BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy10835
         (80 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3SWN|B Chain B, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|E Chain E, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|Q Chain Q, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|T Chain T, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
          Length = 77

 Score =  102 bits (254), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 60/74 (81%)

Query: 1  MSRKESLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYG 60
          M    S ++F+ ++ G+ V+++L SGVDY+G+LSCLDGYMN+ALE+TEEY+NG+  N YG
Sbjct: 1  MGMDSSPNEFLNKVIGKKVLIRLSSGVDYKGILSCLDGYMNLALERTEEYVNGKKTNVYG 60

Query: 61 DTFIRGNNVLYIST 74
          D FIRGNNVLY+S 
Sbjct: 61 DAFIRGNNVLYVSA 74


>pdb|4EMK|B Chain B, Crystal Structure Of Splsm567
          Length = 75

 Score = 98.2 bits (243), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 42/69 (60%), Positives = 58/69 (84%)

Query: 6  SLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIR 65
          S ++F+ ++ G+ V+++L SGVDY+G+LSCLDGY N+ALE+TEEY+NG+  N YGD FIR
Sbjct: 4  SPNEFLNKVIGKKVLIRLSSGVDYKGILSCLDGYXNLALERTEEYVNGKKTNVYGDAFIR 63

Query: 66 GNNVLYIST 74
          GNNVLY+S 
Sbjct: 64 GNNVLYVSA 72


>pdb|3CW1|F Chain F, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|Z Chain Z, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|1 Chain 1, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|2 Chain 2, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3PGW|F Chain F, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|I Chain I, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|F Chain F, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|M Chain M, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|T Chain T, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|F Chain F, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|M Chain M, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|T Chain T, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|F Chain F, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|M Chain M, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|T Chain T, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|F Chain F, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|M Chain M, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|T Chain T, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|3S6N|F Chain F, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
          Gemin2 In Complex With Smd1D2FEG FROM HUMAN
 pdb|4F7U|F Chain F, Macromolecular Machine 6
 pdb|4F7U|I Chain I, Macromolecular Machine 6
 pdb|1VU2|D Chain D, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|L Chain L, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|T Chain T, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|BB Chain b, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|JJ Chain j, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|RR Chain r, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|ZZ Chain z, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|D Chain D, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|L Chain L, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|T Chain T, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|BB Chain b, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|JJ Chain j, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|RR Chain r, The 8s Snrnp Assembly Intermediate
 pdb|4F77|L Chain L, The 8s Snrnp Assembly Intermediate
 pdb|4F77|D Chain D, The 8s Snrnp Assembly Intermediate
 pdb|4F77|T Chain T, The 8s Snrnp Assembly Intermediate
 pdb|4F77|BB Chain b, The 8s Snrnp Assembly Intermediate
 pdb|4F77|JJ Chain j, The 8s Snrnp Assembly Intermediate
 pdb|4F77|RR Chain r, The 8s Snrnp Assembly Intermediate
 pdb|4F77|ZZ Chain z, The 8s Snrnp Assembly Intermediate
          Length = 86

 Score = 72.8 bits (177), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 47/72 (65%)

Query: 1  MSRKESLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYG 60
          MS   +   F+  + G+PV+VKL  G++Y+G L  +DGYMN+ L  TEEYI+G L    G
Sbjct: 1  MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLG 60

Query: 61 DTFIRGNNVLYI 72
          +  IR NNVLYI
Sbjct: 61 EVLIRCNNVLYI 72


>pdb|1LOJ|A Chain A, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|B Chain B, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|C Chain C, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|D Chain D, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|E Chain E, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|F Chain F, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|G Chain G, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|H Chain H, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|I Chain I, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|J Chain J, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|K Chain K, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|L Chain L, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|M Chain M, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|N Chain N, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
          Length = 87

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 37/59 (62%)

Query: 18 PVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYISTQK 76
          PV++KL    ++RGVL   D +MN+ L   EE  +G++  + G   IRG+N++YIS  K
Sbjct: 25 PVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGK 83


>pdb|1JBM|A Chain A, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|B Chain B, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|C Chain C, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|D Chain D, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|E Chain E, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|F Chain F, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|G Chain G, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
          Length = 86

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 37/59 (62%)

Query: 18 PVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYISTQK 76
          PV++KL    ++RGVL   D +MN+ L   EE  +G++  + G   IRG+N++YIS  K
Sbjct: 25 PVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGK 83


>pdb|1JRI|A Chain A, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|B Chain B, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|C Chain C, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|D Chain D, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|E Chain E, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|F Chain F, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|G Chain G, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|H Chain H, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|I Chain I, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|J Chain J, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|K Chain K, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|L Chain L, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|M Chain M, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|N Chain N, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit
          Length = 85

