Query         psy10916
Match_columns 137
No_of_seqs    8 out of 10
Neff          1.5 
Searched_HMMs 46136
Date          Fri Aug 16 21:49:38 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10916.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10916hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PHA03257 Capsid triplex subuni  36.9      14 0.00031   32.0   0.6    8  127-134   265-272 (316)
  2 PF12540 DUF3736:  Protein of u  36.9      33 0.00071   26.5   2.5   63   58-125    44-112 (147)
  3 KOG4163|consensus               34.4      16 0.00034   34.1   0.5   20   77-97    202-221 (551)
  4 smart00838 EFG_C Elongation fa  33.4      10 0.00022   24.7  -0.7   27   16-43     41-67  (85)
  5 cd03710 BipA_TypA_C BipA_TypA_  31.8       9 0.00019   24.9  -1.1   25   16-41     40-64  (79)
  6 cd03711 Tet_C Tet_C: C-terminu  29.3      11 0.00023   24.3  -1.1   28   15-43     38-65  (78)
  7 COG4535 CorC Putative Mg2+ and  27.5      26 0.00057   30.5   0.7   43   82-136    68-110 (293)
  8 cd04096 eEF2_snRNP_like_C eEF2  25.1      15 0.00033   23.5  -0.9   25   16-41     41-65  (80)
  9 cd03713 EFG_mtEFG_C EFG_mtEFG_  25.0      17 0.00036   23.1  -0.7   26   16-42     39-64  (78)
 10 PF00679 EFG_C:  Elongation fac  24.3      19 0.00042   23.8  -0.6   30   15-45     42-71  (89)
 11 cd04097 mtEFG1_C mtEFG1_C: C-t  23.3      18 0.00038   23.3  -0.9   26   16-42     39-64  (78)
 12 PF00394 Cu-oxidase:  Multicopp  23.1      84  0.0018   22.5   2.5   31   47-78     68-98  (159)
 13 PF04831 Popeye:  Popeye protei  22.8      86  0.0019   24.8   2.7   59   51-114    58-150 (153)
 14 COG0512 PabA Anthranilate/para  22.2      94   0.002   25.2   2.9   34   43-77    100-148 (191)
 15 KOG2345|consensus               21.0      52  0.0011   28.8   1.2   24   98-121   268-291 (302)
 16 PF09421 FRQ:  Frequency clock   20.0   2E+02  0.0043   28.8   5.0   65   67-136   781-864 (989)

No 1  
>PHA03257 Capsid triplex subunit 2; Provisional
Probab=36.90  E-value=14  Score=32.04  Aligned_cols=8  Identities=63%  Similarity=1.331  Sum_probs=6.1

Q ss_pred             CCCCcccc
Q psy10916        127 SRYPVYEE  134 (137)
Q Consensus       127 ~~~~~~~~  134 (137)
                      -||||||-
T Consensus       265 rr~~~yea  272 (316)
T PHA03257        265 RRFPVYEA  272 (316)
T ss_pred             ccccHHHH
Confidence            48999973


No 2  
>PF12540 DUF3736:  Protein of unknown function (DUF3736);  InterPro: IPR022207  This domain family is found in eukaryotes, and is typically between 135 and 160 amino acids in length. 
Probab=36.86  E-value=33  Score=26.54  Aligned_cols=63  Identities=29%  Similarity=0.415  Sum_probs=35.7

Q ss_pred             eeeeEEeeeecCceeeecCCCCcchhhhhhhh---cchhhHHHHHHHHHHHhhhhc---CCCCCCCCCCCCCCC
Q psy10916         58 QATLHSIRVLQPKQVRVDSQDDHDSTREFLWK---RSSHIAHLVTEKLTSAARSLL---QPIPSNTPHIPLPPP  125 (137)
Q Consensus        58 ~ATLhSIrVlQPKQvrVdS~DnHdrTREfvW~---RS~~IAhlVsqKL~sAarsml---~p~p~~t~~~~~~~~  125 (137)
                      .|++|+|= -||--++    |+.-+|.+|+|+   ++...|.-..+-...--+-+|   .|.+-+-++-|-.|+
T Consensus        44 ~a~~~~V~-~~pPl~~----~~~~~~~~fl~~~~~~~~~~~~~~~~~~~~~r~r~l~~~~p~~q~~~~~p~~Ps  112 (147)
T PF12540_consen   44 PATLRRVP-EQPPLVL----DASTMKVEFLWRVGQTTPQQACRYYQGQRRKRRRMLREEPPSPQEKQGKPPVPS  112 (147)
T ss_pred             cCCCCccC-CCCCeee----cccccchhHHHHhhccccchhhHhhhccccccccccccCCCCccccccCCCCCC
Confidence            67777763 3555553    566799999998   344555444443333344455   344444445444444


