similarity=0.826  Sum_probs=18.2

Q ss_pred             ccCcccccccCCHHHHHHHHHHhh
Q psy10762         93 HKCTYCMKSFTRKEHLTNHIRQHT  116 (126)
Q Consensus        93 ~~C~~C~~~f~~~~~l~~H~~~h~  116 (126)
                      |.|+.|++.|.+...|..|++.|+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            578889999999889998888764


No 27 
>PHA00732 hypothetical protein
Probab=98.38  E-value=3.4e-07  Score=46.65  Aligned_cols=46  Identities=28%  Similarity=0.466  Sum_probs=37.9

Q ss_pred             ceeccccccccCChhHHHHHHHh-hcCCCCcccCCcccccCCchHHHHHHhhh
Q psy10762          8 PHRCDYCAKTFTRKEHLVNHVRQ-HTGESPHHCNYCAKSFTRKDHMVYHERQH   59 (126)
Q Consensus         8 ~~~C~~C~~~f~~~~~l~~h~~~-h~~~~~~~c~~C~~~~~~~~~l~~h~~~~   59 (126)
                      ||.|..|++.|....+|..|+.. |.+   +.|+.|++.|.   .+..|+...
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~---~l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYR---RLNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeC---Chhhhhccc
Confidence            58899999999999999999984 553   58999999997   467777443


No 28 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=98.30  E-value=5.6e-07  Score=47.94  Aligned_cols=23  Identities=39%  Similarity=0.967  Sum_probs=15.3

Q ss_pred             CccCcccccccCCHHHHHHHHHH
Q psy10762         92 PHKCTYCMKSFTRKEHLTNHIRQ  114 (126)
Q Consensus        92 ~~~C~~C~~~f~~~~~l~~H~~~  114 (126)
                      .+.|..|++.|.+...|..|++.
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~   72 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRS   72 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHH
T ss_pred             CCCCCccCCCCcCHHHHHHHHcC
Confidence            46677777777777777777665


No 29 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.29  E-value=7.8e-07  Score=34.47  Aligned_cols=23  Identities=39%  Similarity=0.907  Sum_probs=16.9

Q ss_pred             eeccccccccCChhHHHHHHHhh
Q psy10762          9 HRCDYCAKTFTRKEHLVNHVRQH   31 (126)
Q Consensus         9 ~~C~~C~~~f~~~~~l~~h~~~h   31 (126)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            56777777777777777777653


No 30 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.28  E-value=4.7e-07  Score=36.55  Aligned_cols=25  Identities=36%  Similarity=0.731  Sum_probs=20.3

Q ss_pred             CccCcccccccCCHHHHHHHHHHhh
Q psy10762         92 PHKCTYCMKSFTRKEHLTNHIRQHT  116 (126)
Q Consensus        92 ~~~C~~C~~~f~~~~~l~~H~~~h~  116 (126)
                      +|.|..|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            4778888888888888888887764


No 31 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.25  E-value=3e-06  Score=40.11  Aligned_cols=48  Identities=25%  Similarity=0.546  Sum_probs=24.3

Q ss_pred             eeccccccccCChhHHHHHHHhh-cC-CCCcccCCcccccCCchHHHHHHhhh
Q psy10762          9 HRCDYCAKTFTRKEHLVNHVRQH-TG-ESPHHCNYCAKSFTRKDHMVYHERQH   59 (126)
Q Consensus         9 ~~C~~C~~~f~~~~~l~~h~~~h-~~-~~~~~c~~C~~~~~~~~~l~~h~~~~   59 (126)
                      |.|+.|++ ..+...|..|.... .. .+.+.|++|...+.  ..|..|+...
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~   52 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQ   52 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHh
Confidence            56666666 44455566665442 22 23455666654322  2455555443


No 32 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=98.03  E-value=3.7e-06  Score=38.44  Aligned_cols=33  Identities=18%  Similarity=0.486  Sum_probs=21.9

Q ss_pred             cCCCCccCcccccccCCHHHHHHHHHHhhhccc
Q psy10762         88 TGESPHKCTYCMKSFTRKEHLTNHIRQHTVRRV  120 (126)
Q Consensus        88 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  120 (126)
                      ..+.|..|++|+..+++..+|++|+++++..+.
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            346778899999999999999999988776553


No 33 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.00  E-value=5.1e-06  Score=33.42  Aligned_cols=25  Identities=44%  Similarity=0.830  Sum_probs=18.0

Q ss_pred             ceeccccccccCChhHHHHHHHhhc
Q psy10762          8 PHRCDYCAKTFTRKEHLVNHVRQHT   32 (126)
Q Consensus         8 ~~~C~~C~~~f~~~~~l~~h~~~h~   32 (126)
                      +|.|..|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            4677777777777777777776553


No 34 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.99  E-value=1.4e-06  Score=54.70  Aligned_cols=52  Identities=23%  Similarity=0.593  Sum_probs=38.3

Q ss_pred             CCCcccCC--CCCcCCChhhHHHHHHhh-------------------cCCCCccCcccccccCCHHHHHHHHH
Q psy10762         62 ETPFPCQY--CPKAFTRKDHLVNHVRRH-------------------TGESPHKCTYCMKSFTRKEHLTNHIR  113 (126)
Q Consensus        62 ~~~~~C~~--C~~~~~~~~~l~~h~~~~-------------------~~~~~~~C~~C~~~f~~~~~l~~H~~  113 (126)
                      ++||.|++  |.+.|....-|.-|+.-.                   ...+||+|++|+|+++....|.-|..
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            46777765  777777776666665321                   12589999999999999988888743


No 35 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.98  E-value=8.3e-06  Score=32.16  Aligned_cols=24  Identities=38%  Similarity=0.690  Sum_probs=20.6

Q ss_pred             ccCcccccccCCHHHHHHHHHHhh
Q psy10762         93 HKCTYCMKSFTRKEHLTNHIRQHT  116 (126)
Q Consensus        93 ~~C~~C~~~f~~~~~l~~H~~~h~  116 (126)
                      |.|..|++.|...+.|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            578899999999999999988664


No 36 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.98  E-value=9.7e-06  Score=31.42  Aligned_cols=23  Identities=39%  Similarity=0.863  Sum_probs=14.0

Q ss_pred             eeccccccccCChhHHHHHHHhh
Q psy10762          9 HRCDYCAKTFTRKEHLVNHVRQH   31 (126)
Q Consensus         9 ~~C~~C~~~f~~~~~l~~h~~~h   31 (126)
                      |.|+.|+..|.+...|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            46677777777777777776654


No 37 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.72  E-value=3.6e-05  Score=40.90  Aligned_cols=74  Identities=23%  Similarity=0.588  Sum_probs=22.1

Q ss_pred             eccccccccCChhHHHHHHHhhcCCCCcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcCCChhhHHHHHHhhc
Q psy10762         10 RCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHVRRHT   88 (126)
Q Consensus        10 ~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~~~   88 (126)
                      .|..|+..|.....+..|+...++-.   .+. ...+.....+..+...... ..+.|..|++.|.+...|..|++.+.
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~---~~~-~~~l~~~~~~~~~~~~~~~-~~~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFD---IPD-QKYLVDPNRLLNYLRKKVK-ESFRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             -----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             Cccccccccccccccccccccccccc---ccc-ccccccccccccccccccC-CCCCCCccCCCCcCHHHHHHHHcCcc
Confidence            48899999999999999986554421   111 1112233333334332222 26899999999999999999999754


No 38 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.72  E-value=2.3e-05  Score=30.84  Aligned_cols=23  Identities=35%  Similarity=0.758  Sum_probs=18.7

Q ss_pred             ccCcccccccCCHHHHHHHHHHh
Q psy10762         93 HKCTYCMKSFTRKEHLTNHIRQH  115 (126)
Q Consensus        93 ~~C~~C~~~f~~~~~l~~H~~~h  115 (126)
                      |.|.+|++.|.+...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            56888888888888888887653


No 39 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.66  E-value=1.1e-05  Score=50.88  Aligned_cols=69  Identities=20%  Similarity=0.444  Sum_probs=41.8

Q ss_pred             Ccceeccc--cccccCChhHHHHHHHh-hcCCCCcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcCCChhhHHH
Q psy10762          6 ETPHRCDY--CAKTFTRKEHLVNHVRQ-HTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVN   82 (126)
Q Consensus         6 ~~~~~C~~--C~~~f~~~~~l~~h~~~-h~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~   82 (126)
                      ++||+|++  |.+.|.....|+.|+.. |...+...-+          .-..+.......|||.|.+|++.|....-|.-
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p----------~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKY  416 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENP----------SPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKY  416 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCC----------CccccccccccCCceeccccchhhccCcccee
Confidence            57888865  88888888778877643 2222211111          01111122345689999999999988877765


Q ss_pred             HH
Q psy10762         83 HV   84 (126)
Q Consensus        83 h~   84 (126)
                      |.
T Consensus       417 Hr  418 (423)
T COG5189         417 HR  418 (423)
T ss_pred             cc
Confidence            54


No 40 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.58  E-value=7.3e-05  Score=29.08  Aligned_cols=23  Identities=35%  Similarity=0.690  Sum_probs=16.5

Q ss_pred             ccCcccccccCCHHHHHHHHHHhh
Q psy10762         93 HKCTYCMKSFTRKEHLTNHIRQHT  116 (126)
Q Consensus        93 ~~C~~C~~~f~~~~~l~~H~~~h~  116 (126)
                      |+|+.|+.... ...|.+|+++++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            57888888777 778888887765


No 41 
>PRK04860 hypothetical protein; Provisional
Probab=97.56  E-value=5.6e-05  Score=43.78  Aligned_cols=38  Identities=26%  Similarity=0.629  Sum_probs=32.4

Q ss_pred             CcccCCCCCcCCChhhHHHHHHhhcCCCCccCcccccccCCH
Q psy10762         64 PFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRK  105 (126)
Q Consensus        64 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~  105 (126)
                      +|.|. |+.   ....+.+|.+++.++++|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            58998 986   666788999999999999999999988653


No 42 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.51  E-value=0.00021  Score=32.81  Aligned_cols=32  Identities=19%  Similarity=0.409  Sum_probs=19.1

Q ss_pred             CCCCcccCCcccccCCchHHHHHHhhhcCCCC
Q psy10762         33 GESPHHCNYCAKSFTRKDHMVYHERQHTGETP   64 (126)
Q Consensus        33 ~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~   64 (126)
                      .+.|..|++|+..+.+..+|.+|+...++.+|
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            44566778888777777778888777776655


No 43 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.46  E-value=0.00012  Score=28.61  Aligned_cols=23  Identities=43%  Similarity=0.823  Sum_probs=14.5

Q ss_pred             eeccccccccCChhHHHHHHHhh
Q psy10762          9 HRCDYCAKTFTRKEHLVNHVRQH   31 (126)
Q Consensus         9 ~~C~~C~~~f~~~~~l~~h~~~h   31 (126)
                      |.|..|++.|.....+..|+..|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            35666666666666666666544


No 44 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.33  E-value=0.0002  Score=28.06  Aligned_cols=22  Identities=36%  Similarity=0.834  Sum_probs=16.0

Q ss_pred             eeccccccccCChhHHHHHHHh
Q psy10762          9 HRCDYCAKTFTRKEHLVNHVRQ   30 (126)
Q Consensus         9 ~~C~~C~~~f~~~~~l~~h~~~   30 (126)
                      |.|..|+..|.+...+..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            5677777777777777777654


No 45 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.18  E-value=8.9e-05  Score=29.75  Aligned_cols=22  Identities=27%  Similarity=0.677  Sum_probs=16.7

Q ss_pred             ccCcccccccCCHHHHHHHHHH
Q psy10762         93 HKCTYCMKSFTRKEHLTNHIRQ  114 (126)
Q Consensus        93 ~~C~~C~~~f~~~~~l~~H~~~  114 (126)
                      |.|..|++.|.+...|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5688888888888888777654


No 46 
>PRK04860 hypothetical protein; Provisional
Probab=97.00  E-value=0.00067  Score=39.39  Aligned_cols=38  Identities=26%  Similarity=0.635  Sum_probs=31.4

Q ss_pred             CcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcCCCh
Q psy10762         36 PHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRK   77 (126)
Q Consensus        36 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~   77 (126)
                      +|.|. |+.   ....+..|.+++.++++|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            47887 876   677788999999999999999999877543


No 47 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.89  E-value=0.0012  Score=25.92  Aligned_cols=21  Identities=24%  Similarity=0.602  Sum_probs=13.5

Q ss_pred             ccCcccccccCCHHHHHHHHHH
Q psy10762         93 HKCTYCMKSFTRKEHLTNHIRQ  114 (126)
Q Consensus        93 ~~C~~C~~~f~~~~~l~~H~~~  114 (126)
                      ..|+.||+.| ..+.|.+|+.+
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            3577777777 44466777654


No 48 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.67  E-value=0.0022  Score=24.72  Aligned_cols=21  Identities=24%  Similarity=0.629  Sum_probs=9.5

Q ss_pred             eeccccccccCChhHHHHHHHh
Q psy10762          9 HRCDYCAKTFTRKEHLVNHVRQ   30 (126)
Q Consensus         9 ~~C~~C~~~f~~~~~l~~h~~~   30 (126)
                      |.|+.|+.... ..+|..|+..
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~   21 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKR   21 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHh
Confidence            34555555444 4455555544


No 49 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.46  E-value=0.0008  Score=26.89  Aligned_cols=22  Identities=32%  Similarity=0.753  Sum_probs=16.1

Q ss_pred             eeccccccccCChhHHHHHHHh
Q psy10762          9 HRCDYCAKTFTRKEHLVNHVRQ   30 (126)
Q Consensus         9 ~~C~~C~~~f~~~~~l~~h~~~   30 (126)
                      |.|..|++.|.+...+..|+..
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5677888888887777777643


No 50 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=96.15  E-value=0.0046  Score=26.15  Aligned_cols=23  Identities=22%  Similarity=0.527  Sum_probs=19.2

Q ss_pred             CccCcccccccCCHHHHHHHHHH
Q psy10762         92 PHKCTYCMKSFTRKEHLTNHIRQ  114 (126)
Q Consensus        92 ~~~C~~C~~~f~~~~~l~~H~~~  114 (126)
                      +|.|..|+..|.+...+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            57799999999988888888754


No 51 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=96.12  E-value=0.0038  Score=29.20  Aligned_cols=28  Identities=25%  Similarity=0.573  Sum_probs=19.2

Q ss_pred             CCCCccCcccccccCCHHHHHHHHHHhh
Q psy10762         89 GESPHKCTYCMKSFTRKEHLTNHIRQHT  116 (126)
Q Consensus        89 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~  116 (126)
                      ||..+.|+.|+..|....++.+|....+
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            4556677777777777777777765543


No 52 
>KOG4173|consensus
Probab=96.03  E-value=0.0031  Score=37.75  Aligned_cols=76  Identities=22%  Similarity=0.546  Sum_probs=56.1

Q ss_pred             CcccCC--cccccCCchHHHHHHhhhcCCCCcccCCCCCcCCChhhHHHHHHhhc----------CCCCccCcc--cccc
Q psy10762         36 PHHCNY--CAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHVRRHT----------GESPHKCTY--CMKS  101 (126)
Q Consensus        36 ~~~c~~--C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~~~----------~~~~~~C~~--C~~~  101 (126)
                      .+.|+.  |...+.....+..|...-++.   .|..|.++|.+...|..|+...+          |.-.|.|.+  |+..
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~~---sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~K  155 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHGN---SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEK  155 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhcccc---hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhh
Confidence            456766  667777777777776655554   89999999999888888886533          334588955  9999


Q ss_pred             cCCHHHHHHHHHH
Q psy10762        102 FTRKEHLTNHIRQ  114 (126)
Q Consensus       102 f~~~~~l~~H~~~  114 (126)
                      |.....-..|+-.
T Consensus       156 FkT~r~RkdH~I~  168 (253)
T KOG4173|consen  156 FKTSRDRKDHMIR  168 (253)
T ss_pred             hhhhhhhhhHHHH
Confidence            9998888888544


No 53 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=95.76  E-value=0.0063  Score=25.56  Aligned_cols=8  Identities=38%  Similarity=0.982  Sum_probs=3.7

Q ss_pred             CccCcccc
Q psy10762         92 PHKCTYCM   99 (126)
Q Consensus        92 ~~~C~~C~   99 (126)
                      ++.|++|+
T Consensus        17 ~~~CP~Cg   24 (33)
T cd00350          17 PWVCPVCG   24 (33)
T ss_pred             CCcCcCCC
Confidence            34444443


No 54 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.57  E-value=0.015  Score=24.52  Aligned_cols=22  Identities=27%  Similarity=0.578  Sum_probs=15.3

Q ss_pred             ceeccccccccCChhHHHHHHH
Q psy10762          8 PHRCDYCAKTFTRKEHLVNHVR   29 (126)
Q Consensus         8 ~~~C~~C~~~f~~~~~l~~h~~   29 (126)
                      +|.|..|+..|.....+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4667777777777666766664


No 55 
>KOG2231|consensus
Probab=95.48  E-value=0.052  Score=38.52  Aligned_cols=97  Identities=23%  Similarity=0.431  Sum_probs=57.7

Q ss_pred             ccCChhHHHHHHHhhcCCCCcccCCcc---------cccCCchHHHHHHhhhcC-CC----CcccCCCCCcCCChhhHHH
Q psy10762         17 TFTRKEHLVNHVRQHTGESPHHCNYCA---------KSFTRKDHMVYHERQHTG-ET----PFPCQYCPKAFTRKDHLVN   82 (126)
Q Consensus        17 ~f~~~~~l~~h~~~h~~~~~~~c~~C~---------~~~~~~~~l~~h~~~~~~-~~----~~~C~~C~~~~~~~~~l~~   82 (126)
                      .|.....|+.|+..-+.  .+.|.+|-         ........|..|+..... ++    .-.|..|...|.....+.+
T Consensus       123 ~~~s~~~Lk~H~~~~H~--~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~r  200 (669)
T KOG2231|consen  123 EFKSVENLKNHMRDQHK--LHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYR  200 (669)
T ss_pred             chhHHHHHHHHHHHhhh--hhccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHH
Confidence            33477889999854332  23444432         223345567777654322 11    1368889888888888888


Q ss_pred             HHHhhcCCCCccC---cccccccCCHHHHHHHHHHhh
Q psy10762         83 HVRRHTGESPHKC---TYCMKSFTRKEHLTNHIRQHT  116 (126)
Q Consensus        83 h~~~~~~~~~~~C---~~C~~~f~~~~~l~~H~~~h~  116 (126)
                      |++..+-...| |   ..++..|.....|..|.|..|
T Consensus       201 H~~~~h~~chf-C~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  201 HLRFDHEFCHF-CDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             hhccceeheee-cCcccccchhcccchHHHHHhhhcC
Confidence            88754322211 2   223456777888888887755


No 56 
>KOG2893|consensus
Probab=95.02  E-value=0.0048  Score=37.86  Aligned_cols=46  Identities=28%  Similarity=0.660  Sum_probs=34.8

Q ss_pred             cCCCCCcCCChhhHHHHHHhhcCCCCccCcccccccCCHHHHHHH-HHHhh
Q psy10762         67 CQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNH-IRQHT  116 (126)
Q Consensus        67 C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H-~~~h~  116 (126)
                      |..|.+.|..+..|..|++    .+.|+|.+|.|..-+.-.|..| +.+|.
T Consensus        13 cwycnrefddekiliqhqk----akhfkchichkkl~sgpglsihcmqvhk   59 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQK----AKHFKCHICHKKLFSGPGLSIHCMQVHK   59 (341)
T ss_pred             eeecccccchhhhhhhhhh----hccceeeeehhhhccCCCceeehhhhhh
Confidence            6779999999988888866    5778999998876555577777 44443


No 57 
>KOG2785|consensus
Probab=94.91  E-value=0.16  Score=33.54  Aligned_cols=50  Identities=22%  Similarity=0.553  Sum_probs=34.9

Q ss_pred             cccCCCCCcCCChhhHHHHHHhhcC-----------------------CCCccCcccc---cccCCHHHHHHHHHH
Q psy10762         65 FPCQYCPKAFTRKDHLVNHVRRHTG-----------------------ESPHKCTYCM---KSFTRKEHLTNHIRQ  114 (126)
Q Consensus        65 ~~C~~C~~~~~~~~~l~~h~~~~~~-----------------------~~~~~C~~C~---~~f~~~~~l~~H~~~  114 (126)
                      -.|-.|++.+.+...-..|+..+++                       ..-+.|..|+   +.|.+....+.||..
T Consensus       167 t~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  167 TDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             cceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            4577787777777777777765543                       1346777787   788887777888754


No 58 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=94.85  E-value=0.064  Score=29.24  Aligned_cols=48  Identities=17%  Similarity=0.275  Sum_probs=24.0

Q ss_pred             cCCCCCcCCChhhHHHHHHhhcCCCCccCcccccccCCHHHHHHHHHHhh
Q psy10762         67 CQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQHT  116 (126)
Q Consensus        67 C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  116 (126)
                      |-.|...|.......  ...-.....|.|+.|...|=..-+.-.|...|.
T Consensus        58 C~~C~~~f~~~~~~~--~~~~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        58 CFGCQGPFPKPPVSP--FDELKDSHRYVCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             ccCcCCCCCCccccc--ccccccccceeCCCCCCccccccchhhhhhccC
Confidence            666666665432100  000122345777777777765555555555443


No 59 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.48  E-value=0.0062  Score=40.50  Aligned_cols=58  Identities=36%  Similarity=0.705  Sum_probs=45.8

Q ss_pred             CcccCCCCCcCCChhhHHHHHH--hhcCC--CCccCc--ccccccCCHHHHHHHHHHhhhcccc
Q psy10762         64 PFPCQYCPKAFTRKDHLVNHVR--RHTGE--SPHKCT--YCMKSFTRKEHLTNHIRQHTVRRVN  121 (126)
Q Consensus        64 ~~~C~~C~~~~~~~~~l~~h~~--~~~~~--~~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~  121 (126)
                      ++.|..|...|.....+..|.+  .|.++  +++.|+  .|++.|.+...+..|..+|+.....
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~  352 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPA  352 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCcc
Confidence            5677778888888888888888  78888  888888  6888888888888888777765543


No 60 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=94.48  E-value=0.027  Score=22.30  Aligned_cols=10  Identities=30%  Similarity=0.647  Sum_probs=5.9

Q ss_pred             cCcccccccC
Q psy10762         94 KCTYCMKSFT  103 (126)
Q Consensus        94 ~C~~C~~~f~  103 (126)
                      .|+.||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            4666666653


No 61 
>KOG1146|consensus
Probab=94.46  E-value=0.01  Score=44.58  Aligned_cols=75  Identities=24%  Similarity=0.368  Sum_probs=49.2

Q ss_pred             hcCCCCcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcCCChhhHHHHHHh------hcCCCCccCcccccccCC
Q psy10762         31 HTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHVRR------HTGESPHKCTYCMKSFTR  104 (126)
Q Consensus        31 h~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~------~~~~~~~~C~~C~~~f~~  104 (126)
                      ++..+.+.|+.|++.+.....|..|++..+.+-.-  ..|.       ..+.|.+.      -.+.++|.|..|..++..
T Consensus       460 ~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~--~~c~-------~gq~~~~~arg~~~~~~~~p~~C~~C~~sttt  530 (1406)
T KOG1146|consen  460 HSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQS--AYCK-------AGQNHPRLARGEVYRCPGKPYPCRACNYSTTT  530 (1406)
T ss_pred             ecccccccCCccchhhhhHHHhhhcccccccccch--hHhH-------hccccccccccccccCCCCcccceeeeeeeec
Confidence            34446678888998888888888888864443211  1121       11111111      123578999999999999


Q ss_pred             HHHHHHHHHH
Q psy10762        105 KEHLTNHIRQ  114 (126)
Q Consensus       105 ~~~l~~H~~~  114 (126)
                      ...|.+|+..
T Consensus       531 ng~LsihlqS  540 (1406)
T KOG1146|consen  531 NGNLSIHLQS  540 (1406)
T ss_pred             chHHHHHHHH
Confidence            9999999755


No 62 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=94.23  E-value=0.034  Score=26.09  Aligned_cols=27  Identities=33%  Similarity=0.730  Sum_probs=17.1

Q ss_pred             CCCcceeccccccccCChhHHHHHHHh
Q psy10762          4 TGETPHRCDYCAKTFTRKEHLVNHVRQ   30 (126)
Q Consensus         4 ~~~~~~~C~~C~~~f~~~~~l~~h~~~   30 (126)
                      .|+.-+.|+-|+..|....++..|...
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhH
Confidence            345556677777777666666666543


No 63 
>KOG1146|consensus
Probab=94.16  E-value=0.0076  Score=45.26  Aligned_cols=103  Identities=17%  Similarity=0.275  Sum_probs=58.4

Q ss_pred             eeccccccccCChhHHHHHHHhhc----CCCCcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcCCChhhHHHHH
Q psy10762          9 HRCDYCAKTFTRKEHLVNHVRQHT----GESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHV   84 (126)
Q Consensus         9 ~~C~~C~~~f~~~~~l~~h~~~h~----~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~   84 (126)
                      ..|.+|...|........+-.-..    ....+.|..|.+.+.....+. ++.   ....|.|..|...|.....+..|.
T Consensus      1229 l~~~~~e~~f~~~~~~~~~a~~~~~~~~~sGe~~c~~~~~~~~~~~~~~-~l~---~~~~~~~~~~~~~~~~~~~l~~~~ 1304 (1406)
T KOG1146|consen 1229 LLPNALEQPFPQEPEPTATAPPKPPELPASGEGECGAVDELLTPSFGIS-TLD---VTHRYLCRQCKMAFDGEAPLTAHQ 1304 (1406)
T ss_pred             ccHHhhhcCccCcccccccCCCCCCcCcCCCcchhhhccccccCcccee-ecc---cchhHHHHHHHhhhcchhHHHHHH
Confidence            345556666665554433321110    011244555555555544433 221   223466777777777766666666


Q ss_pred             Hhh-----------------cCCCCccCcccccccCCHHHHHHHHHHhh
Q psy10762         85 RRH-----------------TGESPHKCTYCMKSFTRKEHLTNHIRQHT  116 (126)
Q Consensus        85 ~~~-----------------~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  116 (126)
                      +..                 ..-..| |..|...|+....|..|+++..
T Consensus      1305 ~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~c~~~~~~~~alqihm~~~~ 1352 (1406)
T KOG1146|consen 1305 RKFCFAGRGSGGSMPPPLRVPDCTYH-CLACEVLLSGREALQIHMRSSA 1352 (1406)
T ss_pred             HHHHhccCccccCCCCcccCcccccc-chHHHhhcchhHHHHHHHHHhh
Confidence            421                 112345 9999999999999999999843


