Diaphorina citri psyllid: psy107

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MQPFSTCGSSGPPSFPGVFRFRLWWCGEWVEVLVDDRLPTVNGKLAFLQSVHSDQFWPGLLEKAYAKLHGSYEALKYGTMLDGLADLTGGITESISIRQDPTSSGRLLNKLLDMTRCMETSGTGRLKFSDFKDLMCSLKYWQTAFKNHTKEKTGILRAERLRDALLEVGYQLNTEVLSVLTLRYMRKDGTLRFGDFVSSVLHLSIAFNI
ccccccccccccccccCEEEEEEEEccEEEEEEcccccccccccEEEEEcccccccccHHHHHHHHHccccHHHHHcccHHHHHHHHccccccccccccccccHHHHHHHHHHccccccccccccccHHHHHHHHHcHHHHHHEEEcEEEccccEEEHHEEcccHHcccccccHHHHHHHcccccccccEECHHHHHHHHHHHHHHHcc
*********SGPPSFPGVFRFRLWWCGEWVEVLVDDRLPTVNGKLAFLQSVHSDQFWPGLLEKAYAKLHGSYEALKYGTMLDGLADLTGGITESISIRQDPTSSGRLLNKLLDMTRCMETSGTGRLKFSDFKDLMCSLKYWQTAFKNHTKEKTGILRAERLRDALLEVGYQLNTEVLSVLTLRYMRKDGTLRFGDFVSSVLHLSIAFNI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQPFSTCGSSGPPSFPGVFRFRLWWCGEWVEVLVDDRLPTVNGKLAFLQSVHSDQFWPGLLEKAYAKLHGSYEALKYGTMLDGLADLTGGITESISIRQDPTSSGRLLNKLLDMTRCMETSGTGRLKFSDFKDLMCSLKYWQTAFKNHTKEKTGILRAERLRDALLEVGYQLNTEVLSVLTLRYMRKDGTLRFGDFVSSVLHLSIAFNI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calpain-C Not known; does not seem to have protease activity.confidentQ9VXH6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004197 [MF]cysteine-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008234
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0016020 [CC]membraneprobableGO:0005575
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0005856 [CC]cytoskeletonprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0032502 [BP]developmental processprobableGO:0008150
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0008092 [MF]cytoskeletal protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0060255 [BP]regulation of macromolecule metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0031323 [BP]regulation of cellular metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QXP, chain A
Confidence level:very confident
Coverage over the Query: 1-203
View the alignment between query and template
View the model in PyMOL