No 3  
>KOG4163|consensus
Probab=34.41  E-value=16  Score=34.11  Aligned_cols=20  Identities=40%  Similarity=0.675  Sum_probs=14.6

Q ss_pred             CCCcchhhhhhhhcchhhHHH
Q psy10916         77 QDDHDSTREFLWKRSSHIAHL   97 (137)
Q Consensus        77 ~DnHdrTREfvW~RS~~IAhl   97 (137)
                      +--.-|||||+||- -|-||+
T Consensus       202 p~PFlRtrEFLWQE-GHTAfa  221 (551)
T KOG4163|consen  202 PQPFLRTREFLWQE-GHTAFA  221 (551)
T ss_pred             CCcchhhhHHHHhc-CcchhC
Confidence            34567999999996 466664


No 4  
>smart00838 EFG_C Elongation factor G C-terminus. This domain includes the carboxyl terminal regions of Elongation factor G, elongation factor 2 and some tetracycline resistance proteins and adopt a ferredoxin-like fold.
Probab=33.39  E-value=10  Score=24.73  Aligned_cols=27  Identities=37%  Similarity=0.460  Sum_probs=20.6

Q ss_pred             hhhhcCCCcccccchhhhhhhhhhchhh
Q psy10916         16 VYLKASIPTFQFGRGVKKELRSATATTA   43 (137)
Q Consensus        16 ~~~~~~~~ekefgrGakkelkSATAtT~   43 (137)
                      +.+++.+|-.++ -|-..+|||+|.-.+
T Consensus        41 ~~i~~~iP~~~~-~~~~~~Lrs~T~G~~   67 (85)
T smart00838       41 QVIKAKVPLSEM-FGYATDLRSATQGRA   67 (85)
T ss_pred             EEEEEECCHHHH-hchHHHHHHhcCCeE
Confidence            557788888888 788888888886543


No 5  
>cd03710 BipA_TypA_C BipA_TypA_C: a C-terminal portion of BipA or TypA having homology to the C terminal domains of the elongation factors EF-G and EF-2. A member of the ribosome binding GTPase superfamily, BipA is widely distributed in bacteria and plants.  BipA is a highly conserved protein with global regulatory properties in Escherichia coli. BipA is phosphorylated on a tyrosine residue under some cellular conditions. Mutants show altered regulation of some pathways. BipA functions as a translation factor that is required specifically for the expression of the transcriptional modulator Fis.  BipA binds to ribosomes at a site that coincides with that of EF-G and has a GTPase activity that is sensitive to high GDP:GTP ratios and, is stimulated  by 70S ribosomes programmed with mRNA and aminoacylated tRNAs. The growth rate-dependent induction of BipA allows the efficient expression of Fis, thereby modulating a range of downstream processes, including DNA metabolism and type III secreti
Probab=31.77  E-value=9  Score=24.92  Aligned_cols=25  Identities=24%  Similarity=0.329  Sum_probs=13.9

Q ss_pred             hhhhcCCCcccccchhhhhhhhhhch
Q psy10916         16 VYLKASIPTFQFGRGVKKELRSATAT   41 (137)
Q Consensus        16 ~~~~~~~~ekefgrGakkelkSATAt   41 (137)
                      +.+++.+|-.++ -|-..+|||+|.-
T Consensus        40 ~~i~~~~P~~~~-~~~~~~Lrs~T~G   64 (79)
T cd03710          40 TRLEFKIPSRGL-IGFRSEFLTDTRG   64 (79)
T ss_pred             EEEEEEECHHHH-cCcHHHHHhhCCC
Confidence            335555555555 5666666666543