No 64 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=93.91  E-value=0.056  Score=25.78  Aligned_cols=11  Identities=27%  Similarity=0.679  Sum_probs=6.0

Q ss_pred             CCCccCccccc
Q psy10762         90 ESPHKCTYCMK  100 (126)
Q Consensus        90 ~~~~~C~~C~~  100 (126)
                      ..+|.|+.||.
T Consensus        48 g~~Y~Cp~CGF   58 (61)
T COG2888          48 GNPYRCPKCGF   58 (61)
T ss_pred             CCceECCCcCc
Confidence            34566666653


No 65 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=93.73  E-value=0.05  Score=23.46  Aligned_cols=32  Identities=25%  Similarity=0.624  Sum_probs=15.3

Q ss_pred             ccCCCCCcCCChhhHHHHHHhhcCCCCccCccccccc
Q psy10762         66 PCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSF  102 (126)
Q Consensus        66 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f  102 (126)
                      .||.|+..|.-...     ++-.+....+|+.|+-.|
T Consensus         4 ~CP~C~~~f~v~~~-----~l~~~~~~vrC~~C~~~f   35 (37)
T PF13719_consen    4 TCPNCQTRFRVPDD-----KLPAGGRKVRCPKCGHVF   35 (37)
T ss_pred             ECCCCCceEEcCHH-----HcccCCcEEECCCCCcEe
Confidence            46666655544322     111223445666666555


No 66 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=93.53  E-value=0.061  Score=23.04  Aligned_cols=32  Identities=19%  Similarity=0.487  Sum_probs=16.6

Q ss_pred             ccCCCCCcCCChhhHHHHHHhhcCCCCccCccccccc
Q psy10762         66 PCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSF  102 (126)
Q Consensus        66 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f  102 (126)
                      .|+.|+..|.-....     +-......+|+.|+..|
T Consensus         4 ~Cp~C~~~y~i~d~~-----ip~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    4 TCPNCQAKYEIDDEK-----IPPKGRKVRCSKCGHVF   35 (36)
T ss_pred             ECCCCCCEEeCCHHH-----CCCCCcEEECCCCCCEe
Confidence            566666665444331     22233445676676655


No 67 
>KOG2186|consensus
Probab=93.50  E-value=0.052  Score=33.75  Aligned_cols=48  Identities=27%  Similarity=0.509  Sum_probs=31.8

Q ss_pred             CcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcCCChhhHHHHHHh
Q psy10762         36 PHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHVRR   86 (126)
Q Consensus        36 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~   86 (126)
                      .|.|..||.+..-. .+.+|+..-.+ .-|.|..|+..|-. .+...|..-
T Consensus         3 ~FtCnvCgEsvKKp-~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kC   50 (276)
T KOG2186|consen    3 FFTCNVCGESVKKP-QVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKC   50 (276)
T ss_pred             EEehhhhhhhcccc-chHHHHHhccC-CeeEEeeccccccc-chhhhhhhh
Confidence            36788888766543 35667766656 46788888888876 455566543


No 68 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=93.45  E-value=0.11  Score=33.98  Aligned_cols=74  Identities=23%  Similarity=0.450  Sum_probs=43.8

Q ss_pred             ccCCcccccCCchHHHHHHhhhcCCCCcccCCCC----CcCCChhhHHHHHHhhcCCCCccCcc--cc----cccCCHHH
Q psy10762         38 HCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCP----KAFTRKDHLVNHVRRHTGESPHKCTY--CM----KSFTRKEH  107 (126)
Q Consensus        38 ~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~----~~~~~~~~l~~h~~~~~~~~~~~C~~--C~----~~f~~~~~  107 (126)
                      .|.+|...|.+...|..|++..+.. -|.|..-+    +-|.+-.+|..|.+    ...|.|.+  |.    .+|.....
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~HE~-ChICD~v~p~~~QYFK~Y~~Le~HF~----~~hy~ct~qtc~~~k~~vf~~~~e  296 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRHEA-CHICDMVGPIRYQYFKSYEDLEAHFR----NAHYCCTFQTCRVGKCYVFPYHTE  296 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhhhh-hhhhhccCccchhhhhCHHHHHHHhh----cCceEEEEEEEecCcEEEeccHHH
Confidence            4777887788888888887765542 23443322    23444455555544    23466643  42    46888888


Q ss_pred             HHHHHHHhh
Q psy10762        108 LTNHIRQHT  116 (126)
Q Consensus       108 l~~H~~~h~  116 (126)
                      |..|+..-+
T Consensus       297 l~~h~~~~h  305 (493)
T COG5236         297 LLEHLTRFH  305 (493)
T ss_pred             HHHHHHHHh
Confidence            888865533


No 69 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=93.36  E-value=0.034  Score=34.70  Aligned_cols=42  Identities=17%  Similarity=0.612  Sum_probs=22.7

Q ss_pred             CCCCCcceeccccccccCChhHHHHHHHhh--cCCCCcccCCccc
Q psy10762          2 WHTGETPHRCDYCAKTFTRKEHLVNHVRQH--TGESPHHCNYCAK   44 (126)
Q Consensus         2 ~~~~~~~~~C~~C~~~f~~~~~l~~h~~~h--~~~~~~~c~~C~~   44 (126)
                      |..|++.|.|..|...... ..--.|+..-  .....|+|.-|+.
T Consensus       136 w~hGGrif~CsfC~~flCE-DDQFEHQAsCQvLe~E~~KC~SCNr  179 (314)
T PF06524_consen  136 WDHGGRIFKCSFCDNFLCE-DDQFEHQASCQVLESETFKCQSCNR  179 (314)
T ss_pred             ccCCCeEEEeecCCCeeec-cchhhhhhhhhhhhccccccccccc
Confidence            5677888888888774433 2333344322  1223466666653


No 70 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=93.01  E-value=0.062  Score=29.21  Aligned_cols=12  Identities=25%  Similarity=0.717  Sum_probs=6.1

Q ss_pred             eeccccccccCC
Q psy10762          9 HRCDYCAKTFTR   20 (126)
Q Consensus         9 ~~C~~C~~~f~~   20 (126)
                      ..|+.||..|..
T Consensus        10 R~Cp~CG~kFYD   21 (108)
T PF09538_consen   10 RTCPSCGAKFYD   21 (108)
T ss_pred             ccCCCCcchhcc
Confidence            445555555544


No 71 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=92.67  E-value=0.073  Score=22.94  Aligned_cols=10  Identities=20%  Similarity=0.673  Sum_probs=5.6

Q ss_pred             ccCccccccc
Q psy10762         93 HKCTYCMKSF  102 (126)
Q Consensus        93 ~~C~~C~~~f  102 (126)
                      ..|+.|+..|
T Consensus        26 v~C~~C~~~~   35 (38)
T TIGR02098        26 VRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEE
Confidence            4566665554


No 72 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=92.60  E-value=0.019  Score=35.17  Aligned_cols=44  Identities=20%  Similarity=0.416  Sum_probs=26.6

Q ss_pred             CcceeccccccccCChhHHHHHHHhh---c-------CCC-----CcccCCcccccCCc
Q psy10762          6 ETPHRCDYCAKTFTRKEHLVNHVRQH---T-------GES-----PHHCNYCAKSFTRK   49 (126)
Q Consensus         6 ~~~~~C~~C~~~f~~~~~l~~h~~~h---~-------~~~-----~~~c~~C~~~~~~~   49 (126)
                      ++...|+.|+..|..........+.-   .       +..     .+.|+.||.++...
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            46788999999998875544443221   1       111     24677787776544


No 73 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=92.57  E-value=0.42  Score=25.94  Aligned_cols=26  Identities=19%  Similarity=0.315  Sum_probs=22.6

Q ss_pred             CccC----cccccccCCHHHHHHHHHHhhh
Q psy10762         92 PHKC----TYCMKSFTRKEHLTNHIRQHTV  117 (126)
Q Consensus        92 ~~~C----~~C~~~f~~~~~l~~H~~~h~~  117 (126)
                      -|.|    ..|+....+...|++|++.+++
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            4789    8999999999999999988764


No 74 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.38  E-value=0.091  Score=22.20  Aligned_cols=9  Identities=22%  Similarity=0.704  Sum_probs=4.3

Q ss_pred             cccCCCCCc
Q psy10762         65 FPCQYCPKA   73 (126)
Q Consensus        65 ~~C~~C~~~   73 (126)
                      |.|..||..
T Consensus         3 ~~C~~CG~i   11 (34)
T cd00729           3 WVCPVCGYI   11 (34)
T ss_pred             EECCCCCCE
Confidence            445555443


No 75 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=92.20  E-value=0.32  Score=26.59  Aligned_cols=86  Identities=20%  Similarity=0.430  Sum_probs=52.3

Q ss_pred             CcceeccccccccCChhHHHHHHHhhcCCCCc------------ccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCc
Q psy10762          6 ETPHRCDYCAKTFTRKEHLVNHVRQHTGESPH------------HCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKA   73 (126)
Q Consensus         6 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~------------~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~   73 (126)
                      +.|..|+.|+.+.-+...|......-...++|            .|--|...|........  ........|+|+.|...
T Consensus        13 ~LP~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~--~~~~~~~~y~C~~C~~~   90 (112)
T TIGR00622        13 ELPVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPF--DELKDSHRYVCAVCKNV   90 (112)
T ss_pred             CCCCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCcccccc--cccccccceeCCCCCCc
Confidence            46788999999887777766553211111111            26667777765421100  00123346999999999


Q ss_pred             CCChhhHHHHHHhhcCCCCccCcccc
Q psy10762         74 FTRKDHLVNHVRRHTGESPHKCTYCM   99 (126)
Q Consensus        74 ~~~~~~l~~h~~~~~~~~~~~C~~C~   99 (126)
                      |-..-+...|...|.      |+-|.
T Consensus        91 FC~dCD~fiHe~Lh~------CPGC~  110 (112)
T TIGR00622        91 FCVDCDVFVHESLHC------CPGCI  110 (112)
T ss_pred             cccccchhhhhhccC------CcCCC
Confidence            988877777766663      66554


No 76 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.15  E-value=0.043  Score=36.56  Aligned_cols=57  Identities=40%  Similarity=0.746  Sum_probs=28.1

Q ss_pred             cccCCcccccCCchHHHHHHh--hhcCC--CCcccC--CCCCcCCChhhHHHHHHhhcCCCCc
Q psy10762         37 HHCNYCAKSFTRKDHMVYHER--QHTGE--TPFPCQ--YCPKAFTRKDHLVNHVRRHTGESPH   93 (126)
Q Consensus        37 ~~c~~C~~~~~~~~~l~~h~~--~~~~~--~~~~C~--~C~~~~~~~~~l~~h~~~~~~~~~~   93 (126)
                      +.|..|...+.....+..|..  .|.++  +++.|+  .|++.|.+...+..|...+.+..++
T Consensus       290 ~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~  352 (467)
T COG5048         290 IKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPA  352 (467)
T ss_pred             CCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCcc
Confidence            344445555555555555554  45555  455555  4555555555555555554444433


No 77 
>KOG2231|consensus
Probab=92.14  E-value=0.22  Score=35.61  Aligned_cols=74  Identities=22%  Similarity=0.495  Sum_probs=46.8

Q ss_pred             cCCcccccCCchHHHHHHhhhcCCCCcccCCC----------CCcCCChhhHHHHHHhhcC-C---CC-ccCcccccccC
Q psy10762         39 CNYCAKSFTRKDHMVYHERQHTGETPFPCQYC----------PKAFTRKDHLVNHVRRHTG-E---SP-HKCTYCMKSFT  103 (126)
Q Consensus        39 c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C----------~~~~~~~~~l~~h~~~~~~-~---~~-~~C~~C~~~f~  103 (126)
                      |..| -.|.....|..|+...+..  +.|..|          .+.| +...|+.|++..-- +   +. -.|+.|...|-
T Consensus       118 ~~~c-~~~~s~~~Lk~H~~~~H~~--~~c~lC~~~~kif~~e~k~Y-t~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fl  193 (669)
T KOG2231|consen  118 CLHC-TEFKSVENLKNHMRDQHKL--HLCSLCLQNLKIFINERKLY-TRAELNLHLMFGDPDDESCRGHPLCKFCHERFL  193 (669)
T ss_pred             Cccc-cchhHHHHHHHHHHHhhhh--hccccccccceeeeeeeehe-hHHHHHHHHhcCCCccccccCCccchhhhhhhc
Confidence            3344 3444778899998655442  344443          2333 34567777765321 2   11 35889999999


Q ss_pred             CHHHHHHHHHHhh
Q psy10762        104 RKEHLTNHIRQHT  116 (126)
Q Consensus       104 ~~~~l~~H~~~h~  116 (126)
                      ....|.+|++.++
T Consensus       194 d~~el~rH~~~~h  206 (669)
T KOG2231|consen  194 DDDELYRHLRFDH  206 (669)
T ss_pred             cHHHHHHhhccce
Confidence            9999999998654


No 78 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=92.00  E-value=0.14  Score=23.00  Aligned_cols=29  Identities=17%  Similarity=0.361  Sum_probs=17.5

Q ss_pred             ceeccccccccCChhHHHHHHHhhcCCCCcccCCcccccC
Q psy10762          8 PHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFT   47 (126)
Q Consensus         8 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~   47 (126)
                      .|.|..||..|...           ...+..|+.||....
T Consensus         2 ~Y~C~~Cg~~~~~~-----------~~~~irC~~CG~rIl   30 (44)
T smart00659        2 IYICGECGRENEIK-----------SKDVVRCRECGYRIL   30 (44)
T ss_pred             EEECCCCCCEeecC-----------CCCceECCCCCceEE
Confidence            36777787766432           223467777776543


No 79 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=91.97  E-value=0.17  Score=29.56  Aligned_cols=33  Identities=18%  Similarity=0.302  Sum_probs=23.6

Q ss_pred             CCCCcccCCCCCcCCChhhHHHHHHhhcCCCCccCccccccc
Q psy10762         61 GETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSF  102 (126)
Q Consensus        61 ~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f  102 (126)
                      ...-|.||.|+..|+...++.         ..|.|+.||...
T Consensus       106 ~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       106 NNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAML  138 (158)
T ss_pred             CCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEe
Confidence            344588888888887776653         368888888754


No 80 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=91.80  E-value=0.05  Score=25.26  Aligned_cols=12  Identities=33%  Similarity=0.808  Sum_probs=7.6

Q ss_pred             eeccccccccCC
Q psy10762          9 HRCDYCAKTFTR   20 (126)
Q Consensus         9 ~~C~~C~~~f~~   20 (126)
                      |.|..|+..|..
T Consensus         6 y~C~~Cg~~fe~   17 (52)
T TIGR02605         6 YRCTACGHRFEV   17 (52)
T ss_pred             EEeCCCCCEeEE
Confidence            667777766643


No 81 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=91.76  E-value=0.21  Score=29.15  Aligned_cols=37  Identities=22%  Similarity=0.340  Sum_probs=25.0

Q ss_pred             hhcCCCCcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcCC
Q psy10762         30 QHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFT   75 (126)
Q Consensus        30 ~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~   75 (126)
                      ...+..-|.|+.|+..|.....+.         ..|.||.||..+.
T Consensus       103 ~e~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L~  139 (158)
T TIGR00373       103 FETNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAMLD  139 (158)
T ss_pred             hccCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEee
Confidence            334455688988887777665553         2589999987543


No 82 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=91.63  E-value=0.18  Score=24.11  Aligned_cols=10  Identities=30%  Similarity=0.687  Sum_probs=5.1

Q ss_pred             CCccCccccc
Q psy10762         91 SPHKCTYCMK  100 (126)
Q Consensus        91 ~~~~C~~C~~  100 (126)
                      .+|.|+.||.
T Consensus        47 ~~Y~CP~CGF   56 (59)
T PRK14890         47 NPYTCPKCGF   56 (59)
T ss_pred             CceECCCCCC
Confidence            4455555543


No 83 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=91.48  E-value=0.18  Score=27.39  Aligned_cols=26  Identities=23%  Similarity=0.496  Sum_probs=22.4

Q ss_pred             Cccc----CCCCCcCCChhhHHHHHHhhcC
Q psy10762         64 PFPC----QYCPKAFTRKDHLVNHVRRHTG   89 (126)
Q Consensus        64 ~~~C----~~C~~~~~~~~~l~~h~~~~~~   89 (126)
                      .|.|    ..|+....+...+.+|++.++|
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            3789    8999999999999999987653


No 84 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=90.75  E-value=0.61  Score=30.72  Aligned_cols=48  Identities=31%  Similarity=0.566  Sum_probs=25.9

Q ss_pred             ccCCCCCcCCChhhHHHHHHhhcCCCCccCccc----ccccCCHHHHHHHHHH
Q psy10762         66 PCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYC----MKSFTRKEHLTNHIRQ  114 (126)
Q Consensus        66 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C----~~~f~~~~~l~~H~~~  114 (126)
                      .|-.|..-|-....|..|.+.-+ ++=|.|..-    ..-|.+..+|.+|.+.
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~H-E~ChICD~v~p~~~QYFK~Y~~Le~HF~~  273 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRH-EACHICDMVGPIRYQYFKSYEDLEAHFRN  273 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhh-hhhhhhhccCccchhhhhCHHHHHHHhhc
Confidence            46666666666667767666432 222333221    1336666666666554


No 85 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=90.64  E-value=0.21  Score=29.74  Aligned_cols=33  Identities=21%  Similarity=0.461  Sum_probs=23.2

Q ss_pred             CCCcccCCCCCcCCChhhHHHHHHhhcCCCCccCcccccccC
Q psy10762         62 ETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFT  103 (126)
Q Consensus        62 ~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~  103 (126)
                      ..-|.|+.|+..|+...++.         ..|.|+.||....
T Consensus       115 ~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L~  147 (178)
T PRK06266        115 NMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEMLE  147 (178)
T ss_pred             CCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCCe
Confidence            34588888888887766542         3688988887643


No 86 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=90.42  E-value=0.059  Score=31.24  Aligned_cols=13  Identities=38%  Similarity=0.577  Sum_probs=8.7

Q ss_pred             cccCCCCCcCCCh
Q psy10762         65 FPCQYCPKAFTRK   77 (126)
Q Consensus        65 ~~C~~C~~~~~~~   77 (126)
                      ++|+.||..|...
T Consensus        29 ~~c~~c~~~f~~~   41 (154)
T PRK00464         29 RECLACGKRFTTF   41 (154)
T ss_pred             eeccccCCcceEe
Confidence            6677777766554


No 87 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=90.17  E-value=0.55  Score=27.05  Aligned_cols=38  Identities=13%  Similarity=0.387  Sum_probs=23.5

Q ss_pred             CCCCcccCCCCCcCCChhhHHHHHHhhcCCCCccCccccccc
Q psy10762         61 GETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSF  102 (126)
Q Consensus        61 ~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f  102 (126)
                      ...-|.||.|+..|.....+.. .  . ....|.|+.||...
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~-~--d-~~~~f~Cp~Cg~~l  133 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQL-L--D-MDGTFTCPRCGEEL  133 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHh-c--C-CCCcEECCCCCCEE
Confidence            3346889999888875443321 0  1 13348899998765


No 88 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=90.14  E-value=0.23  Score=29.18  Aligned_cols=23  Identities=30%  Similarity=0.795  Sum_probs=17.2

Q ss_pred             CcccCCCCCcCCChhhHHHHHHhhcCCCCccCcccc
Q psy10762         64 PFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCM   99 (126)
Q Consensus        64 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~   99 (126)
                      .|.|++||..+             .++-|-+||+||
T Consensus       134 ~~vC~vCGy~~-------------~ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYTH-------------EGEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCcc-------------cCCCCCcCCCCC
Confidence            68999997543             346678899997


No 89 
>KOG4173|consensus
Probab=90.13  E-value=0.14  Score=30.95  Aligned_cols=75  Identities=19%  Similarity=0.538  Sum_probs=53.3

Q ss_pred             ceeccc--cccccCChhHHHHHHHhhcCCCCcccCCcccccCCchHHHHHHhhh----------cCCCCcccCC--CCCc
Q psy10762          8 PHRCDY--CAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQH----------TGETPFPCQY--CPKA   73 (126)
Q Consensus         8 ~~~C~~--C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~----------~~~~~~~C~~--C~~~   73 (126)
                      .|.|++  |-..|.....+..|..+-++   -.|.+|...|+....|..|+...          .|..-|+|-+  |+.-
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~K  155 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEK  155 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhh
Confidence            366765  66777777777777655443   36899999999988888886532          3445588864  8888


Q ss_pred             CCChhhHHHHHH
Q psy10762         74 FTRKDHLVNHVR   85 (126)
Q Consensus        74 ~~~~~~l~~h~~   85 (126)
                      |.+......|+-
T Consensus       156 FkT~r~RkdH~I  167 (253)
T KOG4173|consen  156 FKTSRDRKDHMI  167 (253)
T ss_pred             hhhhhhhhhHHH
Confidence            888777777764


No 90 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=90.05  E-value=0.14  Score=23.20  Aligned_cols=11  Identities=18%  Similarity=0.794  Sum_probs=5.9

Q ss_pred             CcccCCCCCcC
Q psy10762         64 PFPCQYCPKAF   74 (126)
Q Consensus        64 ~~~C~~C~~~~   74 (126)
                      .|.|+.||..+
T Consensus         3 ~y~C~~CG~~~   13 (46)
T PRK00398          3 EYKCARCGREV   13 (46)
T ss_pred             EEECCCCCCEE
Confidence            35566665544


No 91 
>KOG2186|consensus
Probab=90.04  E-value=0.29  Score=30.64  Aligned_cols=48  Identities=19%  Similarity=0.465  Sum_probs=36.4

Q ss_pred             ceeccccccccCChhHHHHHHHhhcCCCCcccCCcccccCCchHHHHHHhh
Q psy10762          8 PHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQ   58 (126)
Q Consensus         8 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~   58 (126)
                      -|.|..||....-. .+..|+....+ .-|.|-.|+..|.. .++..|...
T Consensus         3 ~FtCnvCgEsvKKp-~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kC   50 (276)
T KOG2186|consen    3 FFTCNVCGESVKKP-QVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKC   50 (276)
T ss_pred             EEehhhhhhhcccc-chHHHHHhccC-CeeEEeeccccccc-chhhhhhhh
Confidence            37899999887664 56678877766 56889999999887 667777653


No 92 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=89.84  E-value=0.37  Score=28.72  Aligned_cols=35  Identities=23%  Similarity=0.472  Sum_probs=23.5

Q ss_pred             CCCCcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcCCC
Q psy10762         33 GESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTR   76 (126)
Q Consensus        33 ~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~   76 (126)
                      +..-|.|+.|+..|.....+.         ..|.||.||..+..
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L~~  148 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEMLEE  148 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCCee
Confidence            345688888887776655432         25889999876543


No 93 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=89.75  E-value=0.097  Score=22.83  Aligned_cols=11  Identities=45%  Similarity=1.087  Sum_probs=6.7

Q ss_pred             eeccccccccC
Q psy10762          9 HRCDYCAKTFT   19 (126)
Q Consensus         9 ~~C~~C~~~f~   19 (126)
                      |.|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (41)
T smart00834        6 YRCEDCGHTFE   16 (41)
T ss_pred             EEcCCCCCEEE
Confidence            56666666554


No 94 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=89.50  E-value=0.27  Score=27.77  Aligned_cols=26  Identities=27%  Similarity=0.390  Sum_probs=16.6

Q ss_pred             CCCccCcccccccCCHHHHHHHHHHhhhc
Q psy10762         90 ESPHKCTYCMKSFTRKEHLTNHIRQHTVR  118 (126)
Q Consensus        90 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~  118 (126)
                      .....|.+||+.|...   .+|++.|++-
T Consensus        70 ~d~i~clecGk~~k~L---krHL~~~~gl   95 (132)
T PF05443_consen   70 PDYIICLECGKKFKTL---KRHLRTHHGL   95 (132)
T ss_dssp             SS-EE-TBT--EESBH---HHHHHHTT-S
T ss_pred             cCeeEEccCCcccchH---HHHHHHccCC
Confidence            3456899999999965   8999998643


No 95 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=89.47  E-value=0.43  Score=21.23  Aligned_cols=24  Identities=29%  Similarity=0.686  Sum_probs=13.3

Q ss_pred             CCCccCcccccccCCH----HHHHHHHH
Q psy10762         90 ESPHKCTYCMKSFTRK----EHLTNHIR  113 (126)
Q Consensus        90 ~~~~~C~~C~~~f~~~----~~l~~H~~  113 (126)
                      .....|..|++.+...    +.|.+|++
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL~   41 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHLK   41 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHHH
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhhh
Confidence            3445677787777654    67777773


No 96 
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=88.86  E-value=0.26  Score=23.46  Aligned_cols=26  Identities=27%  Similarity=0.666  Sum_probs=12.0

Q ss_pred             hHHHHHHhhcCCCCccCcc----cccccCC
Q psy10762         79 HLVNHVRRHTGESPHKCTY----CMKSFTR  104 (126)
Q Consensus        79 ~l~~h~~~~~~~~~~~C~~----C~~~f~~  104 (126)
                      .|..|+...-..++..|+.    |+..+..
T Consensus        25 ~l~~H~~~~C~~~~v~C~~~~~GC~~~~~~   54 (60)
T PF02176_consen   25 ELDDHLENECPKRPVPCPYSPYGCKERVPR   54 (60)
T ss_dssp             CHHHHHHTTSTTSEEE-SS----S--EEEH
T ss_pred             HHHHHHHccCCCCcEECCCCCCCCCCccch
Confidence            5556666443444555655    6555543


No 97 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=88.45  E-value=0.31  Score=27.17  Aligned_cols=31  Identities=16%  Similarity=0.341  Sum_probs=16.0

Q ss_pred             ceeccccccccCChhHHHHHHHhhcCCCCcccCCcccccCCc
Q psy10762          8 PHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRK   49 (126)
Q Consensus         8 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~   49 (126)
                      ...|+.||..|....           ..|..|+.||..|...
T Consensus         9 Kr~Cp~cg~kFYDLn-----------k~p~vcP~cg~~~~~~   39 (129)
T TIGR02300         9 KRICPNTGSKFYDLN-----------RRPAVSPYTGEQFPPE   39 (129)
T ss_pred             cccCCCcCccccccC-----------CCCccCCCcCCccCcc
Confidence            345666666664432           2345566666555443


No 98 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=87.80  E-value=0.41  Score=22.03  Aligned_cols=20  Identities=45%  Similarity=1.019  Sum_probs=12.1

Q ss_pred             cCcccccccCCH-----HHHHHHHH
Q psy10762         94 KCTYCMKSFTRK-----EHLTNHIR  113 (126)
Q Consensus        94 ~C~~C~~~f~~~-----~~l~~H~~  113 (126)
                      .|..|++.++..     +.|.+|+.
T Consensus        20 ~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       20 KCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EecCCCCEeeeCCCCCcHHHHHHHH
Confidence            466666665443     46777765


No 99 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=87.23  E-value=0.73  Score=18.11  Aligned_cols=19  Identities=16%  Similarity=0.704  Sum_probs=11.6

Q ss_pred             cCcccccccCCHHHHHHHHH
Q psy10762         94 KCTYCMKSFTRKEHLTNHIR  113 (126)
Q Consensus        94 ~C~~C~~~f~~~~~l~~H~~  113 (126)
                      .|++|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            577777776 3345556653


No 100
>PRK04023 DNA polymerase II large subunit; Validated
Probab=87.03  E-value=0.83  Score=34.42  Aligned_cols=10  Identities=20%  Similarity=0.710  Sum_probs=6.0

Q ss_pred             CccCcccccc
Q psy10762         92 PHKCTYCMKS  101 (126)
Q Consensus        92 ~~~C~~C~~~  101 (126)
                      ++.|+.|+..
T Consensus       663 ~y~CPKCG~E  672 (1121)
T PRK04023        663 EDECEKCGRE  672 (1121)
T ss_pred             CCcCCCCCCC
Confidence            3557777654


No 101
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=86.37  E-value=4.8  Score=23.58  Aligned_cols=104  Identities=14%  Similarity=0.244  Sum_probs=50.5

Q ss_pred             cccccCChhHHHHHHHhhcCCCCcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCC-cCCChhhHHHHHHhhcCCCC
Q psy10762         14 CAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPK-AFTRKDHLVNHVRRHTGESP   92 (126)
Q Consensus        14 C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~-~~~~~~~l~~h~~~~~~~~~   92 (126)
                      |+..+....-|.+-...+.......-..-.......... . ...........||.|.. ++.+...  ...+.+...|+
T Consensus        32 c~Ts~rhSNCLdqfkka~~~~~~~~~~~~~~~~~~~~~~-~-~~~~~~~~~L~CPLCRG~V~GWtvv--e~AR~~LN~K~  107 (162)
T PF07800_consen   32 CDTSYRHSNCLDQFKKAYGKSSSSSSQSSSSAPSDSSSS-E-SSESQEQPELACPLCRGEVKGWTVV--EPARRFLNAKK  107 (162)
T ss_pred             cCCccchhHHHHHHHHHhcCCCCccccccccCcCCCccc-c-cccccccccccCccccCceeceEEc--hHHHHHhccCC
Confidence            666777777777777666543321111000000000000 0 01111222457898853 3333211  23455666777


Q ss_pred             ccCcc--cccccCCHHHHHHHHHH-hhhccccC
Q psy10762         93 HKCTY--CMKSFTRKEHLTNHIRQ-HTVRRVND  122 (126)
Q Consensus        93 ~~C~~--C~~~f~~~~~l~~H~~~-h~~~~~~~  122 (126)
                      -.|..  |..+- +...|++|.+. |-..++.+
T Consensus       108 RsC~~e~C~F~G-tY~eLrKHar~~HP~~rP~~  139 (162)
T PF07800_consen  108 RSCSQESCSFSG-TYSELRKHARSEHPSARPSE  139 (162)
T ss_pred             ccCccccccccc-CHHHHHHHHHhhCCCCCCcc
Confidence            77865  55443 35589999777 44444443


No 102
>KOG3408|consensus
Probab=85.97  E-value=0.5  Score=26.13  Aligned_cols=26  Identities=23%  Similarity=0.565  Sum_probs=18.3

Q ss_pred             CCCCccCcccccccCCHHHHHHHHHH
Q psy10762         89 GESPHKCTYCMKSFTRKEHLTNHIRQ  114 (126)
Q Consensus        89 ~~~~~~C~~C~~~f~~~~~l~~H~~~  114 (126)
                      |...|.|-.|.+-|.....|..|.+.
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            33446677788888877777777665


No 103
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=85.65  E-value=0.077  Score=23.32  Aligned_cols=12  Identities=25%  Similarity=0.445  Sum_probs=8.4

Q ss_pred             CccCcccccccC
Q psy10762         92 PHKCTYCMKSFT  103 (126)
Q Consensus        92 ~~~C~~C~~~f~  103 (126)
                      .|.|..|+..|.
T Consensus        28 fy~C~~C~~~w~   39 (40)
T smart00440       28 FYVCTKCGHRWR   39 (40)
T ss_pred             EEEeCCCCCEeC
Confidence            377877877664


No 104
>PF14353 CpXC:  CpXC protein
Probab=85.56  E-value=0.73  Score=25.76  Aligned_cols=16  Identities=31%  Similarity=0.677  Sum_probs=9.4

Q ss_pred             cccCCCCCcCCChhhH
Q psy10762         65 FPCQYCPKAFTRKDHL   80 (126)
Q Consensus        65 ~~C~~C~~~~~~~~~l   80 (126)
                      +.||.||..+.-...+
T Consensus        39 ~~CP~Cg~~~~~~~p~   54 (128)
T PF14353_consen   39 FTCPSCGHKFRLEYPL   54 (128)
T ss_pred             EECCCCCCceecCCCE
Confidence            5677777666544443


No 105
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=84.84  E-value=0.41  Score=19.93  Aligned_cols=27  Identities=22%  Similarity=0.522  Sum_probs=13.5

Q ss_pred             eeccccccccCChhHHHHHHHhhcCCCCcccCCccccc
Q psy10762          9 HRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSF   46 (126)
Q Consensus         9 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~   46 (126)
                      |.|..|+..+...           ...+..|+.||...
T Consensus         1 Y~C~~Cg~~~~~~-----------~~~~irC~~CG~RI   27 (32)
T PF03604_consen    1 YICGECGAEVELK-----------PGDPIRCPECGHRI   27 (32)
T ss_dssp             EBESSSSSSE-BS-----------TSSTSSBSSSS-SE
T ss_pred             CCCCcCCCeeEcC-----------CCCcEECCcCCCeE
Confidence            5566777665421           12245677776543


No 106
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=84.16  E-value=0.52  Score=26.59  Aligned_cols=23  Identities=26%  Similarity=0.267  Sum_probs=18.7

Q ss_pred             ccCcccccccCCHHHHHHHHHHhhhc
Q psy10762         93 HKCTYCMKSFTRKEHLTNHIRQHTVR  118 (126)
Q Consensus        93 ~~C~~C~~~f~~~~~l~~H~~~h~~~  118 (126)
                      ..|.++|+.|.   .|.+|+.+|.+-
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~gm   99 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYGL   99 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccCC
Confidence            57999999998   578999987753


No 107
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=83.53  E-value=0.81  Score=23.79  Aligned_cols=12  Identities=33%  Similarity=0.675  Sum_probs=6.6

Q ss_pred             CccCcccccccC
Q psy10762         92 PHKCTYCMKSFT  103 (126)
Q Consensus        92 ~~~C~~C~~~f~  103 (126)
                      -|.|..|+..|.
T Consensus        53 IW~C~kCg~~fA   64 (89)
T COG1997          53 IWKCRKCGAKFA   64 (89)
T ss_pred             eEEcCCCCCeec
Confidence            455655655553


No 108
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=83.31  E-value=0.82  Score=28.15  Aligned_cols=29  Identities=28%  Similarity=0.505  Sum_probs=19.3

Q ss_pred             CCCccCcccccccCCHHHHHHHHHHhhhc
Q psy10762         90 ESPHKCTYCMKSFTRKEHLTNHIRQHTVR  118 (126)
Q Consensus        90 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~  118 (126)
                      +..|.|+.|+|.|.-..=.++|+..-|.+
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            44588888888888887788887764443


No 109
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=83.17  E-value=0.5  Score=34.41  Aligned_cols=12  Identities=25%  Similarity=0.637  Sum_probs=7.2

Q ss_pred             CCCcccCCCCCc
Q psy10762         62 ETPFPCQYCPKA   73 (126)
Q Consensus        62 ~~~~~C~~C~~~   73 (126)
                      ..|..||.||..
T Consensus       473 ~~p~~Cp~Cgs~  484 (730)
T COG1198         473 PIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCC
Confidence            345677777643


No 110
>PHA00626 hypothetical protein
Probab=82.10  E-value=0.71  Score=21.83  Aligned_cols=16  Identities=13%  Similarity=0.237  Sum_probs=13.0

Q ss_pred             CCCccCcccccccCCH
Q psy10762         90 ESPHKCTYCMKSFTRK  105 (126)
Q Consensus        90 ~~~~~C~~C~~~f~~~  105 (126)
                      ...|.|+.||..|+..
T Consensus        21 snrYkCkdCGY~ft~~   36 (59)
T PHA00626         21 SDDYVCCDCGYNDSKD   36 (59)
T ss_pred             CcceEcCCCCCeechh
Confidence            4679999999998754


No 111
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=81.57  E-value=0.41  Score=19.27  Aligned_cols=19  Identities=26%  Similarity=0.592  Sum_probs=11.6

Q ss_pred             eeccccccccCChhHHHHHH
Q psy10762          9 HRCDYCAKTFTRKEHLVNHV   28 (126)
Q Consensus         9 ~~C~~C~~~f~~~~~l~~h~   28 (126)
                      |.|-+|++.| ....++.|.
T Consensus         1 ~sCiDC~~~F-~~~~y~~Ht   19 (28)
T PF08790_consen    1 FSCIDCSKDF-DGDSYKSHT   19 (28)
T ss_dssp             EEETTTTEEE-EGGGTTT--
T ss_pred             CeeecCCCCc-CcCCcCCCC
Confidence            5688888888 334555554


No 112
>PTZ00448 hypothetical protein; Provisional
Probab=81.44  E-value=1.6  Score=29.06  Aligned_cols=34  Identities=21%  Similarity=0.437  Sum_probs=27.1

Q ss_pred             CccCcccccccCCHHHHHHHHHH--hh---hccccCCCC
Q psy10762         92 PHKCTYCMKSFTRKEHLTNHIRQ--HT---VRRVNDLPP  125 (126)
Q Consensus        92 ~~~C~~C~~~f~~~~~l~~H~~~--h~---~~~~~~~~p  125 (126)
                      .|.|..|+-.|......+.|++.  |.   .++...+||
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KSDwHrYNLKRkl~gLpp  352 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRSEWHIFNTKRNARKMEP  352 (373)
T ss_pred             CccccccccccCCHHHHHHHhhhhHHHHHHHHHhcCCCC
Confidence            58899999999988888999876  33   566667776


No 113
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=81.08  E-value=0.55  Score=19.24  Aligned_cols=8  Identities=25%  Similarity=0.571  Sum_probs=3.9

Q ss_pred             CcccCCcc
Q psy10762         36 PHHCNYCA   43 (126)
Q Consensus        36 ~~~c~~C~   43 (126)
                      .+.|+.|+
T Consensus        19 ~~vCp~C~   26 (30)
T PF08274_consen   19 LLVCPECG   26 (30)
T ss_dssp             SEEETTTT
T ss_pred             EEeCCccc
Confidence            34555554


No 114
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=80.87  E-value=0.71  Score=26.23  Aligned_cols=13  Identities=15%  Similarity=0.626  Sum_probs=7.5

Q ss_pred             ceeccccccccCC
Q psy10762          8 PHRCDYCAKTFTR   20 (126)
Q Consensus         8 ~~~C~~C~~~f~~   20 (126)
                      .+.|..||..|..
T Consensus        70 ~~~C~~CG~~~~~   82 (135)
T PRK03824         70 VLKCRNCGNEWSL   82 (135)
T ss_pred             EEECCCCCCEEec
Confidence            4566666655544


No 115
>KOG2482|consensus
Probab=80.86  E-value=2.4  Score=28.06  Aligned_cols=50  Identities=20%  Similarity=0.464  Sum_probs=36.7

Q ss_pred             cccCCCCCcCCChhhHHHHHHhhc---------------------------CCCCccCcccccccCCHHHHHHHHHH
Q psy10762         65 FPCQYCPKAFTRKDHLVNHVRRHT---------------------------GESPHKCTYCMKSFTRKEHLTNHIRQ  114 (126)
Q Consensus        65 ~~C~~C~~~~~~~~~l~~h~~~~~---------------------------~~~~~~C~~C~~~f~~~~~l~~H~~~  114 (126)
                      ..|-.|...+.+...+..|+++-+                           +.+.-.|-.|.-.|-....|..|+.-
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~e  356 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMVE  356 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhccc
Confidence            367888888888888888886532                           01223577788889999999999755


No 116
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=80.29  E-value=1.8  Score=27.22  Aligned_cols=13  Identities=15%  Similarity=0.680  Sum_probs=7.8

Q ss_pred             Ccceecccccccc
Q psy10762          6 ETPHRCDYCAKTF   18 (126)
Q Consensus         6 ~~~~~C~~C~~~f   18 (126)
                      .+.|.|..|....
T Consensus       110 drqFaC~~Cd~~W  122 (278)
T PF15135_consen  110 DRQFACSSCDHMW  122 (278)
T ss_pred             ceeeeccccchHH
Confidence            3567777776543


No 117
>PF12907 zf-met2:  Zinc-binding
Probab=80.27  E-value=1.5  Score=19.26  Aligned_cols=33  Identities=21%  Similarity=0.504  Sum_probs=20.0

Q ss_pred             ccCcccccccC---CHHHHHHHHHH-hhhccccCCCC
Q psy10762         93 HKCTYCMKSFT---RKEHLTNHIRQ-HTVRRVNDLPP  125 (126)
Q Consensus        93 ~~C~~C~~~f~---~~~~l~~H~~~-h~~~~~~~~~p  125 (126)
                      +.|.+|...|.   +...|..|... |......++.|
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~~~~~CFP   38 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKNTFEECFP   38 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCCCHHHcCC
Confidence            56888886664   45667777654 44433555554


No 118
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=79.52  E-value=1.7  Score=19.54  Aligned_cols=22  Identities=36%  Similarity=0.614  Sum_probs=16.4

Q ss_pred             ccCcccccccCCHHHHHHHHHH
Q psy10762         93 HKCTYCMKSFTRKEHLTNHIRQ  114 (126)
Q Consensus        93 ~~C~~C~~~f~~~~~l~~H~~~  114 (126)
                      |.|-.|..+...++.|-+|+.-
T Consensus        21 ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHH
Confidence            5677787777777888887754


No 119
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=79.41  E-value=1.6  Score=20.13  Aligned_cols=17  Identities=18%  Similarity=0.419  Sum_probs=10.5

Q ss_pred             cceeccccccccCChhH
Q psy10762          7 TPHRCDYCAKTFTRKEH   23 (126)
Q Consensus         7 ~~~~C~~C~~~f~~~~~   23 (126)
                      +.+.|.+||..|.....
T Consensus         3 k~l~C~dCg~~FvfTa~   19 (49)
T PF13451_consen    3 KTLTCKDCGAEFVFTAG   19 (49)
T ss_pred             eeEEcccCCCeEEEehh
Confidence            45667777776655544


No 120
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=79.38  E-value=0.62  Score=23.40  Aligned_cols=8  Identities=38%  Similarity=1.232  Sum_probs=3.6

Q ss_pred             ccCCcccc
Q psy10762         38 HCNYCAKS   45 (126)
Q Consensus        38 ~c~~C~~~   45 (126)
                      .|+.||..
T Consensus         3 ~CP~Cg~~   10 (72)
T PRK09678          3 HCPLCQHA   10 (72)
T ss_pred             cCCCCCCc
Confidence            34445443


No 121
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=79.17  E-value=1.5  Score=20.06  Aligned_cols=11  Identities=18%  Similarity=0.265  Sum_probs=5.7

Q ss_pred             CccCccccccc
Q psy10762         92 PHKCTYCMKSF  102 (126)
Q Consensus        92 ~~~C~~C~~~f  102 (126)
                      .+.|+.|+..+
T Consensus        20 ~~vC~~Cg~~~   30 (52)
T smart00661       20 RFVCRKCGYEE   30 (52)
T ss_pred             EEECCcCCCeE
Confidence            45555555443


No 122
>KOG2785|consensus
Probab=78.61  E-value=3.2  Score=27.86  Aligned_cols=27  Identities=26%  Similarity=0.552  Sum_probs=22.6

Q ss_pred             cceeccccccccCChhHHHHHHHhhcC
Q psy10762          7 TPHRCDYCAKTFTRKEHLVNHVRQHTG   33 (126)
Q Consensus         7 ~~~~C~~C~~~f~~~~~l~~h~~~h~~   33 (126)
                      .|-.|-.|+..+.....-..||..+++
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~Hg  191 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHG  191 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccC
Confidence            346688999999999999999987765


No 123
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=78.60  E-value=0.86  Score=17.62  Aligned_cols=8  Identities=38%  Similarity=1.044  Sum_probs=4.1

Q ss_pred             CccCcccc
Q psy10762         92 PHKCTYCM   99 (126)
Q Consensus        92 ~~~C~~C~   99 (126)
                      .|.|+.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            35555554


No 124
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=78.05  E-value=1.7  Score=22.82  Aligned_cols=13  Identities=31%  Similarity=0.728  Sum_probs=7.8

Q ss_pred             CcccCCCCCcCCC
Q psy10762         64 PFPCQYCPKAFTR   76 (126)
Q Consensus        64 ~~~C~~C~~~~~~   76 (126)
                      |-.|..||..|..
T Consensus        58 Pa~CkkCGfef~~   70 (97)
T COG3357          58 PARCKKCGFEFRD   70 (97)
T ss_pred             ChhhcccCccccc
Confidence            4466666666654


No 125
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=77.42  E-value=1.4  Score=20.38  Aligned_cols=11  Identities=18%  Similarity=0.459  Sum_probs=6.2

Q ss_pred             CCccCcccccc
Q psy10762         91 SPHKCTYCMKS  101 (126)
Q Consensus        91 ~~~~C~~C~~~  101 (126)
                      ..+.|..|+..
T Consensus        36 ~r~~C~~Cgyt   46 (50)
T PRK00432         36 DRWHCGKCGYT   46 (50)
T ss_pred             CcEECCCcCCE
Confidence            34556666654


No 126
>KOG2893|consensus
Probab=77.17  E-value=0.69  Score=28.82  Aligned_cols=43  Identities=23%  Similarity=0.599  Sum_probs=31.7

Q ss_pred             eeccccccccCChhHHHHHHHhhcCCCCcccCCcccccCCchHHHHH
Q psy10762          9 HRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYH   55 (126)
Q Consensus         9 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h   55 (126)
                      -.|=.|...|-...-|.+|++..+    |+|.+|-+...+-..|..|
T Consensus        11 pwcwycnrefddekiliqhqkakh----fkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   11 PWCWYCNREFDDEKILIQHQKAKH----FKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             ceeeecccccchhhhhhhhhhhcc----ceeeeehhhhccCCCceee
Confidence            347779999988888888887654    7888887776665555555


No 127
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=77.17  E-value=0.72  Score=26.01  Aligned_cols=13  Identities=31%  Similarity=0.841  Sum_probs=6.8

Q ss_pred             CcccCCCCCcCCC
Q psy10762         64 PFPCQYCPKAFTR   76 (126)
Q Consensus        64 ~~~C~~C~~~~~~   76 (126)
                      -|.|+.|++.|..
T Consensus        53 RyrC~~C~~tf~~   65 (129)
T COG3677          53 RYKCKSCGSTFTV   65 (129)
T ss_pred             ccccCCcCcceee
Confidence            3555555555533


No 128
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=77.06  E-value=2.7  Score=18.88  Aligned_cols=11  Identities=27%  Similarity=0.691  Sum_probs=6.3

Q ss_pred             CCCccCccccc
Q psy10762         90 ESPHKCTYCMK  100 (126)
Q Consensus        90 ~~~~~C~~C~~  100 (126)
                      ...|.|..|++
T Consensus        35 ~~~~~C~~C~~   45 (46)
T PF12760_consen   35 RGRYRCKACRK   45 (46)
T ss_pred             CCeEECCCCCC
Confidence            34566666654


No 129
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=76.84  E-value=1.1  Score=19.66  Aligned_cols=15  Identities=13%  Similarity=0.441  Sum_probs=6.9

Q ss_pred             ccCCcccccCCchHH
Q psy10762         38 HCNYCAKSFTRKDHM   52 (126)
Q Consensus        38 ~c~~C~~~~~~~~~l   52 (126)
                      .|+.|+..|.+...|
T Consensus        21 ~C~~C~G~W~d~~el   35 (41)
T PF13453_consen   21 VCPSCGGIWFDAGEL   35 (41)
T ss_pred             ECCCCCeEEccHHHH
Confidence            344444444444443


No 130
>KOG2907|consensus
Probab=76.52  E-value=1.2  Score=24.34  Aligned_cols=39  Identities=21%  Similarity=0.312  Sum_probs=20.6

Q ss_pred             cccCCCCCcCCChhhHHHHHHhhcC-CCCccCcccccccCC
Q psy10762         65 FPCQYCPKAFTRKDHLVNHVRRHTG-ESPHKCTYCMKSFTR  104 (126)
Q Consensus        65 ~~C~~C~~~~~~~~~l~~h~~~~~~-~~~~~C~~C~~~f~~  104 (126)
                      ..||.||-.=..-..++- ...-.| .-.|.|+.|++.|..
T Consensus        75 ~kCpkCghe~m~Y~T~Ql-RSADEGQTVFYTC~kC~~k~~e  114 (116)
T KOG2907|consen   75 HKCPKCGHEEMSYHTLQL-RSADEGQTVFYTCPKCKYKFTE  114 (116)
T ss_pred             ccCcccCCchhhhhhhhc-ccccCCceEEEEcCccceeeec
Confidence            479999743222212111 011112 234899999998864


No 131
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=76.44  E-value=1.8  Score=19.99  Aligned_cols=12  Identities=17%  Similarity=0.653  Sum_probs=8.2

Q ss_pred             cceecccccccc
Q psy10762          7 TPHRCDYCAKTF   18 (126)
Q Consensus         7 ~~~~C~~C~~~f   18 (126)
                      ..|.|..||..|
T Consensus         5 ~~Y~C~~Cg~~~   16 (49)
T COG1996           5 MEYKCARCGREV   16 (49)
T ss_pred             EEEEhhhcCCee
Confidence            357777777766


No 132
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=76.33  E-value=1.3  Score=19.57  Aligned_cols=29  Identities=24%  Similarity=0.701  Sum_probs=17.8

Q ss_pred             eeccccccccCChhHHHHHHHhhcCCCCcccCCccc
Q psy10762          9 HRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAK   44 (126)
Q Consensus         9 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~   44 (126)
                      |.|..||..|-....+      .. .....|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~------~~-~~~~~CP~Cg~   34 (42)
T PF09723_consen    6 YRCEECGHEFEVLQSI------SE-DDPVPCPECGS   34 (42)
T ss_pred             EEeCCCCCEEEEEEEc------CC-CCCCcCCCCCC
Confidence            7788888777544321      11 33457888875


No 133
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=75.12  E-value=3.9  Score=17.99  Aligned_cols=24  Identities=21%  Similarity=0.419  Sum_probs=16.2

Q ss_pred             eeccccccccCCh--hHHHHHHHhhc
Q psy10762          9 HRCDYCAKTFTRK--EHLVNHVRQHT   32 (126)
Q Consensus         9 ~~C~~C~~~f~~~--~~l~~h~~~h~   32 (126)
                      -.|+.||..|...  .+-..|.+.|.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            5799999987655  44556665553


No 134
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=74.12  E-value=0.61  Score=24.89  Aligned_cols=10  Identities=40%  Similarity=0.720  Sum_probs=6.3

Q ss_pred             ccCccccccc
Q psy10762         93 HKCTYCMKSF  102 (126)
Q Consensus        93 ~~C~~C~~~f  102 (126)
                      ..|..||.+|
T Consensus        47 ~~Cg~CGls~   56 (104)
T COG4888          47 AVCGNCGLSF   56 (104)
T ss_pred             EEcccCcceE
Confidence            4566676665


No 135
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=73.98  E-value=2.5  Score=28.82  Aligned_cols=14  Identities=14%  Similarity=0.392  Sum_probs=9.1

Q ss_pred             CccCcccccccCCH
Q psy10762         92 PHKCTYCMKSFTRK  105 (126)
Q Consensus        92 ~~~C~~C~~~f~~~  105 (126)
                      -|+|+.|+..+...
T Consensus       367 g~rC~kCg~~~~~~  380 (421)
T COG1571         367 GFRCKKCGTRARET  380 (421)
T ss_pred             CcccccccccCCcc
Confidence            56777777666544


No 136
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=73.63  E-value=1.3  Score=27.26  Aligned_cols=27  Identities=22%  Similarity=0.391  Sum_probs=19.5

Q ss_pred             CcccCCcccccCCchHHHHHHhhhcCC
Q psy10762         36 PHHCNYCAKSFTRKDHMVYHERQHTGE   62 (126)
Q Consensus        36 ~~~c~~C~~~~~~~~~l~~h~~~~~~~   62 (126)
                      -|.|++|++.|.....+.+|+..-+.+
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             EECCCCCCcccCChHHHHHHHhhcCHH
Confidence            478999999999999999998765544


No 137
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=73.48  E-value=3.2  Score=19.36  Aligned_cols=12  Identities=17%  Similarity=0.653  Sum_probs=6.4

Q ss_pred             cCcccccccCCH
Q psy10762         94 KCTYCMKSFTRK  105 (126)
Q Consensus        94 ~C~~C~~~f~~~  105 (126)
                      .||+|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            899999998753


No 138
>KOG2807|consensus
Probab=73.26  E-value=8.8  Score=25.40  Aligned_cols=26  Identities=19%  Similarity=0.340  Sum_probs=17.2

Q ss_pred             CCccCcccccccCCHHHHHHHHHHhh
Q psy10762         91 SPHKCTYCMKSFTRKEHLTNHIRQHT  116 (126)
Q Consensus        91 ~~~~C~~C~~~f~~~~~l~~H~~~h~  116 (126)
                      ..|.|..|...|=..-+.-.|...|.
T Consensus       344 ~~y~C~~Ck~~FCldCDv~iHesLh~  369 (378)
T KOG2807|consen  344 GRYRCESCKNVFCLDCDVFIHESLHN  369 (378)
T ss_pred             CcEEchhccceeeccchHHHHhhhhc
Confidence            45788888888766555566655543


No 139
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=73.23  E-value=1.5  Score=25.42  Aligned_cols=33  Identities=30%  Similarity=0.696  Sum_probs=20.9

Q ss_pred             CcccCCCCCcCCChhhHHHHHHhhcCCCCccCcccccc
Q psy10762         64 PFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKS  101 (126)
Q Consensus        64 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~  101 (126)
                      +|.|. |+..|.+.   .+|-..-.|+ .|.|..|+-.
T Consensus       117 ~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~gk  149 (156)
T COG3091         117 PYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCGGK  149 (156)
T ss_pred             eEEee-cCCccchh---hhcccccccc-eEEeccCCce
Confidence            58888 88776553   2333333344 7889888754


No 140
>KOG2071|consensus
Probab=73.17  E-value=2.2  Score=30.25  Aligned_cols=32  Identities=25%  Similarity=0.503  Sum_probs=25.8

Q ss_pred             CCCccCcccccccCCHHHHHHHHHHhhhcccc
Q psy10762         90 ESPHKCTYCMKSFTRKEHLTNHIRQHTVRRVN  121 (126)
Q Consensus        90 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~  121 (126)
                      ..+..|..||.+|.......+||-+|.+.+.+
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~dwh~r  447 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHDDWHRR  447 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhhhhhhh
Confidence            46688999999999988888888888765543


No 141
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=72.98  E-value=0.72  Score=19.77  Aligned_cols=18  Identities=17%  Similarity=0.501  Sum_probs=10.1

Q ss_pred             HHHHHhhcCCCCccCccc
Q psy10762         81 VNHVRRHTGESPHKCTYC   98 (126)
Q Consensus        81 ~~h~~~~~~~~~~~C~~C   98 (126)
                      .+|-....|...|.|..|
T Consensus        18 ~k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen   18 KKNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             eeCCCCCCCCEeEecCcC
Confidence            344444455566777666


No 142
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=72.76  E-value=0.046  Score=23.88  Aligned_cols=10  Identities=20%  Similarity=0.590  Sum_probs=7.2

Q ss_pred             ccCccccccc
Q psy10762         93 HKCTYCMKSF  102 (126)
Q Consensus        93 ~~C~~C~~~f  102 (126)
                      |.|..|+..|
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            6777777665


No 143
>KOG2482|consensus
Probab=72.46  E-value=3.8  Score=27.20  Aligned_cols=23  Identities=39%  Similarity=0.852  Sum_probs=21.1

Q ss_pred             CccCcccccccCCHHHHHHHHHH
Q psy10762         92 PHKCTYCMKSFTRKEHLTNHIRQ  114 (126)
Q Consensus        92 ~~~C~~C~~~f~~~~~l~~H~~~  114 (126)
                      .+.|.-|.+.|+.+..|+.|||.
T Consensus       195 r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHh
Confidence            46899999999999999999987


No 144
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=72.37  E-value=1.9  Score=24.30  Aligned_cols=13  Identities=23%  Similarity=0.700  Sum_probs=6.5

Q ss_pred             cccCCCCCcCCCh
Q psy10762         65 FPCQYCPKAFTRK   77 (126)
Q Consensus        65 ~~C~~C~~~~~~~   77 (126)
                      ++|-.||+.|...
T Consensus         2 H~Ct~Cg~~f~dg   14 (131)
T PF09845_consen    2 HQCTKCGRVFEDG   14 (131)
T ss_pred             cccCcCCCCcCCC
Confidence            3455555555443


No 145
>KOG4167|consensus
Probab=72.25  E-value=1  Score=32.73  Aligned_cols=27  Identities=22%  Similarity=0.443  Sum_probs=23.8

Q ss_pred             cceeccccccccCChhHHHHHHHhhcC
Q psy10762          7 TPHRCDYCAKTFTRKEHLVNHVRQHTG   33 (126)
Q Consensus         7 ~~~~C~~C~~~f~~~~~l~~h~~~h~~   33 (126)
                      ..|.|.+|++.|.....+..||+.|.-
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            458999999999999999999998853


No 146
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=72.20  E-value=1  Score=29.39  Aligned_cols=75  Identities=16%  Similarity=0.374  Sum_probs=35.6

Q ss_pred             ceeccccccccCChhHHHHHHHhhcCCCCcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcCCChhhHHHHHHhh
Q psy10762          8 PHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHVRRH   87 (126)
Q Consensus         8 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~~   87 (126)
                      .-.|++||..-. .+ + .+.....+.+-+.|..|+-.+...              ...|+.|+..    ..+ ..+...
T Consensus       187 ~~~CPvCGs~P~-~s-~-v~~~~~~G~RyL~CslC~teW~~~--------------R~~C~~Cg~~----~~l-~y~~~~  244 (309)
T PRK03564        187 RQFCPVCGSMPV-SS-V-VQIGTTQGLRYLHCNLCESEWHVV--------------RVKCSNCEQS----GKL-HYWSLD  244 (309)
T ss_pred             CCCCCCCCCcch-hh-e-eeccCCCCceEEEcCCCCCccccc--------------CccCCCCCCC----Cce-eeeeec
Confidence            355777776421 11 1 111223344455677776433221              2378888852    111 111111


Q ss_pred             ---cCCCCccCcccccccCC
Q psy10762         88 ---TGESPHKCTYCMKSFTR  104 (126)
Q Consensus        88 ---~~~~~~~C~~C~~~f~~  104 (126)
                         .+.+...|..|+.-.+.
T Consensus       245 ~~~~~~r~e~C~~C~~YlK~  264 (309)
T PRK03564        245 SEQAAVKAESCGDCGTYLKI  264 (309)
T ss_pred             CCCcceEeeeccccccccee
Confidence               23355789889765443


No 147
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=72.11  E-value=2.3  Score=21.50  Aligned_cols=31  Identities=23%  Similarity=0.624  Sum_probs=17.4

Q ss_pred             ceeccccccccCChhHHHHHHHhhcCCCCcccCCcccc
Q psy10762          8 PHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKS   45 (126)
Q Consensus         8 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~   45 (126)
                      .|.|..|+..|    .+.+++   .++..-.|+.|+..
T Consensus        12 ~Y~c~~cg~~~----dvvq~~---~ddplt~ce~c~a~   42 (82)
T COG2331          12 SYECTECGNRF----DVVQAM---TDDPLTTCEECGAR   42 (82)
T ss_pred             EEeecccchHH----HHHHhc---ccCccccChhhChH
Confidence            37788888765    333333   23333457777653


No 148
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=71.63  E-value=1.9  Score=23.41  Aligned_cols=12  Identities=17%  Similarity=0.611  Sum_probs=6.3

Q ss_pred             CccCcccccccC
Q psy10762         92 PHKCTYCMKSFT  103 (126)
Q Consensus        92 ~~~C~~C~~~f~  103 (126)
                      .|.|+.|+..+.
T Consensus        19 ~~iCpeC~~EW~   30 (109)
T TIGR00686        19 QLICPSCLYEWN   30 (109)
T ss_pred             eeECcccccccc
Confidence            355555555544


No 149
>KOG1842|consensus
Probab=71.28  E-value=2.8  Score=28.79  Aligned_cols=25  Identities=16%  Similarity=0.445  Sum_probs=15.9

Q ss_pred             CccCcccccccCCHHHHHHHHHHhh
Q psy10762         92 PHKCTYCMKSFTRKEHLTNHIRQHT  116 (126)
Q Consensus        92 ~~~C~~C~~~f~~~~~l~~H~~~h~  116 (126)
                      .|.|++|...|.+.+.|..|..+-|
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH   39 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEH   39 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhc
Confidence            3666666666666666666655533


No 150
>PHA02998 RNA polymerase subunit; Provisional
Probab=70.98  E-value=0.69  Score=27.45  Aligned_cols=41  Identities=22%  Similarity=0.398  Sum_probs=21.0

Q ss_pred             cccCCCCCcCCChhhHHHHHHhhcCCCCccCcccccccCCH
Q psy10762         65 FPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRK  105 (126)
Q Consensus        65 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~  105 (126)
                      -.|+.|+..=.....++..-.-......|.|..|+..|.-.
T Consensus       144 v~CPkCg~~~A~f~qlQTRSADEPmT~FYkC~~CG~~wkpp  184 (195)
T PHA02998        144 TPCPNCKSKNTTPMMIQTRAADEPPLVRHACRDCKKHFKPP  184 (195)
T ss_pred             CCCCCCCCCceEEEEEeeccCCCCceEEEEcCCCCCccCCc
Confidence            47888874322222221100001112348999999988653


No 151
>KOG3408|consensus
Probab=70.75  E-value=3.5  Score=22.93  Aligned_cols=26  Identities=27%  Similarity=0.514  Sum_probs=20.2

Q ss_pred             CCcceeccccccccCChhHHHHHHHh
Q psy10762          5 GETPHRCDYCAKTFTRKEHLVNHVRQ   30 (126)
Q Consensus         5 ~~~~~~C~~C~~~f~~~~~l~~h~~~   30 (126)
                      |...|-|-.|.+-|.....|+.|.++
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            45568888888888888888888754


No 152
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=70.45  E-value=1.8  Score=22.77  Aligned_cols=11  Identities=27%  Similarity=0.724  Sum_probs=5.3

Q ss_pred             CcccCCCCCcC
Q psy10762         64 PFPCQYCPKAF   74 (126)
Q Consensus        64 ~~~C~~C~~~~   74 (126)
                      .|.|..|++.|
T Consensus        54 IW~C~~C~~~~   64 (90)
T PTZ00255         54 IWRCKGCKKTV   64 (90)
T ss_pred             EEEcCCCCCEE
Confidence            44555554443


No 153
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=70.42  E-value=3.2  Score=18.42  Aligned_cols=16  Identities=25%  Similarity=0.663  Sum_probs=10.7

Q ss_pred             cCcccccccCCHHHHH
Q psy10762         94 KCTYCMKSFTRKEHLT  109 (126)
Q Consensus        94 ~C~~C~~~f~~~~~l~  109 (126)
                      .|.+|++.|+.+-...
T Consensus        10 ~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKWA   25 (42)
T ss_pred             cCcccCCcchHHHHHH
Confidence            5778888887664443


No 154
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=70.22  E-value=2.5  Score=23.30  Aligned_cols=12  Identities=17%  Similarity=0.650  Sum_probs=6.6

Q ss_pred             cccCCcccccCC
Q psy10762         37 HHCNYCAKSFTR   48 (126)
Q Consensus        37 ~~c~~C~~~~~~   48 (126)
                      ..|..|+..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (115)
T TIGR00100        71 CECEDCSEEVSP   82 (115)
T ss_pred             EEcccCCCEEec
Confidence            456666655543


No 155
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=69.92  E-value=8  Score=22.88  Aligned_cols=43  Identities=19%  Similarity=0.339  Sum_probs=25.2

Q ss_pred             ccCCCCCcCCChhhHH-------HHHHhhcCCCCccCcccccccCCHHHHHH
Q psy10762         66 PCQYCPKAFTRKDHLV-------NHVRRHTGESPHKCTYCMKSFTRKEHLTN  110 (126)
Q Consensus        66 ~C~~C~~~~~~~~~l~-------~h~~~~~~~~~~~C~~C~~~f~~~~~l~~  110 (126)
                      .|+.|+....--+.-.       .+..  ..+..|.|+.||+.|=..+.+.+
T Consensus        99 RCp~CN~~L~~vs~eev~~~Vp~~~~~--~~~~f~~C~~CgkiYW~GsHw~~  148 (165)
T COG1656          99 RCPECNGELEKVSREEVKEKVPEKVYR--NYEEFYRCPKCGKIYWKGSHWRR  148 (165)
T ss_pred             cCcccCCEeccCcHHHHhhccchhhhh--cccceeECCCCcccccCchHHHH
Confidence            6999976543322111       0111  12456789999999877666555


No 156
>PRK10220 hypothetical protein; Provisional
Probab=69.90  E-value=2.6  Score=22.93  Aligned_cols=11  Identities=18%  Similarity=0.615  Sum_probs=5.4

Q ss_pred             ccCcccccccC
Q psy10762         93 HKCTYCMKSFT  103 (126)
Q Consensus        93 ~~C~~C~~~f~  103 (126)
                      |.|+.|+..+.
T Consensus        21 ~vCpeC~hEW~   31 (111)
T PRK10220         21 YICPECAHEWN   31 (111)
T ss_pred             EECCcccCcCC
Confidence            45555554443


No 157
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=69.71  E-value=6.8  Score=30.75  Aligned_cols=12  Identities=17%  Similarity=0.548  Sum_probs=8.0

Q ss_pred             CcccCCCCCcCC
Q psy10762         64 PFPCQYCPKAFT   75 (126)
Q Consensus        64 ~~~C~~C~~~~~   75 (126)
                      +|.|+.||....
T Consensus       692 vy~CPsCGaev~  703 (1337)
T PRK14714        692 VYVCPDCGAEVP  703 (1337)
T ss_pred             ceeCccCCCccC
Confidence            467888876543


No 158
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=69.65  E-value=0.96  Score=24.88  Aligned_cols=13  Identities=31%  Similarity=0.470  Sum_probs=10.7

Q ss_pred             CCccCcccccccC
Q psy10762         91 SPHKCTYCMKSFT  103 (126)
Q Consensus        91 ~~~~C~~C~~~f~  103 (126)
                      ..|.|..||..|.
T Consensus        99 ~Fy~C~~Cg~~wr  111 (113)
T COG1594          99 RFYKCTRCGYRWR  111 (113)
T ss_pred             EEEEecccCCEee
Confidence            4589999998875


No 159
>KOG2636|consensus
Probab=69.04  E-value=7.2  Score=26.92  Aligned_cols=29  Identities=14%  Similarity=0.359  Sum_probs=22.7

Q ss_pred             HHhhcCCCCccCcccc-cccCCHHHHHHHH
Q psy10762         84 VRRHTGESPHKCTYCM-KSFTRKEHLTNHI  112 (126)
Q Consensus        84 ~~~~~~~~~~~C~~C~-~~f~~~~~l~~H~  112 (126)
                      .+.|.-...|.|.+|| +++.-+..+.+|.
T Consensus       393 yKLHGL~~ey~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  393 YKLHGLDIEYNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             HhhcCCCcccceeeccCccccCcHHHHHHh
Confidence            4667777888888888 7787788888884


No 160
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=68.53  E-value=2.1  Score=20.19  Aligned_cols=9  Identities=22%  Similarity=0.778  Sum_probs=4.3

Q ss_pred             ccCCccccc
Q psy10762         38 HCNYCAKSF   46 (126)
Q Consensus        38 ~c~~C~~~~   46 (126)
                      +|+.||..+
T Consensus         4 ~CP~CG~~i   12 (54)
T TIGR01206         4 ECPDCGAEI   12 (54)
T ss_pred             CCCCCCCEE
Confidence            455555433


No 161
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=68.47  E-value=3.8  Score=20.05  Aligned_cols=12  Identities=17%  Similarity=0.409  Sum_probs=5.6

Q ss_pred             CCccCccccccc
Q psy10762         91 SPHKCTYCMKSF  102 (126)
Q Consensus        91 ~~~~C~~C~~~f  102 (126)
                      +.|.|+.||..+
T Consensus        45 r~~~C~~Cg~~~   56 (69)
T PF07282_consen   45 RVFTCPNCGFEM   56 (69)
T ss_pred             ceEEcCCCCCEE
Confidence            344455554443


No 162
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=68.37  E-value=3.2  Score=22.81  Aligned_cols=11  Identities=18%  Similarity=0.504  Sum_probs=6.0

Q ss_pred             cccCCcccccC
Q psy10762         37 HHCNYCAKSFT   47 (126)
Q Consensus        37 ~~c~~C~~~~~   47 (126)
                      +.|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PRK12380         71 AWCWDCSQVVE   81 (113)
T ss_pred             EEcccCCCEEe
Confidence            45666665444


No 163
>PRK14873 primosome assembly protein PriA; Provisional
Probab=68.02  E-value=1.7  Score=31.53  Aligned_cols=47  Identities=13%  Similarity=0.471  Sum_probs=23.4

Q ss_pred             eccccccccCChhHHHHHHHhhcCCCCcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCc
Q psy10762         10 RCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKA   73 (126)
Q Consensus        10 ~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~   73 (126)
                      .|..||..+....- ...+..|.......|..||...                .++.|+.|+..
T Consensus       385 ~C~~Cg~~~~C~~C-~~~L~~h~~~~~l~Ch~CG~~~----------------~p~~Cp~Cgs~  431 (665)
T PRK14873        385 ACARCRTPARCRHC-TGPLGLPSAGGTPRCRWCGRAA----------------PDWRCPRCGSD  431 (665)
T ss_pred             EhhhCcCeeECCCC-CCceeEecCCCeeECCCCcCCC----------------cCccCCCCcCC
Confidence            46666655544311 1112233334456677777321                25678888753


No 164
>KOG0717|consensus
Probab=67.78  E-value=3.4  Score=28.56  Aligned_cols=22  Identities=36%  Similarity=0.656  Sum_probs=19.4

Q ss_pred             ccCcccccccCCHHHHHHHHHH
Q psy10762         93 HKCTYCMKSFTRKEHLTNHIRQ  114 (126)
Q Consensus        93 ~~C~~C~~~f~~~~~l~~H~~~  114 (126)
                      +-|.+|+++|.+.-.|.+|...
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            6699999999999999999654


No 165
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=66.93  E-value=0.94  Score=28.12  Aligned_cols=23  Identities=17%  Similarity=0.501  Sum_probs=14.8

Q ss_pred             CcceeccccccccCChhHHHHHH
Q psy10762          6 ETPHRCDYCAKTFTRKEHLVNHV   28 (126)
Q Consensus         6 ~~~~~C~~C~~~f~~~~~l~~h~   28 (126)
                      ++.+.|++|+..|........-.
T Consensus        17 kk~ieCPvC~tkFkkeev~tgsi   39 (267)
T COG1655          17 KKTIECPVCNTKFKKEEVKTGSI   39 (267)
T ss_pred             hceeccCcccchhhhhheeccce
Confidence            45678888888886655433333


No 166
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=66.56  E-value=5.6  Score=22.62  Aligned_cols=13  Identities=31%  Similarity=0.728  Sum_probs=10.5

Q ss_pred             cCcccccccCCHH
Q psy10762         94 KCTYCMKSFTRKE  106 (126)
Q Consensus        94 ~C~~C~~~f~~~~  106 (126)
                      +||+|.-+|++++
T Consensus       123 vCPvCkTSFKss~  135 (140)
T PF05290_consen  123 VCPVCKTSFKSSS  135 (140)
T ss_pred             CCCcccccccccc
Confidence            6999988888764


No 167
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=66.02  E-value=1.9  Score=18.44  Aligned_cols=10  Identities=20%  Similarity=0.840  Sum_probs=5.9

Q ss_pred             eccccccccC
Q psy10762         10 RCDYCAKTFT   19 (126)
Q Consensus        10 ~C~~C~~~f~   19 (126)
                      .|+.||.+|-
T Consensus         3 ~C~~Cg~~Yh   12 (36)
T PF05191_consen    3 ICPKCGRIYH   12 (36)
T ss_dssp             EETTTTEEEE
T ss_pred             CcCCCCCccc
Confidence            4666666653


No 168
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=65.26  E-value=2  Score=22.64  Aligned_cols=11  Identities=27%  Similarity=0.851  Sum_probs=5.3

Q ss_pred             CcccCCCCCcC
Q psy10762         64 PFPCQYCPKAF   74 (126)
Q Consensus        64 ~~~C~~C~~~~   74 (126)
                      .|.|..|+..|
T Consensus        53 IW~C~~C~~~~   63 (91)
T TIGR00280        53 IWTCRKCGAKF   63 (91)
T ss_pred             EEEcCCCCCEE
Confidence            34555554443


No 169
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=64.99  E-value=1.5  Score=23.02  Aligned_cols=10  Identities=50%  Similarity=1.006  Sum_probs=5.2

Q ss_pred             ccCccccccc
Q psy10762         93 HKCTYCMKSF  102 (126)
Q Consensus        93 ~~C~~C~~~f  102 (126)
                      |.|..|++.|
T Consensus        54 W~C~~C~~~~   63 (90)
T PF01780_consen   54 WKCKKCGKKF   63 (90)
T ss_dssp             EEETTTTEEE
T ss_pred             eecCCCCCEE
Confidence            4555555544


No 170
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=64.69  E-value=2.5  Score=29.66  Aligned_cols=34  Identities=21%  Similarity=0.460  Sum_probs=14.7

Q ss_pred             eccccccccCChhHHHHHHHhhcCCCCcccCCccc
Q psy10762         10 RCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAK   44 (126)
Q Consensus        10 ~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~   44 (126)
                      .|..||.......- ...+..|.......|..||.
T Consensus       215 ~C~~Cg~~~~C~~C-~~~l~~h~~~~~l~Ch~Cg~  248 (505)
T TIGR00595       215 LCRSCGYILCCPNC-DVSLTYHKKEGKLRCHYCGY  248 (505)
T ss_pred             EhhhCcCccCCCCC-CCceEEecCCCeEEcCCCcC
Confidence            45556555443311 11223333334455555553


No 171
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=64.52  E-value=3.7  Score=17.85  Aligned_cols=14  Identities=21%  Similarity=0.672  Sum_probs=11.6

Q ss_pred             ceeccccccccCCh
Q psy10762          8 PHRCDYCAKTFTRK   21 (126)
Q Consensus         8 ~~~C~~C~~~f~~~   21 (126)
                      ++.|..|+..|...
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            78899999888765


No 172
>KOG2593|consensus
Probab=64.33  E-value=6.3  Score=27.02  Aligned_cols=12  Identities=33%  Similarity=0.755  Sum_probs=5.5

Q ss_pred             eeccccccccCC
Q psy10762          9 HRCDYCAKTFTR   20 (126)
Q Consensus         9 ~~C~~C~~~f~~   20 (126)
                      |.|+.|++.|..
T Consensus       129 Y~Cp~C~kkyt~  140 (436)
T KOG2593|consen  129 YVCPNCQKKYTS  140 (436)
T ss_pred             ccCCccccchhh
Confidence            444444444433


No 173
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=63.99  E-value=2.8  Score=19.12  Aligned_cols=17  Identities=18%  Similarity=0.659  Sum_probs=12.3

Q ss_pred             cCcccccccCCHHHHHH
Q psy10762         94 KCTYCMKSFTRKEHLTN  110 (126)
Q Consensus        94 ~C~~C~~~f~~~~~l~~  110 (126)
                      .|++|++-|+.+....+
T Consensus        14 ICpvCqRPFsWRkKW~~   30 (54)
T COG4338          14 ICPVCQRPFSWRKKWAR   30 (54)
T ss_pred             hhhhhcCchHHHHHHHH
Confidence            68889888887655443


No 174
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=63.49  E-value=6.8  Score=27.28  Aligned_cols=23  Identities=30%  Similarity=0.543  Sum_probs=14.9

Q ss_pred             CccCcccccccCCHHHHHHHHHH
Q psy10762         92 PHKCTYCMKSFTRKEHLTNHIRQ  114 (126)
Q Consensus        92 ~~~C~~C~~~f~~~~~l~~H~~~  114 (126)
                      .+.|+.|.+.|.....+..|+..
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~   79 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQ   79 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHH
Confidence            35666666667666666666654


No 175
>KOG1280|consensus
Probab=62.37  E-value=11  Score=25.22  Aligned_cols=38  Identities=24%  Similarity=0.474  Sum_probs=26.2

Q ss_pred             CcceeccccccccCChhHHHHHHHhhcCCCC--cccCCcc
Q psy10762          6 ETPHRCDYCAKTFTRKEHLVNHVRQHTGESP--HHCNYCA   43 (126)
Q Consensus         6 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~--~~c~~C~   43 (126)
                      ...|.|+.|+..-.....+..|...-+.+..  ..|+.|+
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            4468899999888888888888876544322  3455554


No 176
>KOG1280|consensus
Probab=62.09  E-value=9.5  Score=25.45  Aligned_cols=37  Identities=24%  Similarity=0.511  Sum_probs=27.0

Q ss_pred             CcccCCCCCcCCChhhHHHHHHhhcCCCC--ccCccccc
Q psy10762         64 PFPCQYCPKAFTRKDHLVNHVRRHTGESP--HKCTYCMK  100 (126)
Q Consensus        64 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~--~~C~~C~~  100 (126)
                      -|.|+.|+..-.+...|..|....+-+-.  ..|++|+-
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~~  117 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCAA  117 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcCcccCcceeeecccc
Confidence            58899999877788899999876554433  35777753


No 177
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=61.91  E-value=8.4  Score=23.44  Aligned_cols=11  Identities=18%  Similarity=0.428  Sum_probs=5.7

Q ss_pred             CccCccccccc
Q psy10762         92 PHKCTYCMKSF  102 (126)
Q Consensus        92 ~~~C~~C~~~f  102 (126)
                      .+.|..||..+
T Consensus        30 lvrC~eCG~V~   40 (201)
T COG1326          30 LVRCEECGTVH   40 (201)
T ss_pred             EEEccCCCcEe
Confidence            34555555554


No 178
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=61.19  E-value=12  Score=22.47  Aligned_cols=33  Identities=12%  Similarity=0.437  Sum_probs=19.5

Q ss_pred             CCCCcccCCCCCcCCChhhHHHHHHhhcCCCCccCccccccc
Q psy10762         61 GETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSF  102 (126)
Q Consensus        61 ~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f  102 (126)
                      ...-|.|+.|..-++...++.         ..|.|+.||...
T Consensus       110 ~~~~y~C~~~~~r~sfdeA~~---------~~F~Cp~Cg~~L  142 (176)
T COG1675         110 ENNYYVCPNCHVKYSFDEAME---------LGFTCPKCGEDL  142 (176)
T ss_pred             cCCceeCCCCCCcccHHHHHH---------hCCCCCCCCchh
Confidence            344578877765555443332         227888887643


No 179
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=60.07  E-value=2.6  Score=22.16  Aligned_cols=11  Identities=27%  Similarity=0.833  Sum_probs=5.2

Q ss_pred             CcccCCCCCcC
Q psy10762         64 PFPCQYCPKAF   74 (126)
Q Consensus        64 ~~~C~~C~~~~   74 (126)
                      .|.|..|+..|
T Consensus        54 IW~C~~C~~~~   64 (90)
T PRK03976         54 IWECRKCGAKF   64 (90)
T ss_pred             EEEcCCCCCEE
Confidence            34555554443


No 180
>KOG2593|consensus
Probab=59.98  E-value=8.7  Score=26.38  Aligned_cols=38  Identities=21%  Similarity=0.446  Sum_probs=23.9

Q ss_pred             cCCCCcccCCCCCcCCChhhHHHHHHhhcC-CCCccCcccccc
Q psy10762         60 TGETPFPCQYCPKAFTRKDHLVNHVRRHTG-ESPHKCTYCMKS  101 (126)
Q Consensus        60 ~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~-~~~~~C~~C~~~  101 (126)
                      .....|.||.|.+.|.....++    .-.. .-.|.|..|+-.
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~----L~~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQ----LLDNETGEFHCENCGGE  162 (436)
T ss_pred             cccccccCCccccchhhhHHHH----hhcccCceEEEecCCCc
Confidence            3445688999988887765532    2222 346888888743


No 181
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=59.90  E-value=6.3  Score=21.53  Aligned_cols=11  Identities=27%  Similarity=0.661  Sum_probs=5.4

Q ss_pred             CcccCCCCCcC
Q psy10762         64 PFPCQYCPKAF   74 (126)
Q Consensus        64 ~~~C~~C~~~~   74 (126)
                      |..||.||++|
T Consensus        26 PiVsPytG~s~   36 (129)
T COG4530          26 PIVSPYTGKSY   36 (129)
T ss_pred             ccccCcccccc
Confidence            44455555544


No 182
>COG1773 Rubredoxin [Energy production and conversion]
Probab=59.73  E-value=3.9  Score=19.39  Aligned_cols=12  Identities=17%  Similarity=0.636  Sum_probs=8.2

Q ss_pred             CccCcccccccC
Q psy10762         92 PHKCTYCMKSFT  103 (126)
Q Consensus        92 ~~~C~~C~~~f~  103 (126)
                      .|+|.+||..|.
T Consensus         3 ~~~C~~CG~vYd   14 (55)
T COG1773           3 RWRCSVCGYVYD   14 (55)
T ss_pred             ceEecCCceEec
Confidence            467777777664


No 183
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=59.60  E-value=3.6  Score=22.14  Aligned_cols=13  Identities=31%  Similarity=0.894  Sum_probs=7.2

Q ss_pred             CcccCCCCCcCCC
Q psy10762         64 PFPCQYCPKAFTR   76 (126)
Q Consensus        64 ~~~C~~C~~~~~~   76 (126)
                      |++|..||..|..
T Consensus         2 pH~CtrCG~vf~~   14 (112)
T COG3364           2 PHQCTRCGEVFDD   14 (112)
T ss_pred             Cceeccccccccc
Confidence            3455556655555


No 184
>PRK04351 hypothetical protein; Provisional
Probab=59.58  E-value=3.1  Score=24.16  Aligned_cols=32  Identities=25%  Similarity=0.614  Sum_probs=20.8

Q ss_pred             CcccCCCCCcCCChhhHHHHHHhhcCCCCccCcccccccC
Q psy10762         64 PFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFT  103 (126)
Q Consensus        64 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~  103 (126)
                      .|.|..|+..+.+.-       .+ ....|.|..|+..+.
T Consensus       112 ~Y~C~~Cg~~~~r~R-------r~-n~~~yrCg~C~g~L~  143 (149)
T PRK04351        112 LYECQSCGQQYLRKR-------RI-NTKRYRCGKCRGKLK  143 (149)
T ss_pred             EEECCCCCCEeeeee-------ec-CCCcEEeCCCCcEee
Confidence            378988987664421       11 236689999987654


No 185
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=59.21  E-value=20  Score=24.15  Aligned_cols=30  Identities=13%  Similarity=0.401  Sum_probs=23.6

Q ss_pred             HHhhcCCCCccCcccc-cccCCHHHHHHHHH
Q psy10762         84 VRRHTGESPHKCTYCM-KSFTRKEHLTNHIR  113 (126)
Q Consensus        84 ~~~~~~~~~~~C~~C~-~~f~~~~~l~~H~~  113 (126)
                      ++.|.-.+.|.|.+|| +++.-+..+.+|..
T Consensus       366 ~klhgLd~ef~CEICgNyvy~GR~~FdrHF~  396 (470)
T COG5188         366 CKLHGLDIEFECEICGNYVYYGRDRFDRHFE  396 (470)
T ss_pred             HHhcCCCcceeeeecccccccchHHHHhhhh
Confidence            4677778889999998 77777778888753


No 186
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=58.67  E-value=6  Score=21.92  Aligned_cols=11  Identities=27%  Similarity=0.827  Sum_probs=5.6

Q ss_pred             cccCCcccccC
Q psy10762         37 HHCNYCAKSFT   47 (126)
Q Consensus        37 ~~c~~C~~~~~   47 (126)
                      +.|..|+..|.
T Consensus        72 ~~C~~Cg~~~~   82 (117)
T PRK00564         72 LECKDCSHVFK   82 (117)
T ss_pred             EEhhhCCCccc
Confidence            44555654443


No 187
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=58.46  E-value=4.7  Score=18.60  Aligned_cols=10  Identities=20%  Similarity=0.454  Sum_probs=6.9

Q ss_pred             CccCcccccc
Q psy10762         92 PHKCTYCMKS  101 (126)
Q Consensus        92 ~~~C~~C~~~  101 (126)
                      .+.|..||.+
T Consensus        37 R~~CGkCgyT   46 (51)
T COG1998          37 RWACGKCGYT   46 (51)
T ss_pred             eeEeccccce
Confidence            5677777764


No 188
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=58.41  E-value=5  Score=17.20  Aligned_cols=12  Identities=17%  Similarity=0.581  Sum_probs=6.6

Q ss_pred             cceecccccccc
Q psy10762          7 TPHRCDYCAKTF   18 (126)
Q Consensus         7 ~~~~C~~C~~~f   18 (126)
                      +-|+|..||...
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            458899998864


No 189
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=58.40  E-value=2.6  Score=24.32  Aligned_cols=32  Identities=19%  Similarity=0.566  Sum_probs=19.3

Q ss_pred             CcccCCCCCcCCChhhHHHHHHhhcCCCCccCcccccccC
Q psy10762         64 PFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFT  103 (126)
Q Consensus        64 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~  103 (126)
                      .|.|+.|+..+...      .+.  ....|.|..|+..+.
T Consensus       123 ~~~C~~C~~~~~r~------~~~--~~~~~~C~~C~~~l~  154 (157)
T PF10263_consen  123 VYRCPSCGREYKRH------RRS--KRKRYRCGRCGGPLV  154 (157)
T ss_pred             EEEcCCCCCEeeee------ccc--chhhEECCCCCCEEE
Confidence            46788888665332      222  234488888886653


No 190
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=58.28  E-value=4.6  Score=17.85  Aligned_cols=15  Identities=40%  Similarity=0.952  Sum_probs=9.7

Q ss_pred             cceeccccccccCCh
Q psy10762          7 TPHRCDYCAKTFTRK   21 (126)
Q Consensus         7 ~~~~C~~C~~~f~~~   21 (126)
                      .++.|..|+..|-..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            578899999988765


No 191
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=57.60  E-value=4.7  Score=22.15  Aligned_cols=11  Identities=27%  Similarity=0.863  Sum_probs=4.9

Q ss_pred             cccCCcccccC
Q psy10762         37 HHCNYCAKSFT   47 (126)
Q Consensus        37 ~~c~~C~~~~~   47 (126)
                      +.|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PF01155_consen   71 ARCRDCGHEFE   81 (113)
T ss_dssp             EEETTTS-EEE
T ss_pred             EECCCCCCEEe
Confidence            34555555443


No 192
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=55.86  E-value=3.4  Score=27.04  Aligned_cols=13  Identities=15%  Similarity=0.516  Sum_probs=8.6

Q ss_pred             CCccCcccccccC
Q psy10762         91 SPHKCTYCMKSFT  103 (126)
Q Consensus        91 ~~~~C~~C~~~f~  103 (126)
                      +...|..|+.-.+
T Consensus       251 r~e~C~~C~~YlK  263 (305)
T TIGR01562       251 KAETCDSCQGYLK  263 (305)
T ss_pred             EEeeccccccchh
Confidence            5567888875443


No 193
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=55.64  E-value=4.7  Score=22.22  Aligned_cols=11  Identities=27%  Similarity=0.664  Sum_probs=5.9

Q ss_pred             cccCCcccccC
Q psy10762         37 HHCNYCAKSFT   47 (126)
Q Consensus        37 ~~c~~C~~~~~   47 (126)
                      +.|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (114)
T PRK03681         71 CWCETCQQYVT   81 (114)
T ss_pred             EEcccCCCeee
Confidence            45666665443


No 194
>PLN02294 cytochrome c oxidase subunit Vb
Probab=55.28  E-value=5.8  Score=23.55  Aligned_cols=16  Identities=19%  Similarity=0.530  Sum_probs=13.0

Q ss_pred             CCCCccCcccccccCC
Q psy10762         89 GESPHKCTYCMKSFTR  104 (126)
Q Consensus        89 ~~~~~~C~~C~~~f~~  104 (126)
                      ..++.+|++||..|.-
T Consensus       138 kGkp~RCpeCG~~fkL  153 (174)
T PLN02294        138 KGKSFECPVCTQYFEL  153 (174)
T ss_pred             CCCceeCCCCCCEEEE
Confidence            3578899999999864


No 195
>KOG4167|consensus
Probab=54.98  E-value=3.3  Score=30.34  Aligned_cols=26  Identities=23%  Similarity=0.455  Sum_probs=21.3

Q ss_pred             CccCcccccccCCHHHHHHHHHHhhh
Q psy10762         92 PHKCTYCMKSFTRKEHLTNHIRQHTV  117 (126)
Q Consensus        92 ~~~C~~C~~~f~~~~~l~~H~~~h~~  117 (126)
                      .|-|..|+|.|-.-..+..||+.|.-
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            48999999999877777888888763


No 196
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=54.39  E-value=3.4  Score=23.98  Aligned_cols=13  Identities=31%  Similarity=0.513  Sum_probs=8.9

Q ss_pred             cccCCCCCcCCCh
Q psy10762         65 FPCQYCPKAFTRK   77 (126)
Q Consensus        65 ~~C~~C~~~~~~~   77 (126)
                      -.|+.|+..|.+.
T Consensus        29 ReC~~C~~RFTTf   41 (156)
T COG1327          29 RECLECGERFTTF   41 (156)
T ss_pred             hcccccccccchh
Confidence            4677777777664


No 197
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=54.33  E-value=6.1  Score=21.18  Aligned_cols=15  Identities=27%  Similarity=0.702  Sum_probs=11.8

Q ss_pred             CCCccCcccccccCC
Q psy10762         90 ESPHKCTYCMKSFTR  104 (126)
Q Consensus        90 ~~~~~C~~C~~~f~~  104 (126)
                      .++++|..||..|.-
T Consensus        77 g~~~rC~eCG~~fkL   91 (97)
T cd00924          77 GKPKRCPECGHVFKL   91 (97)
T ss_pred             CCceeCCCCCcEEEE
Confidence            378889999988863


No 198
>KOG0978|consensus
Probab=52.97  E-value=7.5  Score=28.52  Aligned_cols=17  Identities=24%  Similarity=0.583  Sum_probs=11.1

Q ss_pred             CCccCcccccccCCHHH
Q psy10762         91 SPHKCTYCMKSFTRKEH  107 (126)
Q Consensus        91 ~~~~C~~C~~~f~~~~~  107 (126)
                      +.-+||.|+..|....-
T Consensus       677 RqRKCP~Cn~aFganDv  693 (698)
T KOG0978|consen  677 RQRKCPKCNAAFGANDV  693 (698)
T ss_pred             hcCCCCCCCCCCCcccc
Confidence            44467777777776543


No 199
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=52.59  E-value=14  Score=17.54  Aligned_cols=8  Identities=38%  Similarity=0.999  Sum_probs=4.1

Q ss_pred             CcccCCCC
Q psy10762         64 PFPCQYCP   71 (126)
Q Consensus        64 ~~~C~~C~   71 (126)
                      .|.|+.||
T Consensus        14 ~~~Cp~cG   21 (55)
T PF13824_consen   14 NFECPDCG   21 (55)
T ss_pred             CCcCCCCC
Confidence            45555554


No 200
>KOG4124|consensus
Probab=52.02  E-value=1.4  Score=29.11  Aligned_cols=49  Identities=29%  Similarity=0.677  Sum_probs=32.8

Q ss_pred             CCcccCC--CCCcCCChhhHHHHHHh---------------hc----CCCCccCcccccccCCHHHHHHH
Q psy10762         63 TPFPCQY--CPKAFTRKDHLVNHVRR---------------HT----GESPHKCTYCMKSFTRKEHLTNH  111 (126)
Q Consensus        63 ~~~~C~~--C~~~~~~~~~l~~h~~~---------------~~----~~~~~~C~~C~~~f~~~~~l~~H  111 (126)
                      ++|.|++  |.+.+.....+.-|...               |+    -.|+|+|++|.++++....|.-|
T Consensus       348 ~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~  417 (442)
T KOG4124|consen  348 KPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYH  417 (442)
T ss_pred             CCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCce
Confidence            5678865  88888776655544422               11    25889999999998766555444


No 201
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=52.01  E-value=12  Score=17.30  Aligned_cols=13  Identities=23%  Similarity=0.708  Sum_probs=7.9

Q ss_pred             CcccCCCCCcCCC
Q psy10762         64 PFPCQYCPKAFTR   76 (126)
Q Consensus        64 ~~~C~~C~~~~~~   76 (126)
                      .+.|..||.+|-.
T Consensus        18 k~~Cr~Cg~~~C~   30 (57)
T cd00065          18 RHHCRNCGRIFCS   30 (57)
T ss_pred             ccccCcCcCCcCh
Confidence            3566667666654


No 202
>PRK12496 hypothetical protein; Provisional
Probab=51.71  E-value=13  Score=22.04  Aligned_cols=27  Identities=19%  Similarity=0.460  Sum_probs=17.8

Q ss_pred             cccCCCCCcCCChhhHHHHHHhhcCCCCccCcccccccC
Q psy10762         65 FPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFT  103 (126)
Q Consensus        65 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~  103 (126)
                      |.|+.|++.|.....            .-.|++||....
T Consensus       128 ~~C~gC~~~~~~~~~------------~~~C~~CG~~~~  154 (164)
T PRK12496        128 KVCKGCKKKYPEDYP------------DDVCEICGSPVK  154 (164)
T ss_pred             EECCCCCccccCCCC------------CCcCCCCCChhh
Confidence            679999988854211            125999986543


No 203
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=51.58  E-value=13  Score=17.35  Aligned_cols=9  Identities=22%  Similarity=0.840  Sum_probs=3.7

Q ss_pred             cccCCCCCc
Q psy10762         65 FPCQYCPKA   73 (126)
Q Consensus        65 ~~C~~C~~~   73 (126)
                      +.|+.|+..
T Consensus        29 W~C~~Cgh~   37 (55)
T PF14311_consen   29 WKCPKCGHE   37 (55)
T ss_pred             EECCCCCCe
Confidence            344444433


No 204
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=51.46  E-value=6  Score=17.20  Aligned_cols=12  Identities=25%  Similarity=0.786  Sum_probs=5.7

Q ss_pred             CCCCccCccccc
Q psy10762         89 GESPHKCTYCMK  100 (126)
Q Consensus        89 ~~~~~~C~~C~~  100 (126)
                      +.+.+.|..|+.
T Consensus        21 ~~~~w~C~~C~~   32 (40)
T PF04810_consen   21 GGKTWICNFCGT   32 (40)
T ss_dssp             TTTEEEETTT--
T ss_pred             CCCEEECcCCCC
Confidence            345566666654


No 205
>KOG3002|consensus
Probab=50.74  E-value=25  Score=23.13  Aligned_cols=76  Identities=17%  Similarity=0.356  Sum_probs=46.0

Q ss_pred             CCcccCCcccccCCchHHHHHHhhhcCCCCcccC----CCCCcCCChhhHHHHHHhhcCCCCccCcc----cccccCCHH
Q psy10762         35 SPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQ----YCPKAFTRKDHLVNHVRRHTGESPHKCTY----CMKSFTRKE  106 (126)
Q Consensus        35 ~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~----~C~~~~~~~~~l~~h~~~~~~~~~~~C~~----C~~~f~~~~  106 (126)
                      ..-.|+.|...+.....+..-..  .......|+    .|.+.|.+... ..|.+.... .+|.|+.    |...- ...
T Consensus        79 ~~~~CP~Cr~~~g~~R~~amEkV--~e~~~vpC~~~~~GC~~~~~Y~~~-~~HE~~C~f-~~~~CP~p~~~C~~~G-~~~  153 (299)
T KOG3002|consen   79 VSNKCPTCRLPIGNIRCRAMEKV--AEAVLVPCKNAKLGCTKSFPYGEK-SKHEKVCEF-RPCSCPVPGAECKYTG-SYK  153 (299)
T ss_pred             hcccCCccccccccHHHHHHHHH--HHhceecccccccCCceeeccccc-ccccccccc-CCcCCCCCcccCCccC-cHH
Confidence            34568888777775544433322  333345666    38888877766 567777665 7788865    43333 344


Q ss_pred             HHHHHHHHh
Q psy10762        107 HLTNHIRQH  115 (126)
Q Consensus       107 ~l~~H~~~h  115 (126)
                      .|..|.+.-
T Consensus       154 ~l~~H~~~~  162 (299)
T KOG3002|consen  154 DLYAHLNDT  162 (299)
T ss_pred             HHHHHHHhh
Confidence            777786553


No 206
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=49.70  E-value=9.1  Score=21.97  Aligned_cols=33  Identities=24%  Similarity=0.575  Sum_probs=18.7

Q ss_pred             CcccCCCCCcCCChhhHHHHHHhhcCCCCccCcccccccC
Q psy10762         64 PFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFT  103 (126)
Q Consensus        64 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~  103 (126)
                      .|.|..|+..+.+.      . .+.....|.|..|+..+.
T Consensus       112 ~y~C~~C~~~~~~~------r-r~~~~~~y~C~~C~g~l~  144 (146)
T smart00731      112 PYRCTGCGQRYLRV------R-RSNNVSRYRCGKCGGKLI  144 (146)
T ss_pred             EEECCCCCCCCceE------c-cccCcceEEcCCCCCEEE
Confidence            57787787665421      1 111125578888876653


No 207
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=49.52  E-value=8.8  Score=18.70  Aligned_cols=27  Identities=22%  Similarity=0.593  Sum_probs=9.8

Q ss_pred             ccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcCCC
Q psy10762         38 HCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTR   76 (126)
Q Consensus        38 ~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~   76 (126)
                      .|..|+..|..            ..+.+.|..||.+|-.
T Consensus        11 ~C~~C~~~F~~------------~~rrhhCr~CG~~vC~   37 (69)
T PF01363_consen   11 NCMICGKKFSL------------FRRRHHCRNCGRVVCS   37 (69)
T ss_dssp             B-TTT--B-BS------------SS-EEE-TTT--EEEC
T ss_pred             cCcCcCCcCCC------------ceeeEccCCCCCEECC
Confidence            56667766632            1234566666665544


No 208
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=49.45  E-value=20  Score=14.99  Aligned_cols=22  Identities=14%  Similarity=0.525  Sum_probs=10.8

Q ss_pred             cccCCCCCcCCChhhHHHHHHhh
Q psy10762         65 FPCQYCPKAFTRKDHLVNHVRRH   87 (126)
Q Consensus        65 ~~C~~C~~~~~~~~~l~~h~~~~   87 (126)
                      +.|+.|++.+. .+.+..|+...
T Consensus         5 ~~C~nC~R~v~-a~RfA~HLekC   26 (33)
T PF08209_consen    5 VECPNCGRPVA-ASRFAPHLEKC   26 (33)
T ss_dssp             EE-TTTSSEEE-GGGHHHHHHHH
T ss_pred             EECCCCcCCcc-hhhhHHHHHHH
Confidence            45666665442 33455555543


No 209
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=49.41  E-value=19  Score=23.45  Aligned_cols=27  Identities=26%  Similarity=0.592  Sum_probs=20.4

Q ss_pred             CCCccCcccccccCCHHHHHHHHHHhh
Q psy10762         90 ESPHKCTYCMKSFTRKEHLTNHIRQHT  116 (126)
Q Consensus        90 ~~~~~C~~C~~~f~~~~~l~~H~~~h~  116 (126)
                      ...|.|..|-+-|.+...|.+|+..-.
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~~C~   72 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLAKCD   72 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHHhCC
Confidence            456888888888888888888876543


No 210
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=49.33  E-value=1.9  Score=23.18  Aligned_cols=40  Identities=18%  Similarity=0.189  Sum_probs=19.8

Q ss_pred             cccCCCCCcCCChhhHHHHHHhhcCCCCccCcccccccCC
Q psy10762         65 FPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTR  104 (126)
Q Consensus        65 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~  104 (126)
                      ..|+.||..-.....++..-.-......|.|..|+..+..
T Consensus        63 ~~Cp~Cg~~~a~f~~~Q~RsadE~~T~fy~C~~C~~~w~~  102 (104)
T TIGR01384        63 VECPKCGHKEAYYWLLQTRRADEPETRFYKCTKCGYVWRE  102 (104)
T ss_pred             CCCCCCCCCeeEEEEeccCCCCCCcEEEEEeCCCCCeeEe
Confidence            5788887432221111110011112244899989887653


No 211
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the KOG3507|consensus
Probab=48.59  E-value=9.9  Score=18.24  Aligned_cols=12  Identities=17%  Similarity=0.421  Sum_probs=6.9

Q ss_pred             CcccCCcccccC
Q psy10762         36 PHHCNYCAKSFT   47 (126)
Q Consensus        36 ~~~c~~C~~~~~   47 (126)
                      ++.|..||....
T Consensus        37 ~irCReCG~RIl   48 (62)
T KOG3507|consen   37 VIRCRECGYRIL   48 (62)
T ss_pred             cEehhhcchHHH
Confidence            456666665443


No 213
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=48.30  E-value=8  Score=17.90  Aligned_cols=12  Identities=17%  Similarity=0.498  Sum_probs=8.4

Q ss_pred             ccCcccccccCC
Q psy10762         93 HKCTYCMKSFTR  104 (126)
Q Consensus        93 ~~C~~C~~~f~~  104 (126)
                      |+|.+||..+..
T Consensus         2 y~C~~CgyiYd~   13 (50)
T cd00730           2 YECRICGYIYDP   13 (50)
T ss_pred             cCCCCCCeEECC
Confidence            677788777653


No 214
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=47.57  E-value=16  Score=25.62  Aligned_cols=25  Identities=24%  Similarity=0.460  Sum_probs=21.4

Q ss_pred             CcccCCcccccCCchHHHHHHhhhc
Q psy10762         36 PHHCNYCAKSFTRKDHMVYHERQHT   60 (126)
Q Consensus        36 ~~~c~~C~~~~~~~~~l~~h~~~~~   60 (126)
                      .|.|+.|.+.|.+...+..|+...+
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH   81 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEH   81 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhh
Confidence            4789999999999999999987443


No 215
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=47.34  E-value=3.5  Score=30.14  Aligned_cols=79  Identities=23%  Similarity=0.495  Sum_probs=36.8

Q ss_pred             eeccccccccCChhHHHHHHHhhcCCCCcccCCcccccCCchHHHHHHhhhcCCCCc-ccCCCCCcCCChhhHHHHHHhh
Q psy10762          9 HRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPF-PCQYCPKAFTRKDHLVNHVRRH   87 (126)
Q Consensus         9 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~-~C~~C~~~~~~~~~l~~h~~~~   87 (126)
                      ..|++|-+.+....+-.-+    -  ....|..||..|.-...|--- +.++.-..| .|+.|.+.|.....    .+-|
T Consensus       102 a~C~~Cl~Ei~dp~~rrY~----Y--PF~~CT~CGPRfTIi~alPYD-R~nTsM~~F~lC~~C~~EY~dP~n----RRfH  170 (750)
T COG0068         102 ATCEDCLEEIFDPNSRRYL----Y--PFINCTNCGPRFTIIEALPYD-RENTSMADFPLCPFCDKEYKDPLN----RRFH  170 (750)
T ss_pred             hhhHHHHHHhcCCCCccee----c--cccccCCCCcceeeeccCCCC-cccCccccCcCCHHHHHHhcCccc----cccc
Confidence            4577777666555431111    0  123477777776544332100 111111122 46666666655533    2223


Q ss_pred             cCCCCccCccccc
Q psy10762         88 TGESPHKCTYCMK  100 (126)
Q Consensus        88 ~~~~~~~C~~C~~  100 (126)
                        ..+..|+.||-
T Consensus       171 --AQp~aCp~CGP  181 (750)
T COG0068         171 --AQPIACPKCGP  181 (750)
T ss_pred             --cccccCcccCC
Confidence              24556777764


No 216
>KOG4727|consensus
Probab=46.67  E-value=12  Score=22.25  Aligned_cols=23  Identities=17%  Similarity=0.446  Sum_probs=20.4

Q ss_pred             cceeccccccccCChhHHHHHHH
Q psy10762          7 TPHRCDYCAKTFTRKEHLVNHVR   29 (126)
Q Consensus         7 ~~~~C~~C~~~f~~~~~l~~h~~   29 (126)
                      ..|-|.+|.-++...-++..|+.
T Consensus        74 ~GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   74 GGYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             CceeeeecceeehhhHHHHHHhc
Confidence            34889999999999999999985


No 217
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=45.75  E-value=4  Score=19.03  Aligned_cols=14  Identities=21%  Similarity=0.667  Sum_probs=4.6

Q ss_pred             CcccCCCCCcCCCh
Q psy10762         64 PFPCQYCPKAFTRK   77 (126)
Q Consensus        64 ~~~C~~C~~~~~~~   77 (126)
                      .|.|+.|...|--.
T Consensus        21 ~y~C~~C~~~FC~d   34 (51)
T PF07975_consen   21 RYRCPKCKNHFCID   34 (51)
T ss_dssp             EE--TTTT--B-HH
T ss_pred             eEECCCCCCccccC
Confidence            35555555555443


No 218
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=45.75  E-value=6.9  Score=24.37  Aligned_cols=26  Identities=15%  Similarity=0.248  Sum_probs=0.0

Q ss_pred             CCCccCcccccccCCHHHHHHHHHHhh
Q psy10762         90 ESPHKCTYCMKSFTRKEHLTNHIRQHT  116 (126)
Q Consensus        90 ~~~~~C~~C~~~f~~~~~l~~H~~~h~  116 (126)
                      .....|++||....-. .|..|+|+..
T Consensus       166 ~~~~~cPitGe~IP~~-e~~eHmRi~L  191 (229)
T PF12230_consen  166 EKMIICPITGEMIPAD-EMDEHMRIEL  191 (229)
T ss_dssp             ---------------------------
T ss_pred             cccccccccccccccc-cccccccccc
Confidence            3457899999988765 7899998854


No 219
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=45.63  E-value=8.8  Score=21.50  Aligned_cols=7  Identities=29%  Similarity=0.980  Sum_probs=4.0

Q ss_pred             cccCCCC
Q psy10762         65 FPCQYCP   71 (126)
Q Consensus        65 ~~C~~C~   71 (126)
                      +.||.|+
T Consensus        93 ~~CP~Cg   99 (124)
T PRK00762         93 IECPVCG   99 (124)
T ss_pred             CcCcCCC
Confidence            3566665


No 220
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=45.42  E-value=11  Score=17.25  Aligned_cols=12  Identities=17%  Similarity=0.642  Sum_probs=6.7

Q ss_pred             eeccccccccCC
Q psy10762          9 HRCDYCAKTFTR   20 (126)
Q Consensus         9 ~~C~~C~~~f~~   20 (126)
                      |.|..|+..+--
T Consensus         2 y~C~~CgyvYd~   13 (47)
T PF00301_consen    2 YQCPVCGYVYDP   13 (47)
T ss_dssp             EEETTTSBEEET
T ss_pred             cCCCCCCEEEcC
Confidence            556666655533


No 221
>PRK05978 hypothetical protein; Provisional
Probab=45.22  E-value=16  Score=21.29  Aligned_cols=10  Identities=40%  Similarity=0.989  Sum_probs=6.2

Q ss_pred             cCcccccccC
Q psy10762         94 KCTYCMKSFT  103 (126)
Q Consensus        94 ~C~~C~~~f~  103 (126)
                      .|+.||..|.
T Consensus        54 ~C~~CG~~~~   63 (148)
T PRK05978         54 HCAACGEDFT   63 (148)
T ss_pred             CccccCCccc
Confidence            4777766654


No 222
>KOG3214|consensus
Probab=43.83  E-value=5.9  Score=21.24  Aligned_cols=11  Identities=36%  Similarity=0.921  Sum_probs=6.1

Q ss_pred             cCcccccccCC
Q psy10762         94 KCTYCMKSFTR  104 (126)
Q Consensus        94 ~C~~C~~~f~~  104 (126)
                      .|.+|+.+|..
T Consensus        49 sC~iC~esFqt   59 (109)
T KOG3214|consen   49 SCRICEESFQT   59 (109)
T ss_pred             eeeehhhhhcc
Confidence            45556555543


No 223
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=43.52  E-value=13  Score=15.33  Aligned_cols=12  Identities=17%  Similarity=0.670  Sum_probs=9.4

Q ss_pred             cceecccccccc
Q psy10762          7 TPHRCDYCAKTF   18 (126)
Q Consensus         7 ~~~~C~~C~~~f   18 (126)
                      +-|+|..|+...
T Consensus         6 ~~ykC~~Cgniv   17 (34)
T TIGR00319         6 QVYKCEVCGNIV   17 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            468899998875


No 224
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=43.26  E-value=30  Score=18.27  Aligned_cols=15  Identities=13%  Similarity=0.543  Sum_probs=8.3

Q ss_pred             cccCCCCCcCCChhh
Q psy10762         65 FPCQYCPKAFTRKDH   79 (126)
Q Consensus        65 ~~C~~C~~~~~~~~~   79 (126)
                      ..|+.||..|.....
T Consensus        36 ~~C~~CGe~y~~dev   50 (89)
T TIGR03829        36 ISCSHCGMEYQDDTT   50 (89)
T ss_pred             ccccCCCcEeecHHH
Confidence            356666666655443


No 225
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=43.20  E-value=56  Score=17.74  Aligned_cols=39  Identities=13%  Similarity=0.164  Sum_probs=19.7

Q ss_pred             ceeccccccccCChhHHHHHHHhhcCCCCcccCCcccccC
Q psy10762          8 PHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFT   47 (126)
Q Consensus         8 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~   47 (126)
                      .|.|+.-+..|.+...+..-+.... .+.|.|...|+.-.
T Consensus         3 Vf~i~~T~EiF~dYe~Y~~R~~~y~-~~vwtC~~TGk~~L   41 (102)
T PF10537_consen    3 VFYIPFTGEIFRDYEEYLKRMILYN-QRVWTCEITGKSNL   41 (102)
T ss_pred             eEEeCCCCcccCCHHHHHHHHHHHh-CCeeEEecCCCCCC
Confidence            3455555556665555555544332 23455555554433


No 226
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=43.00  E-value=11  Score=17.37  Aligned_cols=8  Identities=50%  Similarity=1.074  Sum_probs=2.5

Q ss_pred             ccCccccc
Q psy10762         93 HKCTYCMK  100 (126)
Q Consensus        93 ~~C~~C~~  100 (126)
                      |.|++|++
T Consensus        42 W~CPiC~~   49 (50)
T PF02891_consen   42 WKCPICNK   49 (50)
T ss_dssp             -B-TTT--
T ss_pred             eECcCCcC
Confidence            66666653


No 227
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=42.96  E-value=14  Score=15.32  Aligned_cols=12  Identities=17%  Similarity=0.678  Sum_probs=8.8

Q ss_pred             cceecccccccc
Q psy10762          7 TPHRCDYCAKTF   18 (126)
Q Consensus         7 ~~~~C~~C~~~f   18 (126)
                      +-|+|..|+...
T Consensus         3 ~~ykC~~CGniv   14 (34)
T cd00974           3 EVYKCEICGNIV   14 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            357888888765


No 228
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=42.54  E-value=15  Score=17.63  Aligned_cols=10  Identities=40%  Similarity=0.869  Sum_probs=4.5

Q ss_pred             CCCCcccCCC
Q psy10762         61 GETPFPCQYC   70 (126)
Q Consensus        61 ~~~~~~C~~C   70 (126)
                      |++.-.||.|
T Consensus        41 GE~VArCPSC   50 (67)
T COG5216          41 GEVVARCPSC   50 (67)
T ss_pred             CceEEEcCCc
Confidence            4444444444


No 229
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=42.48  E-value=3.4  Score=23.41  Aligned_cols=14  Identities=29%  Similarity=0.707  Sum_probs=9.1

Q ss_pred             CCCCcccCCCCCcC
Q psy10762         61 GETPFPCQYCPKAF   74 (126)
Q Consensus        61 ~~~~~~C~~C~~~~   74 (126)
                      ++....||.|++.-
T Consensus       102 g~~~~~CPwCg~~g  115 (131)
T PF15616_consen  102 GEGEVTCPWCGNEG  115 (131)
T ss_pred             CCCCEECCCCCCee
Confidence            34456888888643


No 230
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=41.77  E-value=24  Score=23.34  Aligned_cols=27  Identities=19%  Similarity=0.352  Sum_probs=20.3

Q ss_pred             CCCccCcccccccCCHHHHHHHHHHhh
Q psy10762         90 ESPHKCTYCMKSFTRKEHLTNHIRQHT  116 (126)
Q Consensus        90 ~~~~~C~~C~~~f~~~~~l~~H~~~h~  116 (126)
                      ...|.|+.|...|-..-+.-.|...|.
T Consensus       386 s~rY~Ce~CK~~FC~dCdvfiHe~Lh~  412 (421)
T COG5151         386 SGRYQCELCKSTFCSDCDVFIHETLHF  412 (421)
T ss_pred             ccceechhhhhhhhhhhHHHHHHHHhh
Confidence            456899999888887777777766554


No 231
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=41.60  E-value=12  Score=20.30  Aligned_cols=10  Identities=40%  Similarity=1.095  Sum_probs=5.2

Q ss_pred             CcccCCcccc
Q psy10762         36 PHHCNYCAKS   45 (126)
Q Consensus        36 ~~~c~~C~~~   45 (126)
                      |..|+-||..
T Consensus         2 p~~CpYCg~~   11 (102)
T PF11672_consen    2 PIICPYCGGP   11 (102)
T ss_pred             CcccCCCCCe
Confidence            3456666543


No 232
>PRK11823 DNA repair protein RadA; Provisional
Probab=41.47  E-value=18  Score=25.13  Aligned_cols=24  Identities=21%  Similarity=0.477  Sum_probs=16.3

Q ss_pred             CcceeccccccccCChhHHHHHHHhhcCCCCcccCCcc
Q psy10762          6 ETPHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCA   43 (126)
Q Consensus         6 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~   43 (126)
                      +..|.|..||......              .++|+.|+
T Consensus         5 ~~~y~C~~Cg~~~~~~--------------~g~Cp~C~   28 (446)
T PRK11823          5 KTAYVCQECGAESPKW--------------LGRCPECG   28 (446)
T ss_pred             CCeEECCcCCCCCccc--------------CeeCcCCC
Confidence            4568999999765332              26788885


No 233
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=41.18  E-value=30  Score=16.14  Aligned_cols=7  Identities=29%  Similarity=0.766  Sum_probs=3.1

Q ss_pred             cccCCCC
Q psy10762         65 FPCQYCP   71 (126)
Q Consensus        65 ~~C~~C~   71 (126)
                      ..|+.|+
T Consensus        47 ~~Cp~Cg   53 (56)
T PF02591_consen   47 VFCPNCG   53 (56)
T ss_pred             EECcCCC
Confidence            3444444


No 234
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=40.69  E-value=9.1  Score=23.38  Aligned_cols=23  Identities=22%  Similarity=0.465  Sum_probs=0.0

Q ss_pred             CCCCccCccccc-ccCCHHHHHHH
Q psy10762         89 GESPHKCTYCMK-SFTRKEHLTNH  111 (126)
Q Consensus        89 ~~~~~~C~~C~~-~f~~~~~l~~H  111 (126)
                      -...|.|.+||. +|.-+..+.+|
T Consensus        98 L~~ey~CEICGN~~Y~GrkaFekH  121 (196)
T PF11931_consen   98 LGVEYKCEICGNQSYKGRKAFEKH  121 (196)
T ss_dssp             ------------------------
T ss_pred             CCCeeeeEeCCCcceecHHHHHHh
Confidence            344455555543 23334444444


No 235
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=40.61  E-value=13  Score=15.90  Aligned_cols=14  Identities=29%  Similarity=0.586  Sum_probs=8.6

Q ss_pred             cCcccccccCCHHH
Q psy10762         94 KCTYCMKSFTRKEH  107 (126)
Q Consensus        94 ~C~~C~~~f~~~~~  107 (126)
                      .|+.|++.|...+.
T Consensus         4 ~CprC~kg~Hwa~~   17 (36)
T PF14787_consen    4 LCPRCGKGFHWASE   17 (36)
T ss_dssp             C-TTTSSSCS-TTT
T ss_pred             cCcccCCCcchhhh
Confidence            58888888876543


No 236
>PRK00420 hypothetical protein; Validated
Probab=40.27  E-value=18  Score=19.96  Aligned_cols=10  Identities=20%  Similarity=0.468  Sum_probs=5.1

Q ss_pred             cccCCCCCcC
Q psy10762         65 FPCQYCPKAF   74 (126)
Q Consensus        65 ~~C~~C~~~~   74 (126)
                      ..||.|+...
T Consensus        41 ~~Cp~Cg~~~   50 (112)
T PRK00420         41 VVCPVHGKVY   50 (112)
T ss_pred             eECCCCCCee
Confidence            3555555433


No 237
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=39.90  E-value=14  Score=15.57  Aligned_cols=13  Identities=38%  Similarity=0.938  Sum_probs=5.8

Q ss_pred             eeccccccccCCh
Q psy10762          9 HRCDYCAKTFTRK   21 (126)
Q Consensus         9 ~~C~~C~~~f~~~   21 (126)
                      -.|.+|++.|...
T Consensus         4 ~~C~eC~~~f~dS   16 (34)
T PF01286_consen    4 PKCDECGKPFMDS   16 (34)
T ss_dssp             EE-TTT--EES-S
T ss_pred             chHhHhCCHHHHH
Confidence            3577777777554


No 238
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=39.75  E-value=32  Score=15.05  Aligned_cols=7  Identities=29%  Similarity=0.985  Sum_probs=3.2

Q ss_pred             cccCCCC
Q psy10762         65 FPCQYCP   71 (126)
Q Consensus        65 ~~C~~C~   71 (126)
                      ..||.|+
T Consensus        37 ~~CP~C~   43 (44)
T PF14634_consen   37 VKCPICR   43 (44)
T ss_pred             CCCcCCC
Confidence            3455443


No 239
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=39.53  E-value=16  Score=23.75  Aligned_cols=14  Identities=21%  Similarity=0.315  Sum_probs=9.0

Q ss_pred             CCCccCcccccccC
Q psy10762         90 ESPHKCTYCMKSFT  103 (126)
Q Consensus        90 ~~~~~C~~C~~~f~  103 (126)
                      .+.|.|+.||..+.
T Consensus       320 ~r~~~C~~cg~~~~  333 (364)
T COG0675         320 GRLFKCPRCGFVHD  333 (364)
T ss_pred             ceeEECCCCCCeeh
Confidence            35567777776654


No 240
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=39.07  E-value=14  Score=15.71  Aligned_cols=9  Identities=22%  Similarity=0.781  Sum_probs=4.6

Q ss_pred             eeccccccc
Q psy10762          9 HRCDYCAKT   17 (126)
Q Consensus         9 ~~C~~C~~~   17 (126)
                      ..|.+|+..
T Consensus         9 ~~C~~C~~~   17 (36)
T PF11781_consen    9 EPCPVCGSR   17 (36)
T ss_pred             CcCCCCCCe
Confidence            345555554


No 241
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=38.90  E-value=21  Score=24.87  Aligned_cols=12  Identities=17%  Similarity=0.495  Sum_probs=8.6

Q ss_pred             cceecccccccc
Q psy10762          7 TPHRCDYCAKTF   18 (126)
Q Consensus         7 ~~~~C~~C~~~f   18 (126)
                      ..|.|..||...
T Consensus         6 ~~y~C~~Cg~~~   17 (454)
T TIGR00416         6 SKFVCQHCGADS   17 (454)
T ss_pred             CeEECCcCCCCC
Confidence            458888888654


No 242
>KOG0317|consensus
Probab=38.88  E-value=16  Score=23.72  Aligned_cols=32  Identities=22%  Similarity=0.475  Sum_probs=15.1

Q ss_pred             ccCCCCCcCCChhhHHHHHHhhcCCCCccCcccccccC
Q psy10762         66 PCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFT  103 (126)
Q Consensus        66 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~  103 (126)
                      .|-.||..|.++-.+     .+.++++ .|+.|...|.
T Consensus       253 SaTpCGHiFCWsCI~-----~w~~ek~-eCPlCR~~~~  284 (293)
T KOG0317|consen  253 SATPCGHIFCWSCIL-----EWCSEKA-ECPLCREKFQ  284 (293)
T ss_pred             CcCcCcchHHHHHHH-----HHHcccc-CCCcccccCC
Confidence            344466666554222     2223333 2666665554


No 243
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=38.78  E-value=11  Score=20.37  Aligned_cols=8  Identities=25%  Similarity=0.771  Sum_probs=4.6

Q ss_pred             CcccCCcc
Q psy10762         36 PHHCNYCA   43 (126)
Q Consensus        36 ~~~c~~C~   43 (126)
                      .|.|+.|+
T Consensus        21 ~f~CP~Cg   28 (99)
T PRK14892         21 IFECPRCG   28 (99)
T ss_pred             EeECCCCC
Confidence            35566665


No 244
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=38.68  E-value=14  Score=15.44  Aligned_cols=11  Identities=36%  Similarity=0.972  Sum_probs=6.4

Q ss_pred             ccCcccccccC
Q psy10762         93 HKCTYCMKSFT  103 (126)
Q Consensus        93 ~~C~~C~~~f~  103 (126)
                      +.|..|+.+|.
T Consensus        22 ~~C~~Cg~~~~   32 (33)
T PF08792_consen   22 EVCIFCGSSFP   32 (33)
T ss_pred             EEcccCCcEee
Confidence            45666666553


No 245
>PF06676 DUF1178:  Protein of unknown function (DUF1178);  InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Probab=38.54  E-value=24  Score=20.59  Aligned_cols=30  Identities=13%  Similarity=0.214  Sum_probs=15.8

Q ss_pred             ccCChhHHHHHHHhhcCCCCcccCCcccccCCch
Q psy10762         17 TFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKD   50 (126)
Q Consensus        17 ~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~   50 (126)
                      +|.+...+.....    .....|+.||..-..+.
T Consensus        17 WF~ss~~fd~Q~~----~glv~CP~Cgs~~V~K~   46 (148)
T PF06676_consen   17 WFRSSAAFDRQQA----RGLVSCPVCGSTEVSKA   46 (148)
T ss_pred             ecCCHHHHHHHHH----cCCccCCCCCCCeEeee
Confidence            4555555554432    23466777776544443


No 246
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=38.03  E-value=13  Score=16.17  Aligned_cols=12  Identities=17%  Similarity=0.606  Sum_probs=8.5

Q ss_pred             eeccccccccCC
Q psy10762          9 HRCDYCAKTFTR   20 (126)
Q Consensus         9 ~~C~~C~~~f~~   20 (126)
                      +.|+.||..+.+
T Consensus        33 ~~C~~CGE~~~~   44 (46)
T TIGR03831        33 LVCPQCGEEYLD   44 (46)
T ss_pred             cccccCCCEeeC
Confidence            568888877654


No 247
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=37.75  E-value=22  Score=23.21  Aligned_cols=11  Identities=18%  Similarity=0.471  Sum_probs=5.8

Q ss_pred             cccCCCCCcCC
Q psy10762         65 FPCQYCPKAFT   75 (126)
Q Consensus        65 ~~C~~C~~~~~   75 (126)
                      +.|+.|+.-|.
T Consensus        46 ~vc~~c~~h~r   56 (285)
T TIGR00515        46 EVCPKCDHHMR   56 (285)
T ss_pred             CCCCCCCCcCc
Confidence            35666655443


No 248
>KOG1994|consensus
Probab=37.65  E-value=24  Score=22.18  Aligned_cols=26  Identities=19%  Similarity=0.399  Sum_probs=20.7

Q ss_pred             hcCCCCccCcccccccCCHHHHHHHH
Q psy10762         87 HTGESPHKCTYCMKSFTRKEHLTNHI  112 (126)
Q Consensus        87 ~~~~~~~~C~~C~~~f~~~~~l~~H~  112 (126)
                      ......|-|-.||..|....+|..|-
T Consensus       234 ~LR~eh~YC~fCG~~y~~~edl~ehC  259 (268)
T KOG1994|consen  234 FLRSEHYYCFFCGIKYKDEEDLYEHC  259 (268)
T ss_pred             HHhccceEEEEeccccCCHHHHHHhC
Confidence            34456688999999999998988873


No 249
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=37.64  E-value=16  Score=22.93  Aligned_cols=17  Identities=24%  Similarity=0.391  Sum_probs=13.0

Q ss_pred             CCcceeccccccccCCh
Q psy10762          5 GETPHRCDYCAKTFTRK   21 (126)
Q Consensus         5 ~~~~~~C~~C~~~f~~~   21 (126)
                      .+++.+|.+||..|.-.
T Consensus       178 EGkpqRCpECGqVFKLV  194 (268)
T PTZ00043        178 EGFLYRCGECDQIFMLV  194 (268)
T ss_pred             CCCCccCCCCCcEEEEE
Confidence            35688899999988654


No 250
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=37.41  E-value=6.4  Score=25.74  Aligned_cols=38  Identities=18%  Similarity=0.336  Sum_probs=19.6

Q ss_pred             CcccCCCCCcCCChhhHHHHHHh--hcCCCCccCcccccccC
Q psy10762         64 PFPCQYCPKAFTRKDHLVNHVRR--HTGESPHKCTYCMKSFT  103 (126)
Q Consensus        64 ~~~C~~C~~~~~~~~~l~~h~~~--~~~~~~~~C~~C~~~f~  103 (126)
                      .+.|+.|+..=.....++  .+.  ......|.|..||..|.
T Consensus       258 ~~~C~~C~~~~~~~~q~Q--trsaDEpmT~f~~C~~Cg~~w~  297 (299)
T TIGR01385       258 LFTCGKCKQKKCTYYQLQ--TRSADEPMTTFVTCEECGNRWK  297 (299)
T ss_pred             cccCCCCCCccceEEEec--ccCCCCCCeEEEEcCCCCCeee
Confidence            478999974322211211  111  11123478999997754


No 251
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=37.32  E-value=3.9  Score=17.37  Aligned_cols=10  Identities=20%  Similarity=0.816  Sum_probs=3.9

Q ss_pred             cccCCccccc
Q psy10762         37 HHCNYCAKSF   46 (126)
Q Consensus        37 ~~c~~C~~~~   46 (126)
                      ..|..||..+
T Consensus        22 isC~~CGPr~   31 (35)
T PF07503_consen   22 ISCTNCGPRY   31 (35)
T ss_dssp             --BTTCC-SC
T ss_pred             ccCCCCCCCE
Confidence            4466666443


No 252
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=37.31  E-value=19  Score=19.66  Aligned_cols=24  Identities=25%  Similarity=0.578  Sum_probs=18.1

Q ss_pred             CCccCcccccccCCHHHHHHHHHH
Q psy10762         91 SPHKCTYCMKSFTRKEHLTNHIRQ  114 (126)
Q Consensus        91 ~~~~C~~C~~~f~~~~~l~~H~~~  114 (126)
                      ..+-|-.|.+-|.....|..|.+.
T Consensus        54 GqhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          54 GQHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             ceeeeehhHHHHHHHHHHHHHhcc
Confidence            345677888888888888888654


No 253
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=36.92  E-value=21  Score=24.21  Aligned_cols=11  Identities=18%  Similarity=0.374  Sum_probs=7.5

Q ss_pred             eeccccccccC
Q psy10762          9 HRCDYCAKTFT   19 (126)
Q Consensus         9 ~~C~~C~~~f~   19 (126)
                      |.|..||....
T Consensus         1 ~~c~~cg~~~~   11 (372)
T cd01121           1 YVCSECGYVSP   11 (372)
T ss_pred             CCCCCCCCCCC
Confidence            56888886543


No 254
>KOG1842|consensus
Probab=36.83  E-value=24  Score=24.63  Aligned_cols=26  Identities=15%  Similarity=0.310  Sum_probs=22.5

Q ss_pred             cceeccccccccCChhHHHHHHHhhc
Q psy10762          7 TPHRCDYCAKTFTRKEHLVNHVRQHT   32 (126)
Q Consensus         7 ~~~~C~~C~~~f~~~~~l~~h~~~h~   32 (126)
                      ..|.|+.|...|.....|..|...-+
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH   39 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEH   39 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhc
Confidence            45999999999999999999987543


No 255
>KOG0717|consensus
Probab=36.74  E-value=22  Score=24.93  Aligned_cols=22  Identities=32%  Similarity=0.649  Sum_probs=19.3

Q ss_pred             cccCCCCCcCCChhhHHHHHHh
Q psy10762         65 FPCQYCPKAFTRKDHLVNHVRR   86 (126)
Q Consensus        65 ~~C~~C~~~~~~~~~l~~h~~~   86 (126)
                      +-|+.|.+.|.+..++..|...
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            6899999999999998888764


No 256
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=36.60  E-value=28  Score=24.37  Aligned_cols=27  Identities=30%  Similarity=0.664  Sum_probs=23.0

Q ss_pred             CCCccCcccccccCCHHHHHHHHHHhh
Q psy10762         90 ESPHKCTYCMKSFTRKEHLTNHIRQHT  116 (126)
Q Consensus        90 ~~~~~C~~C~~~f~~~~~l~~H~~~h~  116 (126)
                      ...|.|..|-+-|.+...|.+|+..-.
T Consensus       196 ~~lyiCe~Cl~y~~~~~~~~~H~~~C~  222 (450)
T PLN00104        196 SKLYFCEFCLKFMKRKEQLQRHMKKCD  222 (450)
T ss_pred             CeEEEchhhhhhhcCHHHHHHHHhcCC
Confidence            456999999999999999999986544


No 257
>KOG2272|consensus
Probab=35.75  E-value=12  Score=23.85  Aligned_cols=16  Identities=19%  Similarity=0.606  Sum_probs=8.4

Q ss_pred             CcccCCcccccCCchH
Q psy10762         36 PHHCNYCAKSFTRKDH   51 (126)
Q Consensus        36 ~~~c~~C~~~~~~~~~   51 (126)
                      -|.|++|.+...+...
T Consensus        99 CF~Cd~Cn~~Lad~gf  114 (332)
T KOG2272|consen   99 CFRCDLCNKHLADQGF  114 (332)
T ss_pred             cchhHHHHHHHhhhhh
Confidence            4566666655444433


No 258
>PLN03239 histone acetyltransferase; Provisional
Probab=35.68  E-value=30  Score=23.30  Aligned_cols=25  Identities=20%  Similarity=0.372  Sum_probs=21.6

Q ss_pred             CCCccCcccccccCCHHHHHHHHHH
Q psy10762         90 ESPHKCTYCMKSFTRKEHLTNHIRQ  114 (126)
Q Consensus        90 ~~~~~C~~C~~~f~~~~~l~~H~~~  114 (126)
                      ...|.|..|-+-|.+...|.+|+..
T Consensus       104 ~~lYiCE~Clky~~~~~~l~~H~~~  128 (351)
T PLN03239        104 DVLYVCEFSFGFFARKSELLRFQAK  128 (351)
T ss_pred             ceEEEeccchhhhcCHHHHHHHHHh
Confidence            4679999999999999999999653


No 259
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=35.63  E-value=6.3  Score=16.25  Aligned_cols=10  Identities=40%  Similarity=0.919  Sum_probs=4.9

Q ss_pred             ccCccccccc
Q psy10762         93 HKCTYCMKSF  102 (126)
Q Consensus        93 ~~C~~C~~~f  102 (126)
                      |.|..|+..+
T Consensus        28 f~C~~C~~~L   37 (39)
T smart00132       28 FKCSKCGKPL   37 (39)
T ss_pred             CCCcccCCcC
Confidence            4455555443


No 260
>PTZ00064 histone acetyltransferase; Provisional
Probab=35.45  E-value=33  Score=24.41  Aligned_cols=27  Identities=26%  Similarity=0.690  Sum_probs=23.1

Q ss_pred             CCCccCcccccccCCHHHHHHHHHHhh
Q psy10762         90 ESPHKCTYCMKSFTRKEHLTNHIRQHT  116 (126)
Q Consensus        90 ~~~~~C~~C~~~f~~~~~l~~H~~~h~  116 (126)
                      ...|.|..|-+-|.+...|.+|+..-.
T Consensus       278 d~LYICEfCLkY~~s~~~l~rH~~~C~  304 (552)
T PTZ00064        278 DTLHFCEYCLDFFCFEDELIRHLSRCQ  304 (552)
T ss_pred             CeEEEccchhhhhCCHHHHHHHHhcCC
Confidence            456999999999999999999987644


No 261
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=34.98  E-value=39  Score=13.65  Aligned_cols=15  Identities=20%  Similarity=0.560  Sum_probs=7.1

Q ss_pred             cceeccccccccCCh
Q psy10762          7 TPHRCDYCAKTFTRK   21 (126)
Q Consensus         7 ~~~~C~~C~~~f~~~   21 (126)
                      ..|.|+.|+..+-+.
T Consensus        12 ~kY~Cp~C~~~~CSl   26 (30)
T PF04438_consen   12 AKYRCPRCGARYCSL   26 (30)
T ss_dssp             ESEE-TTT--EESSH
T ss_pred             CEEECCCcCCceeCc
Confidence            346777777665544


No 262
>PF12773 DZR:  Double zinc ribbon
Probab=34.94  E-value=31  Score=15.48  Aligned_cols=9  Identities=22%  Similarity=0.501  Sum_probs=4.9

Q ss_pred             cccCCCCCc
Q psy10762         65 FPCQYCPKA   73 (126)
Q Consensus        65 ~~C~~C~~~   73 (126)
                      ..|+.|+..
T Consensus        30 ~~C~~Cg~~   38 (50)
T PF12773_consen   30 KICPNCGAE   38 (50)
T ss_pred             CCCcCCcCC
Confidence            456666543


No 263
>PRK12722 transcriptional activator FlhC; Provisional
Probab=34.51  E-value=31  Score=21.00  Aligned_cols=28  Identities=21%  Similarity=0.551  Sum_probs=18.9

Q ss_pred             cccCCCCCcCCChhhHHHHHHhhcCCCCccCccccc
Q psy10762         65 FPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMK  100 (126)
Q Consensus        65 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~  100 (126)
                      ..|..|+..|.....        .....|.|+.|.-
T Consensus       135 ~~C~~Cgg~fv~~~~--------e~~~~f~CplC~~  162 (187)
T PRK12722        135 SSCNCCGGHFVTHAH--------DPVGSFVCGLCQP  162 (187)
T ss_pred             ccCCCCCCCeecccc--------ccCCCCcCCCCCC
Confidence            478899888765432        2235689999964


No 264
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=34.32  E-value=23  Score=16.62  Aligned_cols=9  Identities=33%  Similarity=0.888  Sum_probs=3.8

Q ss_pred             ccCCCCCcC
Q psy10762         66 PCQYCPKAF   74 (126)
Q Consensus        66 ~C~~C~~~~   74 (126)
                      .|+.|+..|
T Consensus        42 ~C~~C~~~f   50 (64)
T smart00647       42 TCPKCGFSF   50 (64)
T ss_pred             ECCCCCCeE
Confidence            444444333


No 265
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=33.72  E-value=12  Score=21.42  Aligned_cols=15  Identities=27%  Similarity=0.735  Sum_probs=12.4

Q ss_pred             CCCccCcccccccCC
Q psy10762         90 ESPHKCTYCMKSFTR  104 (126)
Q Consensus        90 ~~~~~C~~C~~~f~~  104 (126)
                      .++.+|+.||..|..
T Consensus       110 g~~~RCpeCG~~fkL  124 (136)
T PF01215_consen  110 GKPQRCPECGQVFKL  124 (136)
T ss_dssp             TSEEEETTTEEEEEE
T ss_pred             CCccCCCCCCeEEEE
Confidence            468899999998864


No 266
>COG1379 PHP family phosphoesterase with a Zn ribbon [General function prediction only]
Probab=33.69  E-value=46  Score=22.40  Aligned_cols=32  Identities=13%  Similarity=0.417  Sum_probs=19.8

Q ss_pred             ccCCCCCcCCChhhHHHHHHhhcCCCCccCcccccccCCHH
Q psy10762         66 PCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKE  106 (126)
Q Consensus        66 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~  106 (126)
                      .|..|...|.-....         .-.++|+.||..+....
T Consensus       248 AC~rC~t~y~le~A~---------~~~wrCpkCGg~ikKGV  279 (403)
T COG1379         248 ACSRCYTRYSLEEAK---------SLRWRCPKCGGKIKKGV  279 (403)
T ss_pred             HHHHhhhccCcchhh---------hhcccCcccccchhhhH
Confidence            366666655443221         23478999999877653


No 267
>PRK12860 transcriptional activator FlhC; Provisional
Probab=33.47  E-value=33  Score=20.94  Aligned_cols=27  Identities=22%  Similarity=0.490  Sum_probs=18.3

Q ss_pred             cccCCCCCcCCChhhHHHHHHhhcCCCCccCcccc
Q psy10762         65 FPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCM   99 (126)
Q Consensus        65 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~   99 (126)
                      ..|..|+..|.....        .....|.|+.|.
T Consensus       135 ~~C~~Cgg~fv~~~~--------e~~~~f~CplC~  161 (189)
T PRK12860        135 ARCCRCGGKFVTHAH--------DLRHNFVCGLCQ  161 (189)
T ss_pred             ccCCCCCCCeecccc--------ccCCCCcCCCCC
Confidence            478889887765322        223568899986


No 268
>PF08882 Acetone_carb_G:  Acetone carboxylase gamma subunit;  InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction:  CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+   It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits). It is expressed to high levels (17 to 25% of soluble protein) in cells grown with acetone as the carbon source but are not present at detectable levels in cells grown with other carbon sources []. Acetone carboxylase may enable Helicobacter pylori to survive off acetone in the stomach of humans and other mammals where it is the etiological agent of peptic ulcer disease []. This entry represents the family of gamma subunit-related acetone carboxylase proteins.
Probab=33.30  E-value=12  Score=20.55  Aligned_cols=12  Identities=17%  Similarity=0.570  Sum_probs=8.2

Q ss_pred             CcccCCCCCcCC
Q psy10762         64 PFPCQYCPKAFT   75 (126)
Q Consensus        64 ~~~C~~C~~~~~   75 (126)
                      .|-||.||....
T Consensus        74 EyyCP~Cgt~le   85 (112)
T PF08882_consen   74 EYYCPGCGTQLE   85 (112)
T ss_pred             EEECCCCcceeE
Confidence            477888886543


No 269
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=33.03  E-value=20  Score=21.07  Aligned_cols=14  Identities=29%  Similarity=0.748  Sum_probs=6.9

Q ss_pred             CCccCcccccccCC
Q psy10762         91 SPHKCTYCMKSFTR  104 (126)
Q Consensus        91 ~~~~C~~C~~~f~~  104 (126)
                      .|.-|..||+.|.+
T Consensus        67 ~PsYC~~CGkpyPW   80 (158)
T PF10083_consen   67 APSYCHNCGKPYPW   80 (158)
T ss_pred             CChhHHhCCCCCch
Confidence            34445555555554


No 270
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=32.88  E-value=19  Score=15.77  Aligned_cols=7  Identities=43%  Similarity=1.023  Sum_probs=3.8

Q ss_pred             cCccccc
Q psy10762         94 KCTYCMK  100 (126)
Q Consensus        94 ~C~~C~~  100 (126)
                      .|+.|+.
T Consensus         2 ~Cp~Cg~    8 (43)
T PF08271_consen    2 KCPNCGS    8 (43)
T ss_dssp             SBTTTSS
T ss_pred             CCcCCcC
Confidence            4555554


No 271
>PRK06260 threonine synthase; Validated
Probab=32.80  E-value=32  Score=23.46  Aligned_cols=26  Identities=23%  Similarity=0.623  Sum_probs=16.2

Q ss_pred             cccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcC
Q psy10762         37 HHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAF   74 (126)
Q Consensus        37 ~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~   74 (126)
                      +.|..||..+...            ...+.|+.|+..+
T Consensus         4 ~~C~~cg~~~~~~------------~~~~~Cp~cg~~l   29 (397)
T PRK06260          4 LKCIECGKEYDPD------------EIIYTCPECGGLL   29 (397)
T ss_pred             EEECCCCCCCCCC------------CccccCCCCCCeE
Confidence            5777888666422            2246788887543


No 272
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=32.73  E-value=47  Score=18.23  Aligned_cols=23  Identities=13%  Similarity=0.255  Sum_probs=16.7

Q ss_pred             cceeccccccccCChhHHHHHHH
Q psy10762          7 TPHRCDYCAKTFTRKEHLVNHVR   29 (126)
Q Consensus         7 ~~~~C~~C~~~f~~~~~l~~h~~   29 (126)
                      ..+.|+.||..+...........
T Consensus        30 ~~~~C~~CGe~~~~~e~~~~~~~   52 (127)
T TIGR03830        30 PGWYCPACGEELLDPEESKRNSA   52 (127)
T ss_pred             eeeECCCCCCEEEcHHHHHHHHH
Confidence            34779999999888876555443


No 273
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=32.32  E-value=34  Score=15.04  Aligned_cols=11  Identities=36%  Similarity=1.186  Sum_probs=7.7

Q ss_pred             ceecccccccc
Q psy10762          8 PHRCDYCAKTF   18 (126)
Q Consensus         8 ~~~C~~C~~~f   18 (126)
                      +..|+.|+..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            56777777665


No 274
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=32.08  E-value=33  Score=25.30  Aligned_cols=8  Identities=25%  Similarity=0.609  Sum_probs=5.7

Q ss_pred             eccccccc
Q psy10762         10 RCDYCAKT   17 (126)
Q Consensus        10 ~C~~C~~~   17 (126)
                      .|+.||..
T Consensus         3 ~Cp~Cg~~   10 (645)
T PRK14559          3 ICPQCQFE   10 (645)
T ss_pred             cCCCCCCc
Confidence            57788765


No 275
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=31.81  E-value=40  Score=21.98  Aligned_cols=11  Identities=27%  Similarity=0.809  Sum_probs=5.9

Q ss_pred             cccCCCCCcCC
Q psy10762         65 FPCQYCPKAFT   75 (126)
Q Consensus        65 ~~C~~C~~~~~   75 (126)
                      |.|+.|.-.|.
T Consensus       256 yvCs~Clsi~C  266 (279)
T TIGR00627       256 FVCSVCLSVLC  266 (279)
T ss_pred             EECCCccCCcC
Confidence            55666654443


No 276
>PLN02748 tRNA dimethylallyltransferase
Probab=31.60  E-value=41  Score=23.75  Aligned_cols=24  Identities=13%  Similarity=0.278  Sum_probs=19.6

Q ss_pred             CCccCccccc-ccCCHHHHHHHHHH
Q psy10762         91 SPHKCTYCMK-SFTRKEHLTNHIRQ  114 (126)
Q Consensus        91 ~~~~C~~C~~-~f~~~~~l~~H~~~  114 (126)
                      +.|.|.+|++ .+.-...+..|+..
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcc
Confidence            5688999997 79888888888754


No 277
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=31.55  E-value=32  Score=22.62  Aligned_cols=11  Identities=18%  Similarity=0.504  Sum_probs=5.1

Q ss_pred             ccCcccccccC
Q psy10762         93 HKCTYCMKSFT  103 (126)
Q Consensus        93 ~~C~~C~~~f~  103 (126)
                      +.|+.|+.-|.
T Consensus        58 ~vcp~c~~h~r   68 (296)
T CHL00174         58 NICEQCGYHLK   68 (296)
T ss_pred             CCCCCCCCCcC
Confidence            34555544443


No 278
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=31.43  E-value=7.9  Score=18.76  Aligned_cols=45  Identities=20%  Similarity=0.430  Sum_probs=21.5

Q ss_pred             HHhhhcCCCCcccCCCCCcCCChhhHHHHHHhhcCCCCccCcccccccC
Q psy10762         55 HERQHTGETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFT  103 (126)
Q Consensus        55 h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~  103 (126)
                      +..+..+..++.|+.-+..+....-++.   . ..+....|+-|+..|.
T Consensus        15 ~~~I~~~~~~l~C~g~~~p~~HPrV~L~---m-g~~gev~CPYC~t~y~   59 (62)
T COG4391          15 HETIEIGDLPLMCPGPEPPNDHPRVFLD---M-GDEGEVVCPYCSTRYR   59 (62)
T ss_pred             ceEEEeCCeeEEcCCCCCCCCCCEEEEE---c-CCCCcEecCccccEEE
Confidence            3344555566666654433333222111   1 1233346777877765


No 279
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=31.42  E-value=7.2  Score=19.44  Aligned_cols=12  Identities=25%  Similarity=0.468  Sum_probs=5.7

Q ss_pred             eeccccccccCC
Q psy10762          9 HRCDYCAKTFTR   20 (126)
Q Consensus         9 ~~C~~C~~~f~~   20 (126)
                      ++++-|++.|.-
T Consensus        11 ~~~~cC~~~y~C   22 (71)
T PF05495_consen   11 IRFPCCGKYYPC   22 (71)
T ss_dssp             EEETTTTEEESS
T ss_pred             EECCcccCeecH
Confidence            344455555443


No 280
>KOG0782|consensus
Probab=31.17  E-value=9.2  Score=27.49  Aligned_cols=51  Identities=24%  Similarity=0.461  Sum_probs=32.4

Q ss_pred             hHHHHHHhhhcCCCCcccCCCCCcCCChhhHHHHHHhhcCC-CCccCcccccccCCHH
Q psy10762         50 DHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHVRRHTGE-SPHKCTYCMKSFTRKE  106 (126)
Q Consensus        50 ~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~-~~~~C~~C~~~f~~~~  106 (126)
                      ..+..|-.+|.....-.|..|+++|.+.-.|.      ..| -...|.+|...|..+.
T Consensus       239 ~~fvrHHWVHrrRqeGkC~~CgKgFQQKf~Fh------sKEivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  239 SGFVRHHWVHRRRQEGKCNTCGKGFQQKFFFH------SKEIVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             ccchHHhHhhHhhhccccchhhhhhhhheeec------cccEEEEEehHHHHHhhcch
Confidence            34666656665544568999998887654432      222 2357888888877654


No 281
>PRK01343 zinc-binding protein; Provisional
Probab=30.52  E-value=27  Score=16.73  Aligned_cols=11  Identities=36%  Similarity=0.612  Sum_probs=6.9

Q ss_pred             ccCcccccccC
Q psy10762         93 HKCTYCMKSFT  103 (126)
Q Consensus        93 ~~C~~C~~~f~  103 (126)
                      ..|++|++.+.
T Consensus        10 ~~CP~C~k~~~   20 (57)
T PRK01343         10 RPCPECGKPST   20 (57)
T ss_pred             CcCCCCCCcCc
Confidence            45777776654


No 282
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=28.69  E-value=89  Score=19.84  Aligned_cols=11  Identities=36%  Similarity=0.769  Sum_probs=5.3

Q ss_pred             eeccccccccC
Q psy10762          9 HRCDYCAKTFT   19 (126)
Q Consensus         9 ~~C~~C~~~f~   19 (126)
                      ..|..|+..+.
T Consensus       120 ~~C~~C~~~~~  130 (244)
T PRK14138        120 YYCVRCGKRYT  130 (244)
T ss_pred             eEECCCCCccc
Confidence            44555555443


No 283
>TIGR00310 ZPR1_znf ZPR1 zinc finger domain.
Probab=28.67  E-value=6.1  Score=24.03  Aligned_cols=38  Identities=21%  Similarity=0.343  Sum_probs=19.0

Q ss_pred             eccccccccCChhHHHHHHHhhcCCC---CcccCCcccccCC
Q psy10762         10 RCDYCAKTFTRKEHLVNHVRQHTGES---PHHCNYCAKSFTR   48 (126)
Q Consensus        10 ~C~~C~~~f~~~~~l~~h~~~h~~~~---~~~c~~C~~~~~~   48 (126)
                      .|+.|+........+..+ ..+.++.   .+.|+.||+....
T Consensus         2 ~Cp~C~~~~~~~~~~~~~-IP~F~evii~sf~C~~CGyr~~e   42 (192)
T TIGR00310         2 DCPSCGGECETVMKTVND-IPYFGEVLETSTICEHCGYRSND   42 (192)
T ss_pred             cCCCCCCCCEEEEEEEcC-CCCcceEEEEEEECCCCCCccce
Confidence            477777543322222221 3333332   4678888866543


No 284
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=28.62  E-value=40  Score=19.42  Aligned_cols=46  Identities=17%  Similarity=0.244  Sum_probs=25.1

Q ss_pred             cccCCCCCcCCChhhHHH--HHH---hhcCCCCccCcccccccCCHHHHHH
Q psy10762         65 FPCQYCPKAFTRKDHLVN--HVR---RHTGESPHKCTYCMKSFTRKEHLTN  110 (126)
Q Consensus        65 ~~C~~C~~~~~~~~~l~~--h~~---~~~~~~~~~C~~C~~~f~~~~~l~~  110 (126)
                      -.|+.|+..+.....-..  -+.   ....+..+.|+.|++.|=..+.+.+
T Consensus        92 sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiyW~GsH~~~  142 (147)
T PF01927_consen   92 SRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIYWEGSHWRR  142 (147)
T ss_pred             CccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEecccccHHH
Confidence            478888765433211100  000   1122456889999998866655544


No 285
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=28.51  E-value=31  Score=22.61  Aligned_cols=10  Identities=20%  Similarity=0.521  Sum_probs=5.7

Q ss_pred             cccCCCCCcC
Q psy10762         65 FPCQYCPKAF   74 (126)
Q Consensus        65 ~~C~~C~~~~   74 (126)
                      +.|+.|+.-|
T Consensus        47 ~vc~~c~~h~   56 (292)
T PRK05654         47 NVCPKCGHHM   56 (292)
T ss_pred             CCCCCCCCCe
Confidence            3566666544


No 286
>PF14369 zf-RING_3:  zinc-finger
Probab=28.35  E-value=27  Score=14.74  Aligned_cols=10  Identities=30%  Similarity=0.863  Sum_probs=6.4

Q ss_pred             cCcccccccC
Q psy10762         94 KCTYCMKSFT  103 (126)
Q Consensus        94 ~C~~C~~~f~  103 (126)
                      .|+.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            4777776664


No 287
>KOG2906|consensus
Probab=28.29  E-value=6.1  Score=21.12  Aligned_cols=38  Identities=16%  Similarity=0.270  Sum_probs=18.5

Q ss_pred             ccCCCCCcCCChhhHHHHHHhhcCCCCccCcccccccC
Q psy10762         66 PCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFT  103 (126)
Q Consensus        66 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~  103 (126)
                      .|+.||..-.+..+|+..-.-......|+|-.|+.+.+
T Consensus        67 ~Cp~Cgh~rayF~qlQtRSADEPmT~FYkC~~C~~~Wr  104 (105)
T KOG2906|consen   67 TCPTCGHERAYFMQLQTRSADEPMTTFYKCCKCKHRWR  104 (105)
T ss_pred             cCCCCCCCceEEEEeeeccCCCcHhHhhhhhccccccc
Confidence            68888743333333321111111224488988877643


No 288
>KOG2747|consensus
Probab=28.15  E-value=39  Score=23.21  Aligned_cols=29  Identities=21%  Similarity=0.630  Sum_probs=24.5

Q ss_pred             CCCccCcccccccCCHHHHHHHHHHhhhc
Q psy10762         90 ESPHKCTYCMKSFTRKEHLTNHIRQHTVR  118 (126)
Q Consensus        90 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~  118 (126)
                      ...|.|..|-+-+.+...|.+|+..-...
T Consensus       156 ~~lYiCEfCLkY~~s~~~l~rH~~kC~~r  184 (396)
T KOG2747|consen  156 DKLYICEFCLKYMKSRTSLQRHLKKCKLR  184 (396)
T ss_pred             CeEEEehHHHhHhchHHHHHHHHHhcCCC
Confidence            45699999999999999999999876544


No 289
>KOG2857|consensus
Probab=28.06  E-value=28  Score=20.14  Aligned_cols=23  Identities=13%  Similarity=0.307  Sum_probs=20.0

Q ss_pred             cceeccccccccCChhHHHHHHH
Q psy10762          7 TPHRCDYCAKTFTRKEHLVNHVR   29 (126)
Q Consensus         7 ~~~~C~~C~~~f~~~~~l~~h~~   29 (126)
                      ..|+|+.|..-|.+..-++.|+.
T Consensus        16 ~KYKCpkC~vPYCSl~CfKiHk~   38 (157)
T KOG2857|consen   16 IKYKCPKCSVPYCSLPCFKIHKS   38 (157)
T ss_pred             hhccCCCCCCccccchhhhhccC
Confidence            36999999999999999888875


No 290
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=26.87  E-value=21  Score=20.73  Aligned_cols=27  Identities=26%  Similarity=0.580  Sum_probs=14.6

Q ss_pred             CcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCC
Q psy10762         36 PHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPK   72 (126)
Q Consensus        36 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~   72 (126)
                      .+.|..||......         + ....-.||.|+.
T Consensus       112 ~l~C~~Cg~~~~~~---------~-~~~l~~Cp~C~~  138 (146)
T PF07295_consen  112 TLVCENCGHEVELT---------H-PERLPPCPKCGH  138 (146)
T ss_pred             eEecccCCCEEEec---------C-CCcCCCCCCCCC
Confidence            46777777544221         1 222347777764


No 291
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=26.71  E-value=29  Score=17.05  Aligned_cols=8  Identities=38%  Similarity=0.804  Sum_probs=4.5

Q ss_pred             ccCccccc
Q psy10762         93 HKCTYCMK  100 (126)
Q Consensus        93 ~~C~~C~~  100 (126)
                      |.|+.|+.
T Consensus         1 y~C~KCg~    8 (64)
T PF09855_consen    1 YKCPKCGN    8 (64)
T ss_pred             CCCCCCCC
Confidence            45666654


No 292
>PRK07218 replication factor A; Provisional
Probab=26.71  E-value=41  Score=23.38  Aligned_cols=10  Identities=20%  Similarity=0.584  Sum_probs=6.9

Q ss_pred             cccCCCCCcC
Q psy10762         65 FPCQYCPKAF   74 (126)
Q Consensus        65 ~~C~~C~~~~   74 (126)
                      ..||.|++..
T Consensus       298 ~rCP~C~r~v  307 (423)
T PRK07218        298 ERCPECGRVI  307 (423)
T ss_pred             ecCcCccccc
Confidence            4678887665


No 293
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=26.67  E-value=29  Score=20.30  Aligned_cols=12  Identities=25%  Similarity=0.814  Sum_probs=6.6

Q ss_pred             CCcccCCCCCcC
Q psy10762         63 TPFPCQYCPKAF   74 (126)
Q Consensus        63 ~~~~C~~C~~~~   74 (126)
                      ..|.|..|+...
T Consensus        50 ~~~~C~~C~~~~   61 (166)
T cd04476          50 GTYRCEKCNKSV   61 (166)
T ss_pred             CcEECCCCCCcC
Confidence            346666665543


No 294
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=26.54  E-value=39  Score=23.58  Aligned_cols=13  Identities=23%  Similarity=0.452  Sum_probs=8.3

Q ss_pred             cceeccccccccC
Q psy10762          7 TPHRCDYCAKTFT   19 (126)
Q Consensus         7 ~~~~C~~C~~~f~   19 (126)
                      ..|.|..||....
T Consensus         6 t~f~C~~CG~~s~   18 (456)
T COG1066           6 TAFVCQECGYVSP   18 (456)
T ss_pred             cEEEcccCCCCCc
Confidence            4577777776543


No 295
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=26.30  E-value=36  Score=13.56  Aligned_cols=8  Identities=25%  Similarity=0.812  Sum_probs=4.2

Q ss_pred             cCcccccc
Q psy10762         94 KCTYCMKS  101 (126)
Q Consensus        94 ~C~~C~~~  101 (126)
                      .|.+|++.
T Consensus         2 ~C~~C~~~    9 (30)
T PF03107_consen    2 WCDVCRRK    9 (30)
T ss_pred             CCCCCCCC
Confidence            45555544


No 296
>KOG1729|consensus
Probab=26.21  E-value=17  Score=23.72  Aligned_cols=9  Identities=33%  Similarity=0.711  Sum_probs=4.5

Q ss_pred             eeccccccc
Q psy10762          9 HRCDYCAKT   17 (126)
Q Consensus         9 ~~C~~C~~~   17 (126)
                      -.|..|+.+
T Consensus       169 ~~C~~C~~~  177 (288)
T KOG1729|consen  169 TECMVCGCT  177 (288)
T ss_pred             eecccCCCc
Confidence            345555553


No 297
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]
Probab=26.17  E-value=44  Score=21.99  Aligned_cols=14  Identities=43%  Similarity=0.999  Sum_probs=6.2

Q ss_pred             hhhcCCCCcccCCCC
Q psy10762         57 RQHTGETPFPCQYCP   71 (126)
Q Consensus        57 ~~~~~~~~~~C~~C~   71 (126)
                      +.|.+..| -||.|.
T Consensus        53 R~hL~~qp-~CP~Cr   66 (391)
T COG5432          53 RRHLGTQP-FCPVCR   66 (391)
T ss_pred             HHHhcCCC-CCcccc
Confidence            34444444 355553


No 298
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=26.13  E-value=21  Score=16.93  Aligned_cols=9  Identities=33%  Similarity=0.914  Sum_probs=4.3

Q ss_pred             CccCccccc
Q psy10762         92 PHKCTYCMK  100 (126)
Q Consensus        92 ~~~C~~C~~  100 (126)
                      |.-|+.|.+
T Consensus        28 PlyCpKCK~   36 (55)
T PF14205_consen   28 PLYCPKCKQ   36 (55)
T ss_pred             cccCCCCCc
Confidence            344555543


No 299
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=26.05  E-value=30  Score=16.13  Aligned_cols=16  Identities=31%  Similarity=0.781  Sum_probs=10.0

Q ss_pred             CCcceeccccccccCC
Q psy10762          5 GETPHRCDYCAKTFTR   20 (126)
Q Consensus         5 ~~~~~~C~~C~~~f~~   20 (126)
                      ++..++|..|++.+..
T Consensus        32 ~~~~~rC~YCe~~~~~   47 (52)
T PF02748_consen   32 EPIKLRCHYCERIITE   47 (52)
T ss_dssp             TTCEEEETTT--EEEH
T ss_pred             CCCEEEeeCCCCEecc
Confidence            4567889888887643


No 300
>KOG2932|consensus
Probab=25.82  E-value=80  Score=21.10  Aligned_cols=29  Identities=17%  Similarity=0.474  Sum_probs=22.5

Q ss_pred             cCCCCccCcc---cccccCCHHHHHHHHHHhh
Q psy10762         88 TGESPHKCTY---CMKSFTRKEHLTNHIRQHT  116 (126)
Q Consensus        88 ~~~~~~~C~~---C~~~f~~~~~l~~H~~~h~  116 (126)
                      ..+..|.|..   |.++|.+..+|+.|+..-+
T Consensus       140 ~~g~iFmC~~~~GC~RTyLsqrDlqAHInhrH  171 (389)
T KOG2932|consen  140 MMGGIFMCAAPHGCLRTYLSQRDLQAHINHRH  171 (389)
T ss_pred             cccceEEeecchhHHHHHhhHHHHHHHhhhhh
Confidence            4456688854   9999999999999976633


No 301
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=25.76  E-value=13  Score=16.81  Aligned_cols=6  Identities=33%  Similarity=0.949  Sum_probs=3.1

Q ss_pred             cccccC
Q psy10762         98 CMKSFT  103 (126)
Q Consensus        98 C~~~f~  103 (126)
                      ||-.|.
T Consensus        33 Cg~tfv   38 (47)
T PF04606_consen   33 CGHTFV   38 (47)
T ss_pred             CCCEEE
Confidence            555553


No 302
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=25.27  E-value=1.2e+02  Score=18.61  Aligned_cols=11  Identities=18%  Similarity=0.694  Sum_probs=5.4

Q ss_pred             CcccCCccccc
Q psy10762         36 PHHCNYCAKSF   46 (126)
Q Consensus        36 ~~~c~~C~~~~   46 (126)
                      ...|..|+..+
T Consensus        95 ~~~C~~C~~~~  105 (206)
T cd01410          95 IEVCKSCGPEY  105 (206)
T ss_pred             cccCCCCCCcc
Confidence            34455555443


No 303
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=25.21  E-value=24  Score=16.77  Aligned_cols=11  Identities=18%  Similarity=0.464  Sum_probs=3.4

Q ss_pred             CCccCcccccc
Q psy10762         91 SPHKCTYCMKS  101 (126)
Q Consensus        91 ~~~~C~~C~~~  101 (126)
                      +.|.|+.||.+
T Consensus        32 r~y~Cp~CgAt   42 (55)
T PF05741_consen   32 RKYVCPICGAT   42 (55)
T ss_dssp             GG---TTT---
T ss_pred             hcCcCCCCcCc
Confidence            45778888765


No 304
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=24.86  E-value=29  Score=16.45  Aligned_cols=12  Identities=42%  Similarity=0.847  Sum_probs=8.6

Q ss_pred             ccCcccccccCC
Q psy10762         93 HKCTYCMKSFTR  104 (126)
Q Consensus        93 ~~C~~C~~~f~~  104 (126)
                      .+|.+|++.|..
T Consensus         6 ~~C~~Cg~~~~~   17 (54)
T PF14446_consen    6 CKCPVCGKKFKD   17 (54)
T ss_pred             ccChhhCCcccC
Confidence            368888888853


No 305
>PTZ00409 Sir2 (Silent Information Regulator) protein; Provisional
Probab=24.75  E-value=1.1e+02  Score=19.93  Aligned_cols=14  Identities=36%  Similarity=0.548  Sum_probs=7.9

Q ss_pred             cceeccccccccCC
Q psy10762          7 TPHRCDYCAKTFTR   20 (126)
Q Consensus         7 ~~~~C~~C~~~f~~   20 (126)
                      ....|..|+..+..
T Consensus       136 ~~~~C~~C~~~~~~  149 (271)
T PTZ00409        136 FEARCCTCRKTIQL  149 (271)
T ss_pred             CcceeCCCCCCccc
Confidence            34556667665543


No 306
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.71  E-value=39  Score=16.42  Aligned_cols=8  Identities=25%  Similarity=0.932  Sum_probs=3.7

Q ss_pred             CcccCCCC
Q psy10762         64 PFPCQYCP   71 (126)
Q Consensus        64 ~~~C~~C~   71 (126)
                      .|.|+.|.
T Consensus        31 tymC~eC~   38 (68)
T COG4896          31 TYMCPECE   38 (68)
T ss_pred             eEechhhH
Confidence            34455543


No 307
>PRK14811 formamidopyrimidine-DNA glycosylase; Provisional
Probab=24.28  E-value=28  Score=22.45  Aligned_cols=30  Identities=23%  Similarity=0.541  Sum_probs=18.9

Q ss_pred             ccCCCCCcCCChhhHHHHHHhhcCCCCccCcccccccC
Q psy10762         66 PCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFT  103 (126)
Q Consensus        66 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~  103 (126)
                      .|+.|+......        ...+...|-|+.|.+.+.
T Consensus       237 pC~~Cg~~I~~~--------~~~gR~ty~Cp~CQ~~~~  266 (269)
T PRK14811        237 PCPRCGTPIEKI--------VVGGRGTHFCPQCQPLRP  266 (269)
T ss_pred             CCCcCCCeeEEE--------EECCCCcEECCCCcCCCC
Confidence            688887543221        223566788999977654


No 308
>PF03145 Sina:  Seven in absentia protein family;  InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non-neuronal cell type. The Sina protein contains an N-terminal RING finger domain C3HC4-type. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologues of Sina have also been identified. The human homologue Siah-1 [] also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation [, ]. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is a C3HC4-type, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologues, whose similarity was noted previously, this family also includes putative homologues from Caenorhabditis elegans, Arabidopsis thaliana.; GO: 0006511 ubiquitin-dependent protein catabolic process, 0007275 multicellular organismal development, 0005634 nucleus; PDB: 2A25_A 1K2F_B 2AN6_C.
Probab=23.96  E-value=56  Score=19.81  Aligned_cols=8  Identities=38%  Similarity=0.858  Sum_probs=3.5

Q ss_pred             hHHHHHHh
Q psy10762         79 HLVNHVRR   86 (126)
Q Consensus        79 ~l~~h~~~   86 (126)
                      .|..|...
T Consensus        62 ~l~~Hl~~   69 (198)
T PF03145_consen   62 ELLDHLRD   69 (198)
T ss_dssp             CHHHHHHH
T ss_pred             HHHHHHHH
Confidence            34444443


No 309
>KOG1088|consensus
Probab=23.83  E-value=39  Score=18.89  Aligned_cols=20  Identities=15%  Similarity=0.174  Sum_probs=14.7

Q ss_pred             hhcCCCCcccCCCCCcCCCh
Q psy10762         58 QHTGETPFPCQYCPKAFTRK   77 (126)
Q Consensus        58 ~~~~~~~~~C~~C~~~~~~~   77 (126)
                      ++..+....|+.||+.|.-+
T Consensus        92 ~~v~EG~l~CpetG~vfpI~  111 (124)
T KOG1088|consen   92 IDVIEGELVCPETGRVFPIS  111 (124)
T ss_pred             hhhccceEecCCCCcEeecc
Confidence            45556677899999988654


No 310
>KOG4118|consensus
Probab=23.78  E-value=54  Score=16.18  Aligned_cols=28  Identities=18%  Similarity=0.437  Sum_probs=18.3

Q ss_pred             cccCCcccccCCchHHHHHHhhhcCCCC
Q psy10762         37 HHCNYCAKSFTRKDHMVYHERQHTGETP   64 (126)
Q Consensus        37 ~~c~~C~~~~~~~~~l~~h~~~~~~~~~   64 (126)
                      +.|..|....+..-.+..|..+.+...+
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~kHpk~~   66 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENKHPKEP   66 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhcCCCCC
Confidence            5677777777777777777665554433


No 311
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=23.45  E-value=19  Score=23.34  Aligned_cols=76  Identities=20%  Similarity=0.385  Sum_probs=28.2

Q ss_pred             eeccccccccCChhHHHHHHHhhcCCCCcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcCCChhhHHHHHHhhc
Q psy10762          9 HRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHVRRHT   88 (126)
Q Consensus         9 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~~~   88 (126)
                      -.|++||..-.- +.+..--.  .+.+-+.|+.|+..+...              ...|+.||..-...-.... .....
T Consensus       173 g~CPvCGs~P~~-s~l~~~~~--~G~R~L~Cs~C~t~W~~~--------------R~~Cp~Cg~~~~~~l~~~~-~e~~~  234 (290)
T PF04216_consen  173 GYCPVCGSPPVL-SVLRGGER--EGKRYLHCSLCGTEWRFV--------------RIKCPYCGNTDHEKLEYFT-VEGEP  234 (290)
T ss_dssp             SS-TTT---EEE-EEEE--------EEEEEETTT--EEE----------------TTS-TTT---SS-EEE---------
T ss_pred             CcCCCCCCcCce-EEEecCCC--CccEEEEcCCCCCeeeec--------------CCCCcCCCCCCCcceeeEe-cCCCC
Confidence            469999874222 21111111  244567788888655332              2378888854333222110 12223


Q ss_pred             CCCCccCccccccc
Q psy10762         89 GESPHKCTYCMKSF  102 (126)
Q Consensus        89 ~~~~~~C~~C~~~f  102 (126)
                      +.+.+.|..|+.-+
T Consensus       235 ~~rve~C~~C~~Yl  248 (290)
T PF04216_consen  235 AYRVEVCESCGSYL  248 (290)
T ss_dssp             SEEEEEETTTTEEE
T ss_pred             cEEEEECCcccchH
Confidence            44567888887543


No 312
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=23.13  E-value=34  Score=19.93  Aligned_cols=15  Identities=27%  Similarity=0.565  Sum_probs=11.5

Q ss_pred             CCccCcccccccCCH
Q psy10762         91 SPHKCTYCMKSFTRK  105 (126)
Q Consensus        91 ~~~~C~~C~~~f~~~  105 (126)
                      +.-.|..|++.|...
T Consensus        27 RRReC~~C~~RFTTy   41 (147)
T TIGR00244        27 RRRECLECHERFTTF   41 (147)
T ss_pred             ecccCCccCCcccee
Confidence            335799999999865


No 313
>PF04988 AKAP95:  A-kinase anchoring protein 95 (AKAP95);  InterPro: IPR007071 A-kinase (or PKA)-anchoring protein AKAP95 is implicated in mitotic chromosome condensation by acting as a targeting molecule for the condensin complex. The protein contains two zinc fingers which are thought to mediate the binding of AKAP95 to DNA [].; GO: 0003677 DNA binding, 0005634 nucleus
Probab=23.04  E-value=57  Score=19.40  Aligned_cols=21  Identities=14%  Similarity=0.396  Sum_probs=14.3

Q ss_pred             cccCCcccccCCchHHHHHHh
Q psy10762         37 HHCNYCAKSFTRKDHMVYHER   57 (126)
Q Consensus        37 ~~c~~C~~~~~~~~~l~~h~~   57 (126)
                      |.|++|.........+..|+.
T Consensus         1 F~Cs~CKfrtf~~~ei~~Hle   21 (165)
T PF04988_consen    1 FTCSFCKFRTFEEKEIEKHLE   21 (165)
T ss_pred             CccceeeeecccHHHHHHHHc
Confidence            457777776666677777754


No 314
>PRK07591 threonine synthase; Validated
Probab=22.90  E-value=59  Score=22.49  Aligned_cols=25  Identities=16%  Similarity=0.479  Sum_probs=15.8

Q ss_pred             cccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcC
Q psy10762         37 HHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAF   74 (126)
Q Consensus        37 ~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~   74 (126)
                      +.|..||..|...            . .|.|+.|+..+
T Consensus        19 l~C~~Cg~~~~~~------------~-~~~C~~cg~~l   43 (421)
T PRK07591         19 LKCRECGAEYPLG------------P-IHVCEECFGPL   43 (421)
T ss_pred             EEeCCCCCcCCCC------------C-CccCCCCCCeE
Confidence            6788888766422            1 26788887544


No 315
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=22.63  E-value=1e+02  Score=18.59  Aligned_cols=21  Identities=14%  Similarity=0.523  Sum_probs=15.0

Q ss_pred             CCccCcccccccCCHHHHHHH
Q psy10762         91 SPHKCTYCMKSFTRKEHLTNH  111 (126)
Q Consensus        91 ~~~~C~~C~~~f~~~~~l~~H  111 (126)
                      ....|..||+.|.....+..-
T Consensus       113 ~~~~C~~Cg~~f~~~k~i~~~  133 (181)
T PRK08222        113 HLQRCSRCERPFAPQKTVALA  133 (181)
T ss_pred             ccCcCcccCCccCcHhHHHHH
Confidence            457899999999866554433


No 316
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=22.51  E-value=32  Score=18.40  Aligned_cols=13  Identities=31%  Similarity=0.583  Sum_probs=8.9

Q ss_pred             CCCCccCcccccc
Q psy10762         89 GESPHKCTYCMKS  101 (126)
Q Consensus        89 ~~~~~~C~~C~~~  101 (126)
                      +.+.|+|.+|+..
T Consensus         3 ~lkewkC~VCg~~   15 (103)
T COG4847           3 GLKEWKCYVCGGT   15 (103)
T ss_pred             ccceeeEeeeCCE
Confidence            3466888888754


No 317
>cd00122 MBD MeCP2, MBD1, MBD2, MBD3, MBD4, CLLD8-like, and BAZ2A-like proteins constitute a family of proteins that share the methyl-CpG-binding domain (MBD). The MBD consists of about 70 residues and is defined as the minimal region required for binding to methylated DNA by a methyl-CpG-binding protein which binds specifically to methylated DNA. The MBD can recognize a single symmetrically methylated CpG either as naked DNA or within chromatin.  MeCP2, MBD1 and MBD2 (and likely MBD3) form complexes with histone deacetylase and are involved in histone deacetylase-dependent repression of transcription. MBD4 is an endonuclease that forms a complex with the DNA mismatch-repair protein MLH1. The MBDs present in putative chromatin remodelling subunit, BAZ2A, and putative histone methyltransferase, CLLD8, represent two phylogenetically distinct groups within the MBD protein family.
Probab=22.50  E-value=98  Score=14.80  Aligned_cols=21  Identities=14%  Similarity=0.290  Sum_probs=16.6

Q ss_pred             cccccccCCHHHHHHHHHHhh
Q psy10762         96 TYCMKSFTRKEHLTNHIRQHT  116 (126)
Q Consensus        96 ~~C~~~f~~~~~l~~H~~~h~  116 (126)
                      .-||+.|.+...+.+.+..+.
T Consensus        31 sP~Gk~~Rs~~ev~~yL~~~~   51 (62)
T cd00122          31 SPCGKKLRSKPEVARYLEKTG   51 (62)
T ss_pred             CCCCceecCHHHHHHHHHhCC
Confidence            348899999999988877653


No 318
>PRK11827 hypothetical protein; Provisional
Probab=22.16  E-value=59  Score=15.77  Aligned_cols=11  Identities=18%  Similarity=0.253  Sum_probs=5.7

Q ss_pred             ccCcccccccC
Q psy10762         93 HKCTYCMKSFT  103 (126)
Q Consensus        93 ~~C~~C~~~f~  103 (126)
                      ..|..|+..|.
T Consensus        27 Lic~~~~laYP   37 (60)
T PRK11827         27 LICKLDNLAFP   37 (60)
T ss_pred             EECCccCeecc
Confidence            44555555554


No 319
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=22.07  E-value=90  Score=13.56  Aligned_cols=6  Identities=33%  Similarity=1.132  Sum_probs=1.3

Q ss_pred             ccCccc
Q psy10762         93 HKCTYC   98 (126)
Q Consensus        93 ~~C~~C   98 (126)
                      +.|+.|
T Consensus        37 ~~CP~C   42 (42)
T PF15227_consen   37 FSCPEC   42 (42)
T ss_dssp             ---SSS
T ss_pred             CCCcCC
Confidence            445443


No 320
>PF00649 Copper-fist:  Copper fist DNA binding domain;  InterPro: IPR001083 Some fungal transcription factors contain an N-terminal domain, the copper fist, which seems to be involved in copper-dependent DNA-binding [, ]. These proteins activate the transcription of the metallothionein gene in response to copper. Metallothionein maintains copper levels in yeast [, ]. The copper fist domain, which is similar in structure to metallothionein itself, undergoes a large conformational change on copper-binding that allows DNA-binding. The domain contains a conserved array of zinc-binding residues (Cys-X2-Cys-X8-Cys-X-His) and forms a three-stranded antiparallel beta-sheet with two short helical segments that project from one end of the beta-sheet []. Conserved residues form a basic patch that may be important for DNA binding. ; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0005507 copper ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1CO4_A.
Probab=22.04  E-value=27  Score=15.37  Aligned_cols=17  Identities=12%  Similarity=0.346  Sum_probs=11.2

Q ss_pred             CCCCcceeccccccccC
Q psy10762          3 HTGETPHRCDYCAKTFT   19 (126)
Q Consensus         3 ~~~~~~~~C~~C~~~f~   19 (126)
                      -.++..|.|..|-+.-.
T Consensus         3 li~g~KyAC~~CirGHR   19 (40)
T PF00649_consen    3 LIDGEKYACESCIRGHR   19 (40)
T ss_dssp             EETTEEEEETTTTTTSG
T ss_pred             eECCeEEEhhhhhCccc
Confidence            34566788888876543


No 321
>PRK06450 threonine synthase; Validated
Probab=21.99  E-value=64  Score=21.60  Aligned_cols=10  Identities=30%  Similarity=0.594  Sum_probs=6.3

Q ss_pred             cccCCccccc
Q psy10762         37 HHCNYCAKSF   46 (126)
Q Consensus        37 ~~c~~C~~~~   46 (126)
                      +.|..||..+
T Consensus         4 ~~C~~Cg~~~   13 (338)
T PRK06450          4 EVCMKCGKER   13 (338)
T ss_pred             eEECCcCCcC
Confidence            5677777554


No 322
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=21.93  E-value=50  Score=12.63  Aligned_cols=7  Identities=29%  Similarity=0.743  Sum_probs=3.8

Q ss_pred             ccCCCCC
Q psy10762         66 PCQYCPK   72 (126)
Q Consensus        66 ~C~~C~~   72 (126)
                      .|+.|+.
T Consensus         4 ~Cp~Cg~   10 (26)
T PF13248_consen    4 FCPNCGA   10 (26)
T ss_pred             CCcccCC
Confidence            4555554


No 323
>COG2879 Uncharacterized small protein [Function unknown]
Probab=21.87  E-value=1.2e+02  Score=14.91  Aligned_cols=19  Identities=26%  Similarity=0.413  Sum_probs=14.8

Q ss_pred             cCCchHHHHHHhhhcCCCC
Q psy10762         46 FTRKDHMVYHERQHTGETP   64 (126)
Q Consensus        46 ~~~~~~l~~h~~~~~~~~~   64 (126)
                      .++.+.+..|++.++..+|
T Consensus        22 vpdYdnYVehmr~~hPd~p   40 (65)
T COG2879          22 VPDYDNYVEHMRKKHPDKP   40 (65)
T ss_pred             CCcHHHHHHHHHHhCcCCC
Confidence            5677788888888887776


No 324
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=21.74  E-value=60  Score=15.35  Aligned_cols=21  Identities=24%  Similarity=0.597  Sum_probs=12.6

Q ss_pred             CCCccCcccccccCCHHHHHH
Q psy10762         90 ESPHKCTYCMKSFTRKEHLTN  110 (126)
Q Consensus        90 ~~~~~C~~C~~~f~~~~~l~~  110 (126)
                      ..-+-|-.||-.|.+...|.+
T Consensus        25 ~~~~YC~~Cg~~Y~d~~dL~~   45 (55)
T PF13821_consen   25 EEHNYCFWCGTKYDDEEDLER   45 (55)
T ss_pred             hhCceeeeeCCccCCHHHHHh
Confidence            334456667777766666544


No 325
>smart00586 ZnF_DBF Zinc finger in DBF-like proteins.
Probab=21.67  E-value=63  Score=14.96  Aligned_cols=21  Identities=24%  Similarity=0.705  Sum_probs=13.9

Q ss_pred             CcceeccccccccCChhHHHHHHH
Q psy10762          6 ETPHRCDYCAKTFTRKEHLVNHVR   29 (126)
Q Consensus         6 ~~~~~C~~C~~~f~~~~~l~~h~~   29 (126)
                      .++--|+.|...|.   .+..|+.
T Consensus         3 ~k~GYCE~Cr~kfd---~l~~Hi~   23 (49)
T smart00586        3 KKPGYCENCREKYD---DLETHLL   23 (49)
T ss_pred             CCCcccccHhHHHh---hHHHHhc
Confidence            45666888888773   4556654


No 326
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=21.65  E-value=43  Score=15.99  Aligned_cols=6  Identities=33%  Similarity=1.325  Sum_probs=2.4

Q ss_pred             cccCCC
Q psy10762         65 FPCQYC   70 (126)
Q Consensus        65 ~~C~~C   70 (126)
                      |.|+.|
T Consensus        32 YmC~eC   37 (56)
T PF09963_consen   32 YMCDEC   37 (56)
T ss_pred             eeChhH
Confidence            334333


No 327
>KOG3352|consensus
Probab=21.51  E-value=44  Score=19.57  Aligned_cols=15  Identities=20%  Similarity=0.532  Sum_probs=11.5

Q ss_pred             CCCccCcccccccCC
Q psy10762         90 ESPHKCTYCMKSFTR  104 (126)
Q Consensus        90 ~~~~~C~~C~~~f~~  104 (126)
                      .+..+|++||..|.-
T Consensus       131 ge~~rc~eCG~~fkL  145 (153)
T KOG3352|consen  131 GETQRCPECGHYFKL  145 (153)
T ss_pred             CCcccCCcccceEEe
Confidence            456779999988863


No 328
>PF10164 DUF2367:  Uncharacterized conserved protein (DUF2367);  InterPro: IPR019317  This is a highly conserved set of proteins which contains three pairs of cysteine residues within a length of 42 amino acids and is rich in proline residues towards the N terminus. It includes a membrane protein that has been found to be highly expressed in the mouse brain and consequently, several members have been assigned as brain protein i3 (Bri3). Their function is unknown.
Probab=20.98  E-value=50  Score=17.77  Aligned_cols=13  Identities=23%  Similarity=0.726  Sum_probs=9.2

Q ss_pred             CCCccCccccccc
Q psy10762         90 ESPHKCTYCMKSF  102 (126)
Q Consensus        90 ~~~~~C~~C~~~f  102 (126)
                      .+..+|..||..|
T Consensus        86 ~r~~rC~nCG~~f   98 (98)
T PF10164_consen   86 MRERRCSNCGATF   98 (98)
T ss_pred             cCccccCCCCccC
Confidence            4666788887765


No 329
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=20.78  E-value=67  Score=19.04  Aligned_cols=9  Identities=33%  Similarity=1.161  Sum_probs=4.1

Q ss_pred             ccCCccccc
Q psy10762         38 HCNYCAKSF   46 (126)
Q Consensus        38 ~c~~C~~~~   46 (126)
                      .|..|+..+
T Consensus       107 ~C~~C~~~~  115 (178)
T PF02146_consen  107 RCSKCGKEY  115 (178)
T ss_dssp             EETTTSBEE
T ss_pred             eecCCCccc
Confidence            444444443


No 330
>PF11494 Ta0938:  Ta0938;  InterPro: IPR021585  Ta0938 is a protein of unknown function however the structure has been determined. The protein has a novel fold and a putative Zn-binding motif. The structure has two different parts, one region contains a beta sheet flanked by two alpha helices and the other contains a bundle of loops which contain all cysteines in the protein. ; PDB: 2FQH_A.
Probab=20.69  E-value=55  Score=17.60  Aligned_cols=11  Identities=27%  Similarity=0.791  Sum_probs=2.6

Q ss_pred             ceecccccccc
Q psy10762          8 PHRCDYCAKTF   18 (126)
Q Consensus         8 ~~~C~~C~~~f   18 (126)
                      .-.|..||.+.
T Consensus        14 e~~CalCG~tW   24 (105)
T PF11494_consen   14 EMGCALCGATW   24 (105)
T ss_dssp             GGS-SS---S-
T ss_pred             cccccccCCcH
Confidence            33444444443


No 331
>PHA02942 putative transposase; Provisional
Probab=20.57  E-value=83  Score=21.58  Aligned_cols=14  Identities=14%  Similarity=0.247  Sum_probs=9.3

Q ss_pred             CCCccCcccccccC
Q psy10762         90 ESPHKCTYCMKSFT  103 (126)
Q Consensus        90 ~~~~~C~~C~~~f~  103 (126)
                      .+.|.|+.||....
T Consensus       340 ~r~f~C~~CG~~~d  353 (383)
T PHA02942        340 HRYFHCPSCGYEND  353 (383)
T ss_pred             CCEEECCCCCCEeC
Confidence            35677877777654


No 332
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=20.28  E-value=38  Score=16.23  Aligned_cols=12  Identities=33%  Similarity=0.614  Sum_probs=5.2

Q ss_pred             ccCcccccccCC
Q psy10762         93 HKCTYCMKSFTR  104 (126)
Q Consensus        93 ~~C~~C~~~f~~  104 (126)
                      ..|++|++.+..
T Consensus         3 v~CP~C~k~~~~   14 (57)
T PF03884_consen    3 VKCPICGKPVEW   14 (57)
T ss_dssp             EE-TTT--EEE-
T ss_pred             ccCCCCCCeecc
Confidence            468888876543


No 333
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=20.26  E-value=41  Score=16.44  Aligned_cols=13  Identities=15%  Similarity=0.565  Sum_probs=6.7

Q ss_pred             cceeccccccccC
Q psy10762          7 TPHRCDYCAKTFT   19 (126)
Q Consensus         7 ~~~~C~~C~~~f~   19 (126)
                      ....|+.|+..|+
T Consensus        52 g~L~Cp~c~r~YP   64 (68)
T PF03966_consen   52 GELICPECGREYP   64 (68)
T ss_dssp             TEEEETTTTEEEE
T ss_pred             CEEEcCCCCCEEe
Confidence            3345555655553


No 334
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=20.22  E-value=68  Score=13.83  Aligned_cols=9  Identities=44%  Similarity=0.981  Sum_probs=4.4

Q ss_pred             ccCCccccc
Q psy10762         38 HCNYCAKSF   46 (126)
Q Consensus        38 ~c~~C~~~~   46 (126)
                      .|..|+..+
T Consensus        13 ~C~~C~~~i   21 (49)
T smart00109       13 KCCVCRKSI   21 (49)
T ss_pred             Ccccccccc
Confidence            455555443


Done!