Diaphorina citri psyllid: psy10890

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------50

VDQFTYTSNQTFQLKYLYNDKYWDKKNGPIFFYCGNEGAVEVFTENTGFLWESAKRFKALIVFSEHRYYGDSLPFGNKSFDSVSTRGYLSSEQALEDFVDVIEYIQSSAEGEKDRALEGDYNLGRRYPVIAFGGSYGGMLASWLRMKYPHIVQGALAASAPIWAFPNMAPCNFYSKTVTEVFKNASQNCHDSIKASWKLIDDVTKDNLGKQWLTDNWKLCTPLETTDDVQKFKGWIGDIYSTLAMVNYPYPNSFLRPVPGYPIKKFCAALDSSTQSNVLLKLFEASQVYLNYTQDAQCFKWDSGSSIDELGLTGWYFQTCTEMVMPFCSKDNDMFEPYPWSFDGFRAECEKTFQVSPNPNIAEKLYGGLRIEAASNIIFSNGLLDPWSHAGVLHNISSSVVAVVIPEGAHHLDLRAANKDDPESVIQARKYYERTFRKWINEFEISEQRNREEFKRYKMRGNEDTNDIWRYLQGTRMVKEKLTVPTKEIGKAFSATESH

ccccccccccCEEEEEEEEccccccccccEEEEEcccccccccccccccHHHHHHHcccEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEccccccHHHHHHHHHccccEEEEEEcccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHcEEEEccccccccccccccccccccccccccEEEEcccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHcccccccccEEEEEccccccccccccccccccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccccccEEEEEEccccHHHHcccccccccc

VDQFTYTSNQTFQLKYLYNDKYWDKKNGPIFFYCGNEGAVEVFTENTGFLWESAKRFKALIVFSEHRYYGDSLPFGNKSFDSVSTRGYLSSEQALEDFVDVIEYIQSSAEGEKDRALEGDYNLGRRYPVIAFGGSYGGMLASWLRMKYPHIVQGALAASAPIWAFPNMAPCNFYSKTVTEVFKNASQNCHDSIKASWKLIDDVTKDNLGKQWLTDNWKLCTPLETTDDVQKFKGWIGDIYSTLAMVNYPYPNSFLRPVPGYPIKKFCAALDSSTQSNVLLKLFEASQVYLNYTQDAQCFKWDSGSSIDELGLTGWYFQTCTEMVMPFCSKDNDMFEPYPWSFDGFRAECEKTFQVSPNPNIAEKLYGGLRIEAASNIIFSNGLLDPWSHAGVLHNISSSVVAVVIPEGAHHLDLRAANKDDPESVIQARKYYERTFRKWINEFEIS******************TNDIWRYLQGTRMVKEKLT****************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Lysosomal Pro-X carboxypeptidase	Cleaves C-terminal amino acids linked to proline in peptides such as angiotensin II, III and des-Arg9-bradykinin. This cleavage occurs at acidic pH, but enzymatic activity is retained with some substrates at neutral pH.	confident	Q5RBU7
Lysosomal Pro-X carboxypeptidase	Cleaves C-terminal amino acids linked to proline in peptides such as angiotensin II, III and des-Arg9-bradykinin. This cleavage occurs at acidic pH, but enzymatic activity is retained with some substrates at neutral pH.	confident	Q7TMR0
Prolyl carboxy peptidase like protein 5		confident	P34676

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005575 [CC]	cellular_component	confident
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0008239 [MF]	dipeptidyl-peptidase activity	probable	GO:0016787, GO:0003824, GO:0008238, GO:0070011, GO:0003674, GO:0008233
GO:0006508 [BP]	proteolysis	probable	GO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0007597 [BP]	blood coagulation, intrinsic pathway	probable	GO:0044238, GO:0032501, GO:0007599, GO:0050878, GO:0044707, GO:0072376, GO:0019538, GO:0072378, GO:0050896, GO:0007596, GO:0009611, GO:0042060, GO:0043170, GO:0071704, GO:0006950, GO:0050817, GO:0008150, GO:0008152, GO:0065007, GO:0065008, GO:0044699
GO:0009058 [BP]	biosynthetic process	probable	GO:0008150, GO:0008152
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0031410 [CC]	cytoplasmic vesicle	probable	GO:0005737, GO:0031982, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043226
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0004177 [MF]	aminopeptidase activity	probable	GO:0016787, GO:0003824, GO:0008238, GO:0070011, GO:0003674, GO:0008233
GO:0004185 [MF]	serine-type carboxypeptidase activity	probable	GO:0016787, GO:0017171, GO:0003824, GO:0004180, GO:0008238, GO:0070011, GO:0003674, GO:0070008, GO:0008233, GO:0008236
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005764 [CC]	lysosome	probable	GO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005768 [CC]	endosome	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3N2Z, chain B
Confidence level:very confident
Coverage over the Query: 1-111,124-445
View the alignment between query and template
View the model in PyMOL