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 37/59 (62%)

Query: 18 PVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYISTQK 76
          PV++KL    ++RGVL   D +MN+ L   EE  +G++  + G   IRG+N++YIS  K
Sbjct: 25 PVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGK 83


>pdb|1I81|A Chain A, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|B Chain B, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|C Chain C, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|D Chain D, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|E Chain E, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|F Chain F, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|G Chain G, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|A Chain A, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|B Chain B, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|C Chain C, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|D Chain D, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|E Chain E, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|F Chain F, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|G Chain G, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
          Length = 83

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 36/57 (63%)

Query: 18 PVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYIST 74
          PV++KL    ++RGVL   D +MN+ L   EE  +G++  + G   IRG+N++YIS 
Sbjct: 27 PVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISP 83


>pdb|1I5L|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I4K|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|O Chain O, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|P Chain P, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Q Chain Q, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|R Chain R, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|S Chain S, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|T Chain T, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|U Chain U, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|V Chain V, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|W Chain W, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|X Chain X, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Y Chain Y, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Z Chain Z, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|1 Chain 1, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|2 Chain 2, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
          Length = 77

 Score = 50.1 bits (118), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 35/59 (59%)

Query: 18 PVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYISTQK 76
          PV+V+L  G ++RG L   D +MN+ L   EE  NG++  K G   IRG+ V+++S   
Sbjct: 16 PVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74


>pdb|1N9S|A Chain A, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|B Chain B, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|C Chain C, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|D Chain D, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|E Chain E, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|F Chain F, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|G Chain G, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|H Chain H, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|I Chain I, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|J Chain J, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|K Chain K, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|L Chain L, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|M Chain M, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|N Chain N, Crystal Structure Of Yeast Smf In Spacegroup P43212
          Length = 93

 Score = 49.7 bits (117), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 41/82 (50%), Gaps = 11/82 (13%)

Query: 1  MSRKESLSQFIQQIHGRPVVVKLVS----------GVDYRGVLSCLDGYMNIALEQTEEY 50
          MS    +S  +Q ++ +P +  LV+            +YRG L   D Y N+ L + EE+
Sbjct: 8  MSESSDISA-MQPVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEF 66

Query: 51 INGQLKNKYGDTFIRGNNVLYI 72
          + G      G+ FIR NNVLYI
Sbjct: 67 VAGVSHGTLGEIFIRSNNVLYI 88


>pdb|1N9R|A Chain A, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|B Chain B, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|C Chain C, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|D Chain D, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|E Chain E, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|F Chain F, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|G Chain G, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
          Length = 93

 Score = 48.9 bits (115), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 41/82 (50%), Gaps = 11/82 (13%)

Query: 1  MSRKESLSQFIQQIHGRPVVVKLVS----------GVDYRGVLSCLDGYMNIALEQTEEY 50
          MS    +S  +Q ++ +P +  LV+            +YRG L   D Y N+ L + EE+
Sbjct: 8  MSESSDISA-MQPVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEF 66

Query: 51 INGQLKNKYGDTFIRGNNVLYI 72
          + G      G+ FIR NNVLYI
Sbjct: 67 VAGVSHGTLGEIFIRCNNVLYI 88


>pdb|1I8F|A Chain A, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|B Chain B, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|C Chain C, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|D Chain D, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|E Chain E, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|F Chain F, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|G Chain G, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1LNX|A Chain A, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|B Chain B, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|C Chain C, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|D Chain D, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|E Chain E, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|F Chain F, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|G Chain G, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
          Length = 81

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 6  SLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIR 65
          +L   +Q   G+ V+VKL    + RG+L   D ++N+ LE  EE I+G +  K G   +R
Sbjct: 11 TLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVY-KRGTMVVR 69

Query: 66 GNNVLYIS 73
          G NVL+IS
Sbjct: 70 GENVLFIS 77


>pdb|1H64|1 Chain 1, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|2 Chain 2, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|A Chain A, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|B Chain B, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|C Chain C, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|D Chain D, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|E Chain E, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|F Chain F, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|G Chain G, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|H Chain H, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|I Chain I, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|J Chain J, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|K Chain K, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|L Chain L, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|M Chain M, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|N Chain N, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|O Chain O, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|P Chain P, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|Q Chain Q, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|R Chain R, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|S Chain S, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|T Chain T, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|U Chain U, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|V Chain V, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|W Chain W, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|X Chain X, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|Y Chain Y, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|Z Chain Z, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
          Length = 75

 Score = 42.4 bits (98), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%)

