Diaphorina citri psyllid: psy1085

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----
MQEESINTVVNPSIHSGMSANYSYMFNFEDKFQHLDTKTWMEKNWTIGFWYCGIYILVIFGGQHLMQNRPRFTLRKALIVWNTLLATFSIIGACRTAPELIHVLKNYGVYHSVCVPSFIEDDKVAGFWTWMFALSKVPELGDTVFIILRKQPLIFLHWYHHITVLLYTWYAYKEYTSSARWFVVMNYCVHSLMYSYFALRAMGKRPPKASAMMVTSLQILQMVIGSLVNIWSLQYINAGQPCKAFTIYCKLNMA
ccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHEEEEEEcccccEEHHHHHHHHHHHHHHHcEEcccccEEEHEEHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEccc
****SIN*VVNPSIHSGMSANYSYMFNFEDKFQHLDTKTWMEKNWTIGFWYCGIYILVIFGGQHLMQNRPRFTLRKALIVWNTLLATFSIIGACRTAPELIHVLKNYGVYHSVCVPSFIEDDKVAGFWTWMFALSKVPELGDTVFIILRKQPLIFLHWYHHITVLLYTWYAYKEYTSSARWFVVMNYCVHSLMYSYFALRAMGKRPPKASAMMVTSLQILQMVIGSLVNIWSLQYINAGQPCKAFTIYCKLNMA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQEESINTVVNPSIHSGMSANYSYMFNFEDKFQHLDTKTWMEKNWTIGFWYCGIYILVIFGGQHLMQNRPRFTLRKALIVWNTLLATFSIIGACRTAPELIHVLKNYGVYHSVCVPSFIEDDKVAGFWTWMFALSKVPELGDTVFIILRKQPLIFLHWYHHITVLLYTWYAYKEYTSSARWFVVMNYCVHSLMYSYFALRAMGKRPPKASAMMVTSLQILQMVIGSLVNIWSLQYINAGQPCKAFTIYCKLNMA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Elongation of very long chain fatty acids protein 6 Condensing enzyme that catalyzes the synthesis of saturated and monounsaturated fatty acids.very confidentQ5ZJR8
Elongation of very long chain fatty acids protein 6 Condensing enzyme that catalyzes the synthesis of unsaturated C16 long chain fatty acids and, to a lesser extent, C18:0 and those with low desaturation degree.confidentQ920L6
Elongation of very long chain fatty acids protein 6 Condensing enzyme that catalyzes the synthesis of saturated and monounsaturated fatty acids. Elongates fatty acids with C12, 14 and 16 carbons.confidentQ920L5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030497 [BP]fatty acid elongationconfidentGO:0006633, GO:0006631, GO:0019752, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0016053, GO:0044237
GO:0042759 [BP]long-chain fatty acid biosynthetic processprobableGO:0006633, GO:0006631, GO:0019752, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0001676, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0016053, GO:0044237, GO:0043436
GO:0030176 [CC]integral to endoplasmic reticulum membraneprobableGO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0031301, GO:0031300, GO:0043227, GO:0031227, GO:0031224, GO:0005737, GO:0044446, GO:0031090, GO:0016021, GO:0016020, GO:0043226, GO:0044432, GO:0012505, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0009922 [MF]fatty acid elongase activityprobableGO:0004312, GO:0003824, GO:0016740, GO:0016746, GO:0016747, GO:0003674
GO:0019367 [BP]fatty acid elongation, saturated fatty acidprobableGO:0006633, GO:0006631, GO:0019752, GO:0016053, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0030497, GO:0044237
GO:0034625 [BP]fatty acid elongation, monounsaturated fatty acidprobableGO:0006633, GO:0006631, GO:0019752, GO:0016053, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0030497, GO:0044237, GO:0019368
GO:0042761 [BP]very long-chain fatty acid biosynthetic processprobableGO:0006633, GO:0006631, GO:0019752, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0000038, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0016053, GO:0044237
GO:0007283 [BP]spermatogenesisprobableGO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0048232, GO:0007276, GO:0000003
GO:0019432 [BP]triglyceride biosynthetic processprobableGO:0071704, GO:0045017, GO:0044710, GO:0044238, GO:0006629, GO:0006641, GO:0009987, GO:0006639, GO:0006638, GO:0044237, GO:0044249, GO:0009058, GO:0008150, GO:0008152, GO:1901576, GO:0046486, GO:0044255, GO:0046463, GO:0046460, GO:0008610
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0034626 [BP]fatty acid elongation, polyunsaturated fatty acidprobableGO:0006633, GO:0006631, GO:0019752, GO:0016053, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0030497, GO:0044237, GO:0019368
GO:0035338 [BP]long-chain fatty-acyl-CoA biosynthetic processprobableGO:1901576, GO:0035383, GO:0051186, GO:0006637, GO:0035384, GO:0071704, GO:0006732, GO:0009987, GO:0051188, GO:0044237, GO:0008150, GO:0044249, GO:0009058, GO:0046949, GO:0071616, GO:0008152, GO:0006793, GO:0009108, GO:0035336, GO:0035337

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted