Diaphorina citri psyllid: psy1078

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MNPLTNVKNIKKLSEQELSSGSKTSWHDQYKDSAWIFVGGLPYDLSEGDVICIFSQYGEIVNLNLVRDKITGKSKGFCFICYEDQRSTVLSVDNLNGVKVLSRTIRVDHVNDYKPPKDNKYTDEETKKLRTIGCAPGTEFGSILPVKTEDIKQEKDSKPTESKDKKRKHKEKKVKKEKKKKKKRKKSSSSSSSSSSDSD
cccHHHHHHHHHHHHHHHccccccccccccccccEEEEccccccccHHHHHHHHccccccEEEEEEcccccccccccEEEEEccHHHHHHHHHcccccccccEEEEECcccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccc
****TNV*******************HDQYKDSAWIFVGGLPYDLSEGDVICIFSQYGEIVNLNLVRDKITGKSKGFCFICYEDQRSTVLSVDNLNGVKVLSRTIRVDHVNDY*******************GCAPG**************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPLTNVKNIKKLSEQELSSGSKTSWHDQYKDSAWIFVGGLPYDLSEGDVICIFSQYGEIVNLNLVRDKITGKSKGFCFICYEDQRSTVLSVDNLNGVKVLSRTIRVDHVNDYKPPKDNKYTDEETKKLRTIGCAPGTEFGSILPVKTEDIKQEKDSKPTESKDKxxxxxxxxxxxxxxxxxxxxxSSSSSSSSSSDSD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RNA-binding motif protein, X-linked 2 confidentQ9Y388
U2 snRNP component ist3 Required for pre-mRNA splicing and spliceosome assembly.confidentO94290
RNA-binding motif protein, X-linked 2 confidentQ8R0F5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0016604 [CC]nuclear bodyprobableGO:0044446, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0045087 [BP]innate immune responseprobableGO:0002376, GO:0050896, GO:0006952, GO:0006950, GO:0008150, GO:0006955
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005686 [CC]U2 snRNPprobableGO:0005575, GO:0032991, GO:0043231, GO:0030532, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0070274 [CC]RES complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0000398 [BP]mRNA splicing, via spliceosomeprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0044237, GO:0043170, GO:0006396, GO:0006397
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0010468 [BP]regulation of gene expressionprobableGO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0022618 [BP]ribonucleoprotein complex assemblyprobableGO:0071826, GO:0022607, GO:0043933, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0034622, GO:0022613, GO:0071840
GO:0003727 [MF]single-stranded RNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QFJ, chain A
Confidence level:very confident
Coverage over the Query: 2-114
View the alignment between query and template
View the model in PyMOL
Template: 2QFJ, chain A
Confidence level:very confident
Coverage over the Query: 31-143
View the alignment between query and template
View the model in PyMOL