Query: 17 RPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYISTQK 76
          + V+V L  G ++RG L   D ++N+ L   E   +G++  +YG   IRG+NVL IS  +
Sbjct: 15 KDVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGEVVKRYGKIVIRGDNVLAISPTE 74


>pdb|1M8V|A Chain A, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|B Chain B, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|C Chain C, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|D Chain D, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|E Chain E, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|F Chain F, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|G Chain G, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|H Chain H, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|I Chain I, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|J Chain J, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|K Chain K, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|L Chain L, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|M Chain M, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|N Chain N, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
          Length = 77

 Score = 42.4 bits (98), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%)

Query: 17 RPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYISTQK 76
          + V+V L  G ++RG L   D ++N+ L   E   +G++  +YG   IRG+NVL IS  +
Sbjct: 17 KDVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGEVVKRYGKIVIRGDNVLAISPTE 76


>pdb|1TH7|A Chain A, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|B Chain B, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|C Chain C, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|D Chain D, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|E Chain E, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|F Chain F, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|G Chain G, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|H Chain H, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|I Chain I, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|J Chain J, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|K Chain K, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|L Chain L, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|M Chain M, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|N Chain N, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
          Length = 81

 Score = 38.9 bits (89), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%)

Query: 19 VVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYIS 73
          V+VKL    + RG+L   D +MN+ L  +EE  +     K G   IRG+NV+ IS
Sbjct: 22 VLVKLKGNKEVRGMLRSYDQHMNLVLSDSEEIQSDGSGKKLGTIVIRGDNVILIS 76


>pdb|4EMH|A Chain A, Crystal Structure Of Splsm4
 pdb|4EMH|B Chain B, Crystal Structure Of Splsm4
 pdb|4EMH|C Chain C, Crystal Structure Of Splsm4
 pdb|4EMH|D Chain D, Crystal Structure Of Splsm4
 pdb|4EMH|E Chain E, Crystal Structure Of Splsm4
 pdb|4EMH|F Chain F, Crystal Structure Of Splsm4
 pdb|4EMH|G Chain G, Crystal Structure Of Splsm4
 pdb|4EMH|H Chain H, Crystal Structure Of Splsm4
 pdb|4EMH|I Chain I, Crystal Structure Of Splsm4
 pdb|4EMH|J Chain J, Crystal Structure Of Splsm4
 pdb|4EMH|K Chain K, Crystal Structure Of Splsm4
 pdb|4EMH|L Chain L, Crystal Structure Of Splsm4
 pdb|4EMH|M Chain M, Crystal Structure Of Splsm4
 pdb|4EMH|N Chain N, Crystal Structure Of Splsm4
 pdb|4EMH|O Chain O, Crystal Structure Of Splsm4
 pdb|4EMH|P Chain P, Crystal Structure Of Splsm4
 pdb|4EMH|Q Chain Q, Crystal Structure Of Splsm4
 pdb|4EMH|R Chain R, Crystal Structure Of Splsm4
 pdb|4EMH|T Chain T, Crystal Structure Of Splsm4
 pdb|4EMH|U Chain U, Crystal Structure Of Splsm4
 pdb|4EMH|V Chain V, Crystal Structure Of Splsm4
 pdb|4EMH|W Chain W, Crystal Structure Of Splsm4
 pdb|4EMH|X Chain X, Crystal Structure Of Splsm4
 pdb|4EMH|Y Chain Y, Crystal Structure Of Splsm4
          Length = 105

 Score = 38.9 bits (89), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 10 FIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIAL-EQTEEYINGQLKNKYGDTFIRGNN 68
           +    GRP++V+L +G  + G L   D Y N+ L E      +G    +  + +IRGNN
Sbjct: 20 LLNATQGRPILVELKNGETFNGHLENCDNYXNLTLREVIRTXPDGDKFFRLPECYIRGNN 79

Query: 69 VLYISTQ 75
          + Y+  Q
Sbjct: 80 IKYLRIQ 86


>pdb|3CW1|G Chain G, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|3 Chain 3, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|4 Chain 4, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|5 Chain 5, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3PGW|G Chain G, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|J Chain J, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|3S6N|G Chain G, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
          Gemin2 In Complex With Smd1D2FEG FROM HUMAN
 pdb|4F7U|G Chain G, Macromolecular Machine 6
 pdb|4F7U|J Chain J, Macromolecular Machine 6
 pdb|1VU2|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|4 Chain 4, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|4F77|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|4F77|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|4F77|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|4F77|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|4F77|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|4F77|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|4F77|4 Chain 4, The 8s Snrnp Assembly Intermediate
          Length = 76

