Query         psy10886
Match_columns 320
No_of_seqs    170 out of 1604
Neff          8.4 
Searched_HMMs 29240
Date          Fri Aug 16 20:58:40 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10886.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/10886hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3cqb_A Probable protease HTPX   16.0      37  0.0013   24.8   0.4   14   82-95     82-95  (107)
  2 3b4r_A Putative zinc metallopr  12.6 1.5E+02  0.0051   24.7   3.4   14   85-98     50-63  (224)
  3 1v54_M VIIIB, IX, cytochrome C   8.7 3.7E+02   0.013   16.5   3.2    8   82-89     29-36  (46)
  4 2dod_A Transcription elongatio   7.3 4.1E+02   0.014   18.3   3.5   24  286-309    31-54  (82)
  5 3c37_A Peptidase, M48 family;    6.9 1.1E+02  0.0039   25.8   0.4   15   82-96     99-113 (253)
  6 2jsd_A Matrix metalloproteinas   5.8 1.6E+02  0.0053   22.8   0.6   16   84-99    109-124 (160)
  7 2og0_A Excisionase; protein-DN   5.4 2.4E+02  0.0083   17.6   1.2   26  295-320    19-51  (52)
  8 1e52_A Excinuclease ABC subuni   5.3 3.6E+02   0.012   17.6   2.1   16  259-274     3-18  (63)
  9 1atl_A Atrolysin C; metalloend   5.1 2.1E+02  0.0071   23.1   1.0   13   85-97    138-150 (202)
 10 2w15_A Zinc metalloproteinase    5.0 1.9E+02  0.0065   23.3   0.6   13   85-97    138-150 (202)

No 1  
>3cqb_A Probable protease HTPX homolog; heat shock protein HTPX domain, PSI-2, protein structure INI structural genomics; HET: MSE; 1.86A {Vibrio parahaemolyticus rimd 2210633}
Probab=15.97  E-value=37  Score=24.83  Aligned_cols=14  Identities=21%  Similarity=0.268  Sum_probs=11.4

Q ss_pred             HHHHHHHhhccccc
Q psy10886         82 HSLMLSIHEMAHNL   95 (320)
Q Consensus        82 ~~~~~l~HE~~H~~   95 (320)
                      ...++++||.+|..
T Consensus        82 El~aVlaHElgH~~   95 (107)
T 3cqb_A           82 EAEAVLAHEVSHIA   95 (107)
T ss_dssp             HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHH
Confidence            45678899999985


No 2  
>3b4r_A Putative zinc metalloprotease MJ0392; intramembrane protease, CBS domain, hydrolase, metal-binding, transmembrane; 3.30A {Methanocaldococcus jannaschii}
Probab=12.59  E-value=1.5e+02  Score=24.70  Aligned_cols=14  Identities=21%  Similarity=0.446  Sum_probs=10.9

Q ss_pred             HHHHhhcccccccC
Q psy10886         85 MLSIHEMAHNLAFG   98 (320)
Q Consensus        85 ~~l~HE~~H~~~f~   98 (320)
                      .++.||.+|.-..+
T Consensus        50 ~v~~HElgH~~~A~   63 (224)
T 3b4r_A           50 SVVLHELGHSYVAK   63 (224)
T ss_dssp             HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHH
Confidence            45689999998763


No 3  
>1v54_M VIIIB, IX, cytochrome C oxidase polypeptide VIII-heart; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: f.23.7.1 PDB: 1oco_M* 1occ_M* 1ocz_M* 1ocr_M* 1v55_M* 2dyr_M* 2dys_M* 2eij_M* 2eik_M* 2eil_M* 2eim_M* 2ein_M* 2occ_M* 2ybb_X* 2zxw_M* 3abk_M* 3abl_M* 3abm_M* 3ag1_M* 3ag2_M* ...
Probab=8.72  E-value=3.7e+02  Score=16.45  Aligned_cols=8  Identities=13%  Similarity=-0.014  Sum_probs=3.3

Q ss_pred             HHHHHHHh
Q psy10886         82 HSLMLSIH   89 (320)
Q Consensus        82 ~~~~~l~H   89 (320)
                      ...|++.|
T Consensus        29 PagWVLsh   36 (46)
T 1v54_M           29 PAGWVLYH   36 (46)
T ss_dssp             HHHHHHHT
T ss_pred             hHHHHHHH
Confidence            34444443


No 4  
>2dod_A Transcription elongation regulator 1; FF domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.159.2.1
Probab=7.32  E-value=4.1e+02  Score=18.26  Aligned_cols=24  Identities=21%  Similarity=0.398  Sum_probs=20.1

Q ss_pred             CCCCcccHHHHHHHhhhCCCCCcc
Q psy10886        286 NLPQHHSWSAVLYDFVMDPDIGPY  309 (320)
Q Consensus       286 ~~~~~~~y~~~~~~~~~~~~~~~~  309 (320)
                      +++-..+|-+++...+.||.+..-
T Consensus        31 ~V~p~~tWe~~~~~i~~DpRY~aL   54 (82)
T 2dod_A           31 GVSAFSTWEKELHKIVFDPRYLLL   54 (82)
T ss_dssp             TCCSSSCHHHHHHHHHTCSGGGTS
T ss_pred             CcCCCCCHHHHHHHHccCCccccC
Confidence            666677999999999999998753


No 5  
>3c37_A Peptidase, M48 family; Q74D82, GSR143A, structural genomics, protein structure initiative, northeast structural genomics consortium; 1.70A {Geobacter sulfurreducens pca}
Probab=6.93  E-value=1.1e+02  Score=25.83  Aligned_cols=15  Identities=27%  Similarity=0.317  Sum_probs=12.1

Q ss_pred             HHHHHHHhhcccccc
Q psy10886         82 HSLMLSIHEMAHNLA   96 (320)
Q Consensus        82 ~~~~~l~HE~~H~~~   96 (320)
                      ...++++||.+|...
T Consensus        99 ELaaVLaHElgH~~~  113 (253)
T 3c37_A           99 ELAGVLAHEINHAVA  113 (253)
T ss_dssp             HHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHC
Confidence            456789999999963


No 6  
>2jsd_A Matrix metalloproteinase-20; MMP-NNGH, structural genomics, structural proteomics in europe, spine, spine-2, spine2-complexes, hydrolase; HET: NGH; NMR {Homo sapiens}
Probab=5.75  E-value=1.6e+02  Score=22.79  Aligned_cols=16  Identities=31%  Similarity=0.706  Sum_probs=11.8

Q ss_pred             HHHHHhhcccccccCC
Q psy10886         84 LMLSIHEMAHNLAFGH   99 (320)
Q Consensus        84 ~~~l~HE~~H~~~f~s   99 (320)
                      ..++.||.+|.-=+..
T Consensus       109 ~~v~~HEiGHaLGL~H  124 (160)
T 2jsd_A          109 FTVAAHEFGHALGLAH  124 (160)
T ss_dssp             HHHHHHHHHHHHTCCC
T ss_pred             HHHHHHHhHhhhcCCC
Confidence            3567899999876653


No 7  
>2og0_A Excisionase; protein-DNA complex, DNA architectural protein, 'winged'HELI protein, phage excision; 1.90A {Enterobacteria phage lambda} SCOP: a.6.1.7 PDB: 1lx8_A 1rh6_A 2ief_A
Probab=5.44  E-value=2.4e+02  Score=17.64  Aligned_cols=26  Identities=15%  Similarity=0.203  Sum_probs=18.6

Q ss_pred             HHHHHhhhCCCC-------CccccccccCCCCC
Q psy10886        295 AVLYDFVMDPDI-------GPYARMKRKHRGLD  320 (320)
Q Consensus       295 ~~~~~~~~~~~~-------~~~~~~~~~~~~~~  320 (320)
                      ++++.++-+..+       |-.+|++++++..|
T Consensus        19 ~Tl~r~ar~G~I~Pp~~KvGr~wrv~~~a~~v~   51 (52)
T 2og0_A           19 ETVRRWVRESRIFPPPVKDGREYLFHESAVKVD   51 (52)
T ss_dssp             HHHHHHHHTTCEESCCEEETTEEEEETTCEECC
T ss_pred             HHHHHHHHCCCCCCcccccCCEEEEcccceeeC
Confidence            567777765544       77889999887654


No 8  
>1e52_A Excinuclease ABC subunit; DNA excision repair, UVRB, DNA repair, UVRC binding domain; NMR {Escherichia coli} SCOP: a.2.9.1 PDB: 1qoj_A
Probab=5.27  E-value=3.6e+02  Score=17.60  Aligned_cols=16  Identities=25%  Similarity=0.312  Sum_probs=8.6

Q ss_pred             cccccCCCCCCCCChH
Q psy10886        259 HNEHHDFPAVPGSRLP  274 (320)
Q Consensus       259 H~eHHlfP~vP~~~Lp  274 (320)
                      |.-||+-|..-+-.++
T Consensus         3 ~~~~~~~~~~~~~~ls   18 (63)
T 1e52_A            3 HHHHHLEPDNVPMDMS   18 (63)
T ss_dssp             -----CCCTTSSCCSC
T ss_pred             cccccCCcccchhhcC
Confidence            6678999988777754


No 9  
>1atl_A Atrolysin C; metalloendopeptidase, hydrolase-hydrolase inhibitor complex; HET: 0QI; 1.80A {Crotalus atrox} SCOP: d.92.1.9 PDB: 1htd_A 1dth_A* 3aig_A* 2aig_P* 4aig_A* 1iag_A
Probab=5.09  E-value=2.1e+02  Score=23.08  Aligned_cols=13  Identities=38%  Similarity=0.690  Sum_probs=9.3

Q ss_pred             HHHHhhccccccc
Q psy10886         85 MLSIHEMAHNLAF   97 (320)
Q Consensus        85 ~~l~HE~~H~~~f   97 (320)
                      .+++||.||.--.
T Consensus       138 ~~~AHElGHnlG~  150 (202)
T 1atl_A          138 VTMAHELGHNLGM  150 (202)
T ss_dssp             HHHHHHHHHHTTC
T ss_pred             EEehhhhccccCc
Confidence            3568999998543


No 10 
>2w15_A Zinc metalloproteinase BAP1; hydrolase inhibitor complex, metal-binding, zinc-depending, metalloprotease, metalloproteinase/inhibitor complex; HET: WR2; 1.05A {Bothrops asper} PDB: 2w12_A* 2w13_A* 2w14_A* 1nd1_A 3gbo_A
Probab=4.97  E-value=1.9e+02  Score=23.31  Aligned_cols=13  Identities=38%  Similarity=0.675  Sum_probs=9.3

Q ss_pred             HHHHhhccccccc
Q psy10886         85 MLSIHEMAHNLAF   97 (320)
Q Consensus        85 ~~l~HE~~H~~~f   97 (320)
                      .+++||.||.--.
T Consensus       138 ~~~AHElGH~lG~  150 (202)
T 2w15_A          138 VTMAHELGHNLGI  150 (202)
T ss_dssp             HHHHHHHHHHTTC
T ss_pred             HHHHHHHhhhcCC
Confidence            3568999998543


Done!