BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy10895
         (661 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2FYN|C Chain C, Crystal Structure Analysis Of The Double Mutant
           Rhodobacter Sphaeroides Bc1 Complex
 pdb|2FYN|F Chain F, Crystal Structure Analysis Of The Double Mutant
           Rhodobacter Sphaeroides Bc1 Complex
 pdb|2FYN|I Chain I, Crystal Structure Analysis Of The Double Mutant
           Rhodobacter Sphaeroides Bc1 Complex
 pdb|2FYN|L Chain L, Crystal Structure Analysis Of The Double Mutant
           Rhodobacter Sphaeroides Bc1 Complex
 pdb|2FYN|O Chain O, Crystal Structure Analysis Of The Double Mutant
           Rhodobacter Sphaeroides Bc1 Complex
 pdb|2FYN|R Chain R, Crystal Structure Analysis Of The Double Mutant
           Rhodobacter Sphaeroides Bc1 Complex
 pdb|2QJY|C Chain C, Crystal Structure Of Rhodobacter Sphaeroides Double Mutant
           With Stigmatellin And Uq2
 pdb|2QJY|F Chain F, Crystal Structure Of Rhodobacter Sphaeroides Double Mutant
           With Stigmatellin And Uq2
 pdb|2QJY|I Chain I, Crystal Structure Of Rhodobacter Sphaeroides Double Mutant
           With Stigmatellin And Uq2
 pdb|2QJY|L Chain L, Crystal Structure Of Rhodobacter Sphaeroides Double Mutant
           With Stigmatellin And Uq2
 pdb|2QJY|O Chain O, Crystal Structure Of Rhodobacter Sphaeroides Double Mutant
           With Stigmatellin And Uq2
 pdb|2QJY|R Chain R, Crystal Structure Of Rhodobacter Sphaeroides Double Mutant
           With Stigmatellin And Uq2
          Length = 187

 Score = 30.4 bits (67), Expect = 3.2,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 26/61 (42%), Gaps = 11/61 (18%)

Query: 154 DQVKFWLVRWLLFRLIVTSPINKLSSGDPSWWTLKALGIHFQSMG----------LPTPL 203
           D+   WLV W +   +  SPI  + SGD   W     G H+ S G          LP PL
Sbjct: 117 DEAGEWLVMWGVCTHLGCSPIGGV-SGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPL 175

Query: 204 A 204
           A
Sbjct: 176 A 176


>pdb|2QJK|C Chain C, Crystal Structure Analysis Of Mutant Rhodobacter
           Sphaeroides Bc1 With Stigmatellin And Antimycin
 pdb|2QJK|F Chain F, Crystal Structure Analysis Of Mutant Rhodobacter
           Sphaeroides Bc1 With Stigmatellin And Antimycin
 pdb|2QJK|I Chain I, Crystal Structure Analysis Of Mutant Rhodobacter
           Sphaeroides Bc1 With Stigmatellin And Antimycin
 pdb|2QJK|L Chain L, Crystal Structure Analysis Of Mutant Rhodobacter
           Sphaeroides Bc1 With Stigmatellin And Antimycin
 pdb|2QJK|O Chain O, Crystal Structure Analysis Of Mutant Rhodobacter
           Sphaeroides Bc1 With Stigmatellin And Antimycin
 pdb|2QJK|R Chain R, Crystal Structure Analysis Of Mutant Rhodobacter
           Sphaeroides Bc1 With Stigmatellin And Antimycin
          Length = 179

 Score = 30.4 bits (67), Expect = 3.7,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 26/61 (42%), Gaps = 11/61 (18%)

Query: 154 DQVKFWLVRWLLFRLIVTSPINKLSSGDPSWWTLKALGIHFQSMG----------LPTPL 203
           D+   WLV W +   +  SPI  + SGD   W     G H+ S G          LP PL
Sbjct: 109 DEAGEWLVMWGVCTHLGCSPIGGV-SGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPL 167

Query: 204 A 204
           A
Sbjct: 168 A 168


>pdb|2OWP|A Chain A, Crystal Structure Of A Cystatin-Like Fold Protein
           (Bxe_b1374) From Burkholderia Xenovorans Lb400 At 2.00 A
           Resolution
 pdb|2OWP|B Chain B, Crystal Structure Of A Cystatin-Like Fold Protein
           (Bxe_b1374) From Burkholderia Xenovorans Lb400 At 2.00 A
           Resolution
          Length = 129

 Score = 29.6 bits (65), Expect = 5.2,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 23/44 (52%)

Query: 38  RSQLEGDESLPLSKKLHRKPTLLWLAPFIGLSTEYMMDVISLVG 81
           R+  E  E +P S+KLHR     +   F  +STE+  D   L+G
Sbjct: 58  RAWRERCEPVPKSRKLHRTVVTTFGTDFATVSTEFTSDATPLLG 101


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.139    0.443 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 18,716,225
Number of Sequences: 62578
Number of extensions: 751727
Number of successful extensions: 1501
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 1500
Number of HSP's gapped (non-prelim): 7
length of query: 661
length of database: 14,973,337
effective HSP length: 105
effective length of query: 556
effective length of database: 8,402,647
effective search space: 4671871732
effective search space used: 4671871732
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 55 (25.8 bits)