 Score = 34.3 bits (77), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 30/57 (52%)

Query: 21 VKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYISTQKR 77
          +KL  G   +G+L   D +MN+ +++  E      +N  G   IRGN+++ +   +R
Sbjct: 19 LKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALER 75


>pdb|1M5Q|A Chain A, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|B Chain B, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|C Chain C, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|D Chain D, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|E Chain E, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|F Chain F, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|G Chain G, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|H Chain H, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|I Chain I, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|J Chain J, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|K Chain K, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|L Chain L, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|M Chain M, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|N Chain N, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|O Chain O, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|P Chain P, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|Q Chain Q, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|R Chain R, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|S Chain S, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|T Chain T, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|U Chain U, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|V Chain V, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|W Chain W, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|X Chain X, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|Y Chain Y, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|Z Chain Z, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|1 Chain 1, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|2 Chain 2, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
          Length = 130

 Score = 32.3 bits (72), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 4/63 (6%)

Query: 16 GRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYISTQ 75
          GR V V L +G  Y+GVL  +D  +NI L       + +   K+   FI    +++I + 
Sbjct: 10 GREVQVVLSNGEVYKGVLHAVDNQLNIVLANA----SNKAGEKFNRVFIXYRYIVHIDST 65

Query: 76 KRR 78
          +RR
Sbjct: 66 ERR 68


>pdb|1B34|A Chain A, Crystal Structure Of The D1d2 Sub-Complex From The Human
          Snrnp Core Domain
 pdb|3CW1|B Chain B, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|M Chain M, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|N Chain N, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|O Chain O, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3PGW|X Chain X, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|U Chain U, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|3S6N|A Chain A, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
          Gemin2 In Complex With Smd1D2FEG FROM HUMAN
 pdb|4F7U|A Chain A, Macromolecular Machine 6
 pdb|4F7U|C Chain C, Macromolecular Machine 6
 pdb|1VU2|A Chain A, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|I Chain I, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|Q Chain Q, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|Y Chain Y, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|GG Chain g, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|OO Chain o, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|WW Chain w, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|A Chain A, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|I Chain I, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|Q Chain Q, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|Y Chain Y, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|GG Chain g, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|OO Chain o, The 8s Snrnp Assembly Intermediate
 pdb|4F77|I Chain I, The 8s Snrnp Assembly Intermediate
 pdb|4F77|A Chain A, The 8s Snrnp Assembly Intermediate
 pdb|4F77|Q Chain Q, The 8s Snrnp Assembly Intermediate
 pdb|4F77|Y Chain Y, The 8s Snrnp Assembly Intermediate
 pdb|4F77|GG Chain g, The 8s Snrnp Assembly Intermediate
 pdb|4F77|OO Chain o, The 8s Snrnp Assembly Intermediate
 pdb|4F77|WW Chain w, The 8s Snrnp Assembly Intermediate
          Length = 119

 Score = 29.6 bits (65), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 32/65 (49%)

Query: 7  LSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRG 66
          L +F+ ++    V ++L +G    G ++ +D  MN  L+  +  +  +   +     IRG
Sbjct: 3  LVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRG 62

Query: 67 NNVLY 71
          NN+ Y
Sbjct: 63 NNIRY 67


>pdb|1LJO|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm2) From
          Archaeoglobus Fulgidus At 1.95a Resolution
          Length = 77

 Score = 29.3 bits (64), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%)

Query: 31 GVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVLYISTQKR 77
          G L  +D YMN+ L    E    +     G+  +RGNNV+ I  Q+ 
Sbjct: 31 GKLEGVDDYMNLYLTNAMECKGEEKVRSLGEIVLRGNNVVLIQPQEE 77


>pdb|4GMO|A Chain A, Crystal Structure Of Syo1
          Length = 684

 Score = 26.6 bits (57), Expect = 4.0,   Method: Composition-based stats.
 Identities = 10/24 (41%), Positives = 16/24 (66%)

Query: 12  QQIHGRPVVVKLVSGVDYRGVLSC 35
           Q+ H   V++KL +G D R V++C
Sbjct: 227 QETHVYDVLLKLATGTDPRAVMAC 250


>pdb|4GMN|A Chain A, Structural Basis Of Rpl5 Recognition By Syo1
          Length = 676

 Score = 26.6 bits (57), Expect = 4.0,   Method: Composition-based stats.
 Identities = 10/24 (41%), Positives = 16/24 (66%)

