Query         psy10937
Match_columns 131
No_of_seqs    119 out of 198
Neff          3.5 
Searched_HMMs 46136
Date          Fri Aug 16 22:19:07 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10937.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10937hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2418|consensus              100.0 1.3E-48 2.8E-53  337.5   7.0  127    2-130   278-409 (448)
  2 KOG2418|consensus              100.0 1.8E-36 3.9E-41  262.3   5.0   89   42-130   287-379 (448)
  3 PF00418 Tubulin-binding:  Tau   99.6 2.7E-16 5.9E-21   94.6   2.0   30   65-94      1-31  (31)
  4 PF00418 Tubulin-binding:  Tau   99.6 9.8E-16 2.1E-20   92.2   2.2   31   95-126     1-31  (31)
  5 PF01307 Plant_vir_prot:  Plant  13.0 1.2E+02  0.0025   22.4   1.3   12  115-126    36-47  (104)
  6 TIGR00307 S8e ribosomal protei  11.5 1.9E+02  0.0042   22.3   2.1   48   27-74      8-61  (127)
  7 PF10267 Tmemb_cc2:  Predicted   10.3 1.3E+02  0.0028   27.1   0.9   18   15-32    129-146 (395)
  8 PF15462 Barttin:  Bartter synd  10.1 1.1E+02  0.0023   25.8   0.3   14    8-21     81-94  (224)
  9 COG3586 Uncharacterized conser   9.8 1.9E+02  0.0042   21.7   1.5   33   69-102    48-84  (101)
 10 PF02395 Peptidase_S6:  Immunog   9.6 1.3E+02  0.0028   29.2   0.7   16    8-23     53-68  (769)

No 1  
>KOG2418|consensus
Probab=100.00  E-value=1.3e-48  Score=337.50  Aligned_cols=127  Identities=43%  Similarity=0.700  Sum_probs=119.3

Q ss_pred             CcccccccCCCCccccccccccCcCCcccCCCCc-eeeeeeccccc-ccccccc-CCccccCCCCceeEEEEEeecc--c
Q psy10937          2 NKIQVGAAPSPNLKKVTSKIGSLQNAHYKPGGGK-VKIENRKLEWK-AEPRIAA-KNDEYVPGGGDKKIEVVKLNWN--A   76 (131)
Q Consensus         2 ~~~~~~~~p~Pdl~~V~SKiGS~dNikh~PGGG~-vkI~~~K~d~~-~~sk~gs-~N~~h~PgGG~vkI~s~Kld~~--~   76 (131)
                      +.+|.+++|+|||+||+|||||++|||||||||+ |||.++|+||+ ++||||| +||+|+||||+|+|+++||||+  +
T Consensus       278 k~lr~~p~p~pdlkNVKSKIGSt~NiKhqpgGG~IVqIv~kk~dlshvtSKcGSLkNi~H~pGGG~V~Ies~KLDFk~~~  357 (448)
T KOG2418|consen  278 KVLRMTPKPNPDLKNVKSKIGSTTNIKHQPGGGNIVQIVSKKRDLSHVTSKCGSLKNITHVPGGGNVQIESRKLDFKAAV  357 (448)
T ss_pred             chhcccCCCCchhhhhhhhccccccccccCCCCcEEEEEeechhhhhhhhhhcccccccccCCCceeeeeeeecchhhhh
Confidence            4789999999999999999999999999999999 99999999995 8999997 7999999999999999999997  5


Q ss_pred             ccccccCCCCcccCCCCCeeEEEeeeccccCcccCCCCCCCCcccCCCCceeec
Q psy10937         77 KPKVGSLDNATHKPGGGDKKIESVKLDFKDKAKPKVGSKDNLKHSPGGGTVKVL  130 (131)
Q Consensus        77 ~SK~GS~dNi~H~PgGG~vkIes~Kldf~~ka~sKvGS~dni~H~PgGG~vki~  130 (131)
                      |+|||||||++|+||||||||+++||+|+++  +|+++.+++.|+|-+++|.+.
T Consensus       358 qaKVGSldNahhvPgggnvKI~S~KLