BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy10788
         (229 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1TTU|A Chain A, Crystal Structure Of Csl Bound To Dna
 pdb|2FO1|A Chain A, Crystal Structure Of The Csl-Notch-Mastermind Ternary
           Complex Bound To Dna
 pdb|3BRD|A Chain A, Csl (Lag-1) Bound To Dna With Lin-12 Ram Peptide, P212121
          Length = 477

 Score = 26.9 bits (58), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 8/71 (11%)

Query: 148 SLKLNSHTIHFFYNELRGTELTQSILAPATDSASDKPSYNSSLVDKLIDIVTLSCQPGCR 207
           S K  + TIH F +E RG + T +       +  D   Y  S+V KL+D VT    P  R
Sbjct: 233 STKWGAFTIHLFDDE-RGLQETDNF------AVRDGFVYYGSVV-KLVDSVTGIALPRLR 284

Query: 208 VRLVTLEVTIL 218
           +R V  +  IL
Sbjct: 285 IRKVDKQQVIL 295


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.136    0.395 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,980,747
Number of Sequences: 62578
Number of extensions: 212020
Number of successful extensions: 512
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 510
Number of HSP's gapped (non-prelim): 5
length of query: 229
length of database: 14,973,337
effective HSP length: 95
effective length of query: 134
effective length of database: 9,028,427
effective search space: 1209809218
effective search space used: 1209809218
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)