Diaphorina citri psyllid: psy10869


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160---
MVDTTAEATKRLHVKKQTLDDAYAAPANFLEIDVVNPITHGVAKKRYTDYEVRMKTNLPVFKTKDSNVRRRYSDFEWLRNELERDSKIVVPPLPGKAWKRQMPFRGDDGIFEEEFIEDRRKGLETFINKIAGHPLAQNERCLHMFLQEPTIDKNYVPGKIRNT
cccccccccccccccccccccccccccccEEEEEcccCEECccccccEEEEEEEECccccccccccEEEECcccHHHHHHHHHHcccCEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccc
*****************TLDDAYAAPANFLEIDVVNPITHGVAKKRYTDYEVRMKTNLPVFKTKDSNVRRRYSDFEWLRNELERDSKIVVPPLPGKAWKRQMPFRGDDGIFEEEFIEDRRKGLETFINKIAGHPLAQNERCLHMFLQEPTIDKNYVPG*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDTTAEATKRLHVKKQTLDDAYAAPANFLEIDVVNPITHGVAKKRYTDYEVRMKTNLPVFKTKDSNVRRRYSDFEWLRNELERDSKIVVPPLPGKAWKRQMPFRGDDGIFEEEFIEDRRKGLETFINKIAGHPLAQNERCLHMFLQEPTIDKNYVPGKIRNT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sorting nexin-12 May be involved in several stages of intracellular trafficking.very confidentO70493
Sorting nexin-12 May be involved in several stages of intracellular trafficking.very confidentQ9UMY4
Sorting nexin-3 Required for retention of late Golgi membrane proteins. Component of the retrieval machinery that functions by direct interaction with the cytosolic tails of certain TGN membrane proteins during the sorting/budding process at the prevacuolar compartment. Binds phosphatidylinositol 3-phosphate (PtdIns(P3)).confidentQ6C2S9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005769 [CC]early endosomeconfidentGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0019903 [MF]protein phosphatase bindingconfidentGO:0019902, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0035220 [BP]wing disc developmentconfidentGO:0032502, GO:0032501, GO:0044707, GO:0007444, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0090263 [BP]positive regulation of canonical Wnt receptor signaling pathwayconfidentGO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0030111, GO:0050794, GO:0023056, GO:0030177, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0060828, GO:0048522
GO:0050821 [BP]protein stabilizationconfidentGO:0019222, GO:0060255, GO:0010608, GO:0031647, GO:0050789, GO:0065007, GO:0008150, GO:0065008, GO:0010468
GO:0060070 [BP]canonical Wnt receptor signaling pathwayconfidentGO:0044700, GO:0051716, GO:0009987, GO:0008150, GO:0050896, GO:0016055, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0010008 [CC]endosome membraneconfidentGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005768, GO:0043226, GO:0044422, GO:0043231
GO:0032266 [MF]phosphatidylinositol-3-phosphate bindingconfidentGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:1901981
GO:0061357 [BP]positive regulation of Wnt protein secretionconfidentGO:0032880, GO:0070201, GO:0051223, GO:0050708, GO:0060341, GO:0051046, GO:0050714, GO:0051049, GO:0051050, GO:0051047, GO:0050794, GO:0061356, GO:0065007, GO:0032879, GO:0023051, GO:0048518, GO:0008150, GO:0051222, GO:0010646, GO:0050789, GO:0048522
GO:0061359 [BP]regulation of Wnt receptor signaling pathway by Wnt protein secretionconfidentGO:0008104, GO:0048583, GO:0032940, GO:0023052, GO:0023051, GO:0010646, GO:0050789, GO:0044699, GO:0009966, GO:0061355, GO:0065007, GO:0071702, GO:0033036, GO:0006810, GO:0009306, GO:0009987, GO:0023061, GO:0050794, GO:0045184, GO:0044765, GO:0044763, GO:0003001, GO:0051649, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0051641, GO:0044700, GO:0046903, GO:0030111, GO:0015031, GO:0008150
GO:0006911 [BP]phagocytosis, engulfmentconfidentGO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0030904 [CC]retromer complexconfidentGO:0043234, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0012505, GO:0044425
GO:0006886 [BP]intracellular protein transportprobableGO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006810, GO:0045184, GO:0008104, GO:0044763, GO:0044699, GO:0071702, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0051649, GO:0051641
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0034499 [BP]late endosome to Golgi transportprobableGO:0016197, GO:0051234, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0042147, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0097308 [BP]cellular response to farnesolprobableGO:1901700, GO:1901701, GO:0051716, GO:0033993, GO:0050896, GO:0009987, GO:0071396, GO:0008150, GO:0071310, GO:0044763, GO:0044699, GO:0070887, GO:0042221, GO:0097305, GO:0010033, GO:0097307, GO:0097306

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CSK, chain A
Confidence level:very confident
Coverage over the Query: 23-163
View the alignment between query and template
View the model in PyMOL