Diaphorina citri psyllid: psy10763


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MYALQKSQRAYRFVQGKDWGFKKFIRRDFLLDELNGLLPEDKLTIFCEQNPLILVVKTEISFECFVTCVGSWNGKMPHQLKLVFQENKFM
cccHHccccEEEEEccccccccHHEEccccccccccccccccEEEEEEEEEEEEEccccccccccEEEcccccccccHHHHHHHHHcccc
*********AYRFVQGKDWGFKKFIRRDFLLDELNGLLPEDKLTIFCEQNPLILVVKTEISFECFVTCVGSWNGKMPHQLKLVFQENKFM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYALQKSQRAYRFVQGKDWGFKKFIRRDFLLDELNGLLPEDKLTIFCEQNPLILVVKTEISFECFVTCVGSWNGKMPHQLKLVFQENKFM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Speckle-type POZ protein In complex with CUL3, involved in ubiquitination and proteasomal degradation of several substrates.very confidentQ7T330
Protein roadkill Involved in segment polarity. In complex with gft/CUL3, promotes ubiquitination of ci and its subsequent degradation by the proteasome, which results in hh signaling attenuation. This regulation may be important during eye formation for proper packing of ommatidia into an hexagonal array.very confidentQ9VFP2
Speckle-type POZ protein Inhibits IPF1/PDX1 transactivation of established target promoters, such as insulin, may be by recruiting a repressor complex. In complex with CUL3, involved in ubiquitination of BMI1, DAXX and H2AFY, and probably also in ubiquitination and proteasomal degradation of Gli2 or Gli3.very confidentQ0VCW1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031463 [CC]Cul3-RING ubiquitin ligase complexconfidentGO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0016607 [CC]nuclear speckconfidentGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0043161 [BP]proteasomal ubiquitin-dependent protein catabolic processconfidentGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0031625 [MF]ubiquitin protein ligase bindingconfidentGO:0003674, GO:0044389, GO:0005515, GO:0019899, GO:0005488
GO:0042787 [BP]protein ubiquitination involved in ubiquitin-dependent protein catabolic processconfidentGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0070647, GO:0032446, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0044237, GO:0043170, GO:0016567, GO:0006511
GO:0001085 [MF]RNA polymerase II transcription factor bindingprobableGO:0008134, GO:0003674, GO:0005488, GO:0005515
GO:0031397 [BP]negative regulation of protein ubiquitinationprobableGO:0032269, GO:0032268, GO:0010605, GO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0031400, GO:0031324, GO:0031323, GO:0051248, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0031399, GO:0031396, GO:0009892, GO:0050789, GO:0048523

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IVV, chain A
Confidence level:very confident
Coverage over the Query: 8-53
View the alignment between query and template
View the model in PyMOL
Template: 3HQI, chain A
Confidence level:very confident
Coverage over the Query: 8-89
View the alignment between query and template
View the model in PyMOL