No 6  
>cd03711 Tet_C Tet_C: C-terminus of ribosomal protection proteins Tet(M) and Tet(O). This domain has homology to the C terminal domains of the elongation factors EF-G and EF-2. Tet(M) and Tet(O) catalyze the release of tetracycline (Tc) from the ribosome in a GTP-dependent manner thereby mediating Tc resistance.  Tcs are broad-spectrum antibiotics.  Typical Tcs bind to the ribosome and inhibit the elongation phase of protein synthesis, by inhibiting the  occupation of site A by aminoacyl-tRNA.
Probab=29.25  E-value=11  Score=24.34  Aligned_cols=28  Identities=29%  Similarity=0.304  Sum_probs=18.6

Q ss_pred             hhhhhcCCCcccccchhhhhhhhhhchhh
Q psy10916         15 RVYLKASIPTFQFGRGVKKELRSATATTA   43 (137)
Q Consensus        15 ~~~~~~~~~ekefgrGakkelkSATAtT~   43 (137)
                      ++.+++.+|-.+. -|-..+|||+|.-.+
T Consensus        38 ~~~i~~~~P~~~~-~g~~~~Lr~~T~G~~   65 (78)
T cd03711          38 EVTLEGTIPVATS-QDYQSELPSYTHGEG   65 (78)
T ss_pred             EEEEEEEECHHHH-hhHHHHhHhhcCCeE
Confidence            3456777777776 677777777776543


No 7  
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism]
Probab=27.52  E-value=26  Score=30.49  Aligned_cols=43  Identities=28%  Similarity=0.457  Sum_probs=28.4

Q ss_pred             hhhhhhhhcchhhHHHHHHHHHHHhhhhcCCCCCCCCCCCCCCCCCCCCcccccC
Q psy10916         82 STREFLWKRSSHIAHLVTEKLTSAARSLLQPIPSNTPHIPLPPPPSRYPVYEEDN  136 (137)
Q Consensus        82 rTREfvW~RS~~IAhlVsqKL~sAarsml~p~p~~t~~~~~~~~~~~~~~~~~~~  136 (137)
                      +-|+.|--||.++.--..|-|..-..-+     .+++|       |||||+.||+
T Consensus        68 ~vrDiMIPRSQM~~l~~~~~l~~~l~~i-----iesaH-------SRfPVi~edk  110 (293)
T COG4535          68 RVRDIMIPRSQMITLKRNQTLDECLDVI-----IESAH-------SRFPVISEDK  110 (293)
T ss_pred             hHhhhcccHHHheeccccCCHHHHHHHH-----HHhcc-------ccCCcccCCc
Confidence            4567777787777655555555443333     34555       8999999985


No 8  
>cd04096 eEF2_snRNP_like_C eEF2_snRNP_like_C: this family represents a C-terminal domain of eukaryotic elongation factor 2 (eEF-2) and a homologous domain of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p.  Yeast Snu114p is essential for cell viability and for splicing in vivo. U5-116 kD binds GTP.  Experiments suggest that GTP binding and probably GTP hydrolysis is important for the function of the U5-116 kD/Snu114p.   In complex with GTP, EF-2 promotes the translocation step of translation. During translocation the peptidyl-tRNA is moved from the A site to the P site, the uncharged tRNA from the P site to the E-site and, the mRNA is shifted one codon relative to the ribosome.
Probab=25.08  E-value=15  Score=23.52  Aligned_cols=25  Identities=36%  Similarity=0.501  Sum_probs=14.6

Q ss_pred             hhhhcCCCcccccchhhhhhhhhhch
Q psy10916         16 VYLKASIPTFQFGRGVKKELRSATAT   41 (137)
Q Consensus        16 ~~~~~~~~ekefgrGakkelkSATAt   41 (137)
                      +.+++.+|-.|+ -|-..+|||.|.-
T Consensus        41 ~~i~~~iP~~e~-~~~~~~Lrs~T~G   65 (80)
T cd04096          41 FEIKAYLPVIES-FGFETDLRSATSG   65 (80)
T ss_pred             EEEEEEEeHHHH-hCcHHHHHhhCCC
Confidence            445556666665 5666666666643


