Diaphorina citri psyllid: psy10806


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MITMVELVLYVCSQVLGCLIGVGLVNIITPEEILFPVSSAGLSNGFCTTVPHASLTTVQAFLAEFFSTSLLVFTCCGVWDSRNAKFGDSVAIKFALVIALCSITVGPYTGASMNPARSLAPAIYSNVWTAHWIYWVAPILGSIVSTLLYKYVFSKDHDGKNRPEQLSPADVESSVPIN
cccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHcccccccEEEEHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccc
MITMVELVLYVCSQVLGCLIGVGLVNIITPEEILFPVSSAGLSNGFCTTVPHASLTTVQAFLAEFFSTSLLVFTCCGVWDSRNAKFGDSVAIKFALVIALCSITVGPYTGASMNPARSLAPAIYSNVWTAHWIYWVAPILGSIVSTLLYKYVFS************************
xxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MITMVELVLYVCSQVLGCLIGVGLVNIITPEEILFPVSSAGLSNGFCTTVPHASLTTVQAFLAEFFSTSLLVFTCCGVWDSRNAKFGDSVAIKFALVIALCSITVGPYTGASMNPARSLAPAIYSNVWTAHWIYWVAPILGSIVSTLLYKYVFSKDHDGKNRPEQLSPADVESSVPIN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Aquaporin Z Channel that permits osmotically driven movement of water in both directions. It is involved in the osmoregulation and in the maintenance of cell turgor during volume expansion in rapidly growing cells. It mediates rapid entry or exit of water in response to abrupt changes in osmolarity.confidentQ7MIV9
Aquaporin Z Channel that permits osmotically driven movement of water in both directions. It is involved in the osmoregulation and in the maintenance of cell turgor during volume expansion in rapidly growing cells. It mediates rapid entry or exit of water in response to abrupt changes in osmolarity.confidentQ8DB17
Aquaporin Z Channel that permits osmotically driven movement of water in both directions. It is involved in the osmoregulation and in the maintenance of cell turgor during volume expansion in rapidly growing cells. It mediates rapid entry or exit of water in response to abrupt changes in osmolarity.confidentQ88F17

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0015793 [BP]glycerol transportprobableGO:0015850, GO:0006810, GO:0008643, GO:0044765, GO:0008150, GO:0015791, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0006833 [BP]water transportprobableGO:0042044, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0043674 [CC]columellaprobableGO:0043667, GO:0043668, GO:0031012, GO:0005575, GO:0043673, GO:0044420
GO:0015250 [MF]water channel activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0022857, GO:0015267, GO:0003674, GO:0022803, GO:0022838, GO:0005372
GO:0097305 [BP]response to alcoholprobableGO:1901700, GO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0015670 [BP]carbon dioxide transportprobableGO:0019755, GO:0006810, GO:0015669, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0008324 [MF]cation transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0015075, GO:0022857, GO:0003674
GO:0016323 [CC]basolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0033993 [BP]response to lipidprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0030104 [BP]water homeostasisprobableGO:0042592, GO:0008150, GO:0065008, GO:0065007, GO:0048878
GO:0046715 [MF]borate transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674, GO:0015103
GO:0009705 [CC]plant-type vacuole membraneprobableGO:0005737, GO:0005575, GO:0000325, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005774, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0070887 [BP]cellular response to chemical stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0042221, GO:0044699
GO:0005216 [MF]ion channel activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022803, GO:0022838
GO:0015168 [MF]glycerol transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:1901476, GO:0005215, GO:0022857, GO:0015144, GO:1901618, GO:0003674, GO:0015166, GO:0015665
GO:0080170 [BP]hydrogen peroxide transmembrane transportprobableGO:0006810, GO:0009987, GO:0051179, GO:0044765, GO:0044763, GO:0008150, GO:0051234, GO:0055085, GO:0044699
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0097458 [CC]neuron partprobableGO:0005575, GO:0044464, GO:0005623
GO:0031967 [CC]organelle envelopeprobableGO:0005575, GO:0044464, GO:0005623, GO:0031975, GO:0044446, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0015700 [BP]arsenite transportprobableGO:0006811, GO:0006810, GO:0006820, GO:0044765, GO:0008150, GO:0015698, GO:0051234, GO:0051179, GO:0044699
GO:0031224 [CC]intrinsic to membraneprobableGO:0005575, GO:0044425, GO:0016020
GO:0031410 [CC]cytoplasmic vesicleprobableGO:0005737, GO:0031982, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043226
GO:0042807 [CC]central vacuoleprobableGO:0005737, GO:0000325, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009725 [BP]response to hormone stimulusprobableGO:0009719, GO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0015105 [MF]arsenite transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674, GO:0015103

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1LDF, chain A
Confidence level:very confident
Coverage over the Query: 1-157
View the alignment between query and template
View the model in PyMOL