Query: 12  QQIHGRPVVVKLVSGVDYRGVLSC 35
           Q+ H   V++KL +G D R V++C
Sbjct: 227 QETHVYDVLLKLATGTDPRAVMAC 250


>pdb|3QE9|Y Chain Y, Crystal Structure Of Human Exonuclease 1 Exo1 (D173a) In
           Complex With Dna (Complex I)
 pdb|3QE9|Z Chain Z, Crystal Structure Of Human Exonuclease 1 Exo1 (D173a) In
           Complex With Dna (Complex I)
          Length = 352

 Score = 25.8 bits (55), Expect = 5.9,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 9/51 (17%)

Query: 20  VVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVL 70
           V++L +  D   V+  +  Y+ + +   E+YING         FIR NN  
Sbjct: 241 VLRLANNPDIVKVIKKIGHYLKMNITVPEDYING---------FIRANNTF 282


>pdb|3SWN|A Chain A, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|D Chain D, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|P Chain P, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|S Chain S, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
          Length = 82

 Score = 25.8 bits (55), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 9  QFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEY--INGQLKNKYGDTFIRG 66
          + I +  G  + V + S  ++ G L   D Y+NI L+   EY  + G +  K+ +  + G
Sbjct: 11 ELIDKCIGSNLWVIMKSEREFAGTLVGFDDYVNIVLKDVTEYDTVTG-VTEKHSEMLLNG 69

Query: 67 NNVLYI 72
          N +  +
Sbjct: 70 NGMCML 75


>pdb|3QEA|Z Chain Z, Crystal Structure Of Human Exonuclease 1 Exo1 (Wt) In
           Complex With Dna (Complex Ii)
 pdb|3QEB|Z Chain Z, Crystal Structure Of Human Exonuclease 1 Exo1 (Wt) In
           Complex With Dna And Mn2+ (Complex Iii)
          Length = 352

 Score = 25.8 bits (55), Expect = 6.1,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 9/51 (17%)

Query: 20  VVKLVSGVDYRGVLSCLDGYMNIALEQTEEYINGQLKNKYGDTFIRGNNVL 70
           V++L +  D   V+  +  Y+ + +   E+YING         FIR NN  
Sbjct: 241 VLRLANNPDIVKVIKKIGHYLKMNITVPEDYING---------FIRANNTF 282


>pdb|2FWK|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6 Snrna-
          Associated Sm-Like Protein Lsm5
 pdb|2FWK|B Chain B, Crystal Structure Of Cryptosporidium Parvum U6 Snrna-
          Associated Sm-Like Protein Lsm5
 pdb|3PGG|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6
          Snrna-Associated Sm- Like Protein Lsm5
 pdb|3PGG|B Chain B, Crystal Structure Of Cryptosporidium Parvum U6
          Snrna-Associated Sm- Like Protein Lsm5
          Length = 121

 Score = 25.8 bits (55), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 21/41 (51%)

Query: 10 FIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEY 50
           I +  G  + V +    ++ GVL   D Y+N+ L+  +EY
Sbjct: 32 LIDKCIGNRIYVVMKGDKEFSGVLRGFDEYVNMVLDDVQEY 72


>pdb|3SWN|C Chain C, Structure Of The Lsm657 Complex: An Assembly Intermediate
           Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|F Chain F, Structure Of The Lsm657 Complex: An Assembly Intermediate
           Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|O Chain O, Structure Of The Lsm657 Complex: An Assembly Intermediate
           Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|R Chain R, Structure Of The Lsm657 Complex: An Assembly Intermediate
           Of The Lsm1 7 And Lsm2 8 Rings
          Length = 117

 Score = 25.0 bits (53), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 34/80 (42%), Gaps = 8/80 (10%)

Query: 2   SRKESLSQFIQQIHGRPVVVKLVSGVDYRGVLSCLDGYMNIALEQTEEYI----NGQLKN 57
            RKES+    +    R +      G    G+L   D  MN+ L+  EE +    +G+L  
Sbjct: 24  PRKESILDLSRYQDQR-IQATFTGGRQITGILKGFDQLMNLVLDDVEEQLRNPEDGKLTG 82

Query: 58  ---KYGDTFIRGNNVLYIST 74
              K G   +RG  ++ I+ 
Sbjct: 83  AIRKLGLVVVRGTTLVLIAP 102


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.138    0.389 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,256,076
Number of Sequences: 62578
Number of extensions: 79202
Number of successful extensions: 216
Number of sequences better than 100.0: 28
Number of HSP's better than 100.0 without gapping: 23
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 191
Number of HSP's gapped (non-prelim): 28
length of query: 80
length of database: 14,973,337
effective HSP length: 49
effective length of query: 31
effective length of database: 11,907,015
effective search space: 369117465
effective search space used: 369117465
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)