Diaphorina citri psyllid: psy10876

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MKLRLIKYKFLWILFSFILGCTITLFYISKVDNISANQTGLSKFKNLKHSYFIVILILTSSKNYIRRKNIRDTWIKNIEKYQVKYLFSIGNKENVVDVKLKEEIRRYDDILLLNQVPDEYSSLSQKVLHSFKYIYEHFDFQYLLKCDDDTFVRVPNIIHELENKFHYEKKLYWGFFDGRARVRRAGKWKEKNWFLCDRYLPYALGGGYVLSHLLVKFISENSHMLSSYISEDVSVGVWLSALDITRYHDVRFDTEFQSRGCNNSYLIVHKQNMHQLYNNLMLSNQARLCFHEYKERNSYEYNWKVAPSQCCIRNNSKIP
cccHHHHHHHHHHHHHHHHHHHHHHEEcccccccccccccccccccccccEEEEEEEEcccccHHHHHHHHHHHHcccccccEEEEEEEEccccHHHHHHHHHHHHcccEEEccccccccccHHHHHHHHHHHHHHcccEEEEEEccccEEECHHHHHHHHHccccccccEEEEEEEccccccccccEECccccccccccccccccCEEEcHHHHHHHHHHccccccccccHHHHHHHHHHcccccccccccccccccccccccEEEEccccHHHHHHHHHHccccccccHHccccccCECcccccccccccccccccc
**LRLIKYKFLWILFSFILGCTITLFYISKVDNISANQTGLSKFKNLKHSYFIVILILTSSKNYIRRKNIRDTWIKNIEKYQVKYLFSIGNKENVVDVKLKEEIRRYDDILLLNQVPDEYSSLSQKVLHSFKYIYEHFDFQYLLKCDDDTFVRVPNIIHELENKFHYEKKLYWGFFDGRARVRRAGKWKEKNWFLCDRYLPYALGGGYVLSHLLVKFISENSHMLSSYISEDVSVGVWLSALDITRYHDVRFDTEFQSRGCNNSYLIVHKQNMHQLYNNLMLSNQARLCFHEYKERNSYEYNWKVAPSQCCIRN*****
xxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLRLIKYKFLWILFSFILGCTITLFYISKVDNISANQTGLSKFKNLKHSYFIVILILTSSKNYIRRKNIRDTWIKNIEKYQVKYLFSIGNKENVVDVKLKEEIRRYDDILLLNQVPDEYSSLSQKVLHSFKYIYEHFDFQYLLKCDDDTFVRVPNIIHELENKFHYEKKLYWGFFDGRARVRRAGKWKEKNWFLCDRYLPYALGGGYVLSHLLVKFISENSHMLSSYISEDVSVGVWLSALDITRYHDVRFDTEFQSRGCNNSYLIVHKQNMHQLYNNLMLSNQARLCFHEYKERNSYEYNWKVAPSQCCIRNNSKIP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Beta-1,3-galactosyltransferase 6 Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. Has a preference for galactose-beta-1,4-xylose that is found in the linker region of glycosaminoglycans, such as heparan sulfate and chondroitin sulfate. Has no activity towards substrates with terminal glucosamine or galactosamine residues.confidentQ91Z92
Beta-1,3-galactosyltransferase sqv-2 Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. Required for vulval morphogenesis and zygotic cytokinesis, suggesting that glycosaminoglycans play a central role in vulval morphogenesis.confidentQ9N491
Beta-1,3-galactosyltransferase 6 Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. Has a preference for galactose-beta-1,4-xylose that is found in the linker region of glycosaminoglycans, such as heparan sulfate and chondroitin sulfate. Has no activity towards substrates with terminal glucosamine or galactosamine residues.confidentQ96L58

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035250 [MF]UDP-galactosyltransferase activityconfidentGO:0003674, GO:0003824, GO:0016740, GO:0008378, GO:0016757, GO:0016758, GO:0008194
GO:0006024 [BP]glycosaminoglycan biosynthetic processprobableGO:1901576, GO:0044710, GO:0030203, GO:1901564, GO:1901566, GO:1901137, GO:1901135, GO:0043170, GO:0008150, GO:0071704, GO:0009058, GO:0009059, GO:0006807, GO:0008152, GO:0006022, GO:0006023
GO:0008499 [MF]UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activityprobableGO:0003674, GO:0035250, GO:0003824, GO:0016740, GO:0008378, GO:0016757, GO:0016758, GO:0008194, GO:0048531
GO:0047220 [MF]galactosylxylosylprotein 3-beta-galactosyltransferase activityprobableGO:0003674, GO:0035250, GO:0003824, GO:0016740, GO:0008378, GO:0016757, GO:0016758, GO:0008194
GO:0005797 [CC]Golgi medial cisternaprobableGO:0005795, GO:0005794, GO:0031985, GO:0031984, GO:0043231, GO:0043229, GO:0044464, GO:0044444, GO:0005623, GO:0005737, GO:0044446, GO:0044431, GO:0005575, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0006486 [BP]protein glycosylationprobableGO:0044249, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0009059, GO:0044238, GO:0005975, GO:1901137, GO:1901135, GO:0043412, GO:0044237, GO:0043170, GO:0019538, GO:0043413
GO:0040011 [BP]locomotionprobableGO:0008150
GO:0040018 [BP]positive regulation of multicellular organism growthprobableGO:0040014, GO:0051240, GO:0050789, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0040008, GO:0045927
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0040025 [BP]vulval developmentprobableGO:0032502, GO:0009791, GO:0048856, GO:0044707, GO:0048569, GO:0032501, GO:0002119, GO:0044767, GO:0048513, GO:0002164, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0030204 [BP]chondroitin sulfate metabolic processprobableGO:0030203, GO:0006807, GO:0050654, GO:0009100, GO:0044710, GO:0044260, GO:0071704, GO:0009987, GO:0008150, GO:0008152, GO:0043436, GO:0044238, GO:1901564, GO:0006082, GO:0019538, GO:1901135, GO:0044237, GO:0043170, GO:0006029, GO:0006790, GO:0006022, GO:0044281
GO:0000910 [BP]cytokinesisprobableGO:0009987, GO:0008150, GO:0044763, GO:0007049, GO:0051301, GO:0022402, GO:0044699
GO:0018991 [BP]ovipositionprobableGO:0032501, GO:0048609, GO:0032504, GO:0019098, GO:0050896, GO:0044706, GO:0007610, GO:0022414, GO:0008150, GO:0033057, GO:0000003, GO:0051704
GO:0000139 [CC]Golgi membraneprobableGO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0002009 [BP]morphogenesis of an epitheliumprobableGO:0032502, GO:0048856, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0048729, GO:0009653, GO:0044699

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.4.-.-Glycosyltransferases.probable
2.4.1.-Hexosyltransferases.probable
2.4.1.134Galactosylxylosylprotein 3-beta-galactosyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J0A, chain A
Confidence level:confident
Coverage over the Query: 48-178,199-257
View the alignment between query and template
View the model in PyMOL