No 9  
>cd03713 EFG_mtEFG_C EFG_mtEFG_C: domains similar to the C-terminal domain of the bacterial translational elongation factor (EF) EF-G.  Included in this group is the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2) proteins. Eukaryotic cells harbor 2 protein synthesis systems: one localized in the cytoplasm, the other in the mitochondria. Most factors regulating mitochondrial protein synthesis are encoded by nuclear genes, translated in the cytoplasm, and then transported to the mitochondria. The eukaryotic system of elongation factor (EF) components is more complex than that in prokaryotes, with both cytoplasmic and mitochondrial elongation factors and multiple isoforms being expressed in certain species. During the process of peptide synthesis and tRNA site changes, the ribosome is moved along the mRNA a distance equal to one codon with the addition of each amino acid. In bacteria this translocation step is catalyzed by EF-G_GTP, which is hydrolyzed to provide
Probab=25.02  E-value=17  Score=23.15  Aligned_cols=26  Identities=31%  Similarity=0.413  Sum_probs=18.3

Q ss_pred             hhhhcCCCcccccchhhhhhhhhhchh
Q psy10916         16 VYLKASIPTFQFGRGVKKELRSATATT   42 (137)
Q Consensus        16 ~~~~~~~~ekefgrGakkelkSATAtT   42 (137)
                      +.+++.+|-.|+ -|-..+|||+|.-.
T Consensus        39 ~~i~~~iP~~e~-~~~~~~Lr~~T~G~   64 (78)
T cd03713          39 KVIKAEVPLAEM-FGYSTDLRSLTQGR   64 (78)
T ss_pred             EEEEEEcCHHHH-hChHHHHHhhcCCe
Confidence            456777777777 67777777777643


No 10 
>PF00679 EFG_C:  Elongation factor G C-terminus;  InterPro: IPR000640 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ]. EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution. Elongation factor EF2 (EF-G) is a G-protein. It brings about the translocation of peptidyl-tRNA and mRNA through a ratchet-like mechanism: the binding of GTP-EF2 to the ribosome causes a counter-clockwise rotation in the small ribosomal subunit; the hydrolysis of GTP to GDP by EF2 and the subsequent release of EF2 causes a clockwise rotation of the small subunit back to the starting position [, ]. This twisting action destabilises tRNA-ribosome interactions, freeing the tRNA to translocate along the ribosome upon GTP-hydrolysis by EF2. EF2 binding also affects the entry and exit channel openings for the mRNA, widening it when bound to enable the mRNA to translocate along the ribosome. This entry represents the C-terminal domain found in EF2 (or EF-G) of both prokaryotes and eukaryotes (also known as eEF2), as well as in some tetracycline-resistance proteins. This domain adopts a ferredoxin-like fold consisting of an alpha/beta sandwich with anti-parallel beta-sheets. It resembles the topology of domain III found in these elongation factors, with which it forms the C-terminal block, but these two domains cannot be superimposed []. This domain is often found associated with (IPR000795 from INTERPRO), which contains the signatures for the N terminus of the proteins. More information about these proteins can be found at Protein of the Month: Elongation Factors [].; GO: 0005525 GTP binding; PDB: 1WDT_A 2DY1_A 3CB4_F 3DEG_C 2EFG_A 1ELO_A 2XSY_Y 2WRK_Y 1DAR_A 2WRI_Y ....
Probab=24.27  E-value=19  Score=23.76  Aligned_cols=30  Identities=40%  Similarity=0.554  Sum_probs=23.0

Q ss_pred             hhhhhcCCCcccccchhhhhhhhhhchhhhh
Q psy10916         15 RVYLKASIPTFQFGRGVKKELRSATATTAEM   45 (137)
Q Consensus        15 ~~~~~~~~~ekefgrGakkelkSATAtT~EM   45 (137)
                      ++.+++.+|-.+.- |-..+||++|.-.+.+
T Consensus        42 ~~~i~~~iP~~~~~-gf~~~Lr~~T~G~a~~   71 (89)
T PF00679_consen   42 RVVIEAEIPVRELF-GFRSELRSLTSGRASF   71 (89)
T ss_dssp             EEEEEEEEEGGGHT-THHHHHHHHTTTS-EE
T ss_pred             heeEEEEEChhhhh-hHHHHhhccCCCEEEE
Confidence            45677888988887 9999999998766543


No 11 
>cd04097 mtEFG1_C mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes.  Eukaryotic cells harbor 2 protein synthesis systems: one localized in the cytoplasm, the other in the mitochondria. Most factors regulating mitochondrial protein synthesis are encoded by nuclear genes, translated in the cytoplasm, and then transported to the mitochondria. The eukaryotic system of elongation factor (EF) components is more complex than that in prokaryotes, with both cytoplasmic and mitochondrial elongation factors and multiple isoforms being expressed in certain species.  Eukaryotic EF-2 operates in the cytosolic protein synthesis machinery of eukaryotes, EF-Gs in protein synthesis in bacteria.  Eukaryotic mtEFG1 proteins show significant homology to bacterial EF-Gs.  Mutants in yeast mtEFG1 have impaired mitochondrial protein synthesis, respiratory defects and a tendency to lose mitochondrial DNA. There are two forms of mtEFG present in mammals (desig
Probab=23.33  E-value=18  Score=23.30  Aligned_cols=26  Identities=35%  Similarity=0.417  Sum_probs=17.7

Q ss_pred             hhhhcCCCcccccchhhhhhhhhhchh
Q psy10916         16 VYLKASIPTFQFGRGVKKELRSATATT   42 (137)
Q Consensus        16 ~~~~~~~~ekefgrGakkelkSATAtT   42 (137)
                      +.+++.+|-.++ -|-..+|||+|.-.
T Consensus        39 ~~i~~~~P~~e~-~g~~~~Lr~~T~G~   64 (78)
T cd04097          39 FTLEAEVPLNDM-FGYSTELRSMTQGK   64 (78)
T ss_pred             EEEEEEECHHHh-hChHHHHHhhCCCc
Confidence            456677777776 67777777777643


No 12 
>PF00394 Cu-oxidase:  Multicopper oxidase;  InterPro: IPR001117 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties. Since free copper is toxic, even at very low concentrations, its homeostasis in living organisms is tightly controlled by subtle molecular mechanisms. In eukaryotes, before being transported inside the cell via the high-affinity copper transporters of the CTR family, the copper (II) ion is reduced to copper (I). In blue copper proteins such as cupredoxin, the copper (I) ion form is stabilised by a constrained His2Cys coordination environment. Multicopper oxidases oxidise their substrate by accepting electrons at a mononuclear copper centre and transferring them to a trinuclear copper centre; dioxygen binds to the trinuclear centre and, following the transfer of four electrons, is reduced to two molecules of water []. There are three spectroscopically different copper centres found in multicopper oxidases: type 1 (or blue), type 2 (or normal) and type 3 (or coupled binuclear) [, ]. Multicopper oxidases consist of 2, 3 or 6 of these homologous domains, which also share homology to the cupredoxins azurin and plastocyanin. Structurally, these domains consist of a cupredoxin-like fold, a beta-sandwich consisting of 7 strands in 2 beta-sheets, arranged in a Greek-key beta-barrel []. Multicopper oxidases include:   Ceruloplasmin (1.16.3.1 from EC) (ferroxidase), a 6-domain enzyme found in the serum of mammals and birds that oxidizes different inorganic and organic substances; exhibits internal sequence homology that appears to have evolved from the triplication of a Cu-binding domain similar to that of laccase and ascorbate oxidase.  Laccase (1.10.3.2 from EC) (urishiol oxidase), a 3-domain enzyme found in fungi and plants, which oxidizes different phenols and diamines. CueO is a laccase found in Escherichia coli that is involved in copper-resistance []. Ascorbate oxidase (1.10.3.3 from EC), a 3-domain enzyme found in higher plants. Nitrite reductase (1.7.2.1 from EC), a 2-domain enzyme containing type-1 and type-2 copper centres [, ].   In addition to the above enzymes there are a number of other proteins that are similar to the multi-copper oxidases in terms of structure and sequence, some of which have lost the ability to bind copper. These include: copper resistance protein A (copA) from a plasmid in Pseudomonas syringae; domain A of (non-copper binding) blood coagulation factors V (Fa V) and VIII (Fa VIII) []; yeast FET3 required for ferrous iron uptake []; yeast hypothetical protein YFL041w; and the fission yeast homologue SpAC1F7.08. This entry represents multicopper oxidase type 1 (blue) domains. These domains are also present in proteins that have lost the ability to bind copper.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 1RZP_A 2AVF_D 1NIA_A 1KCB_A 2NRD_A 1NIB_A 2BW4_A 1RZQ_C 2BWD_A 2BWI_A ....
Probab=23.12  E-value=84  Score=22.51  Aligned_cols=31  Identities=19%  Similarity=0.314  Sum_probs=21.1

Q ss_pred             eeeEEEEeeCceeeeEEeeeecCceeeecCCC
Q psy10916         47 GKINLRVMHGGQATLHSIRVLQPKQVRVDSQD   78 (137)
Q Consensus        47 Gkl~lrV~~gG~ATLhSIrVlQPKQvrVdS~D   78 (137)
                      -+..||+.++|..+.+.+.+-.- .+.|-..|
T Consensus        68 ~~~rlRliNa~~~~~~~~~i~gh-~~~Via~D   98 (159)
T PF00394_consen   68 ERYRLRLINAGASTSFNFSIDGH-PMTVIAAD   98 (159)
T ss_dssp             TEEEEEEEEESSS-BEEEEETTB-CEEEEEET
T ss_pred             cEEEEEEEeccCCeeEEEEeecc-ceeEeeec
Confidence            35899999999999998887543 34444444


No 13 
>PF04831 Popeye:  Popeye protein conserved region;  InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle. It is represented by a conserved region which includes three potential transmembrane domains []. The strong conservation of POP genes during evolution and their preferential expression in heart and skeletal muscle suggest that these novel proteins may have an important function in these tissues in vertebrates.; GO: 0016020 membrane
Probab=22.78  E-value=86  Score=24.83  Aligned_cols=59  Identities=32%  Similarity=0.427  Sum_probs=38.4

Q ss_pred             EEEeeCceeeeEEeeeecCceeeecCCCC-----------------cchhhhhhhhcch-----------------hhHH
Q psy10916         51 LRVMHGGQATLHSIRVLQPKQVRVDSQDD-----------------HDSTREFLWKRSS-----------------HIAH   96 (137)
Q Consensus        51 lrV~~gG~ATLhSIrVlQPKQvrVdS~Dn-----------------HdrTREfvW~RS~-----------------~IAh   96 (137)
                      +||..+| -.||-|   .|.|. +|||+=                 -+.-|=+.|+|..                 -|++
T Consensus        58 ~~Vs~~g-~fLH~I---~p~qF-lDSPEW~s~~~s~~~~FQVTitA~~~Cryl~W~R~kL~~~l~~~~~L~~vF~~liGk  132 (153)
T PF04831_consen   58 MRVSCDG-RFLHYI---YPYQF-LDSPEWESLRPSEDDKFQVTITAEEDCRYLCWPREKLYLLLAKDPFLAAVFSNLIGK  132 (153)
T ss_pred             EEEEECC-EeeEee---ccccc-ccChhhhccccCCCCeEEEEEEEcCCcEEEEEEHHHHHHHHhhCHHHHHHHHHHHHH
Confidence            4667775 479988   46554 455431                 1234668899864                 4666


Q ss_pred             HHHHHHHHHhhhhcCCCC
Q psy10916         97 LVTEKLTSAARSLLQPIP  114 (137)
Q Consensus        97 lVsqKL~sAarsml~p~p  114 (137)
                      =|++||-+....+++.-+
T Consensus       133 DI~~KLy~ln~~~~~~~g  150 (153)
T PF04831_consen  133 DIAEKLYSLNEKLFTKRG  150 (153)
T ss_pred             HHHHHHHHhhhHhHhhcc
Confidence            678899888877776544


No 14 
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism]
Probab=22.22  E-value=94  Score=25.18  Aligned_cols=34  Identities=29%  Similarity=0.505  Sum_probs=26.7

Q ss_pred             hhheeeeEEEEeeCc------------eeeeEEeeeec---CceeeecCC
Q psy10916         43 AEMMGKINLRVMHGG------------QATLHSIRVLQ---PKQVRVDSQ   77 (137)
Q Consensus        43 ~EM~Gkl~lrV~~gG------------~ATLhSIrVlQ---PKQvrVdS~   77 (137)
                      .=|+||.+ .|.|+|            ++-+||+-|-.   |+-+.|++.
T Consensus       100 ~~~HGK~s-~i~h~g~~iF~glp~~f~v~RYHSLvv~~~~lP~~l~vtA~  148 (191)
T COG0512         100 EPMHGKTS-IITHDGSGLFAGLPNPFTVTRYHSLVVDPETLPEELEVTAE  148 (191)
T ss_pred             CCcCCeee-eeecCCcccccCCCCCCEEEeeEEEEecCCCCCCceEEEEE
Confidence            35999999 888887            45789998874   677777765


No 15 
>KOG2345|consensus
Probab=21.01  E-value=52  Score=28.84  Aligned_cols=24  Identities=38%  Similarity=0.587  Sum_probs=22.5

Q ss_pred             HHHHHHHHhhhhcCCCCCCCCCCC
Q psy10916         98 VTEKLTSAARSLLQPIPSNTPHIP  121 (137)
Q Consensus        98 VsqKL~sAarsml~p~p~~t~~~~  121 (137)
                      .||+|-+--++|++++|..-|+|+
T Consensus       268 yse~l~~lik~mlqvdP~qRP~i~  291 (302)
T KOG2345|consen  268 YSEALHQLIKSMLQVDPNQRPTIP  291 (302)
T ss_pred             ccHHHHHHHHHHhcCCcccCCCHH
Confidence            689999999999999999999986


No 16 
>PF09421 FRQ:  Frequency clock protein;  InterPro: IPR018554  The frequency clock protein, is the central component of the frq-based circadian negative feedback loop, regulates various aspects of the circadian clock in Neurospora crassa []. This protein has been shown to interact with itself via a coiled-coil []. 
Probab=20.02  E-value=2e+02  Score=28.78  Aligned_cols=65  Identities=29%  Similarity=0.528  Sum_probs=36.8

Q ss_pred             ecCceeeecCCCCcchhhhhhhhcchhhHHHHHHHHHHHhhhhcCC--CCCCC-----------------CCCCCCCCCC
Q psy10916         67 LQPKQVRVDSQDDHDSTREFLWKRSSHIAHLVTEKLTSAARSLLQP--IPSNT-----------------PHIPLPPPPS  127 (137)
Q Consensus        67 lQPKQvrVdS~DnHdrTREfvW~RS~~IAhlVsqKL~sAarsml~p--~p~~t-----------------~~~~~~~~~~  127 (137)
                      -+||+++..+.-...++|     ++..++..+.++|.....|.=-|  ...++                 +-.|||||-+
T Consensus       781 KRpk~~~p~~~~~~~r~~-----~se~~~~~I~~rLAs~~TSsp~p~~s~~k~~~~~IeiEYlS~rikrL~PvpLPpPa~  855 (989)
T PF09421_consen  781 KRPKDIRPSASRPIGRRR-----RSEESTERIIQRLASMSTSSPSPGPSERKTSEPPIEIEYLSGRIKRLAPVPLPPPAS  855 (989)
T ss_pred             cccccccccccccccccc-----ccchhHHHHHHHHhhccccCCCCCCCccccccCceeEEEeeccceecCCCCCCCccc
Confidence            466666543322223322     23367778888887766653122  22222                 2248999999


Q ss_pred             CCCcccccC
Q psy10916        128 RYPVYEEDN  136 (137)
Q Consensus       128 ~~~~~~~~~  136 (137)
                      -||-|.-|+
T Consensus       856 FFpPFSsds  864 (989)
T PF09421_consen  856 FFPPFSSDS  864 (989)
T ss_pred             ccCCcccCC
Confidence            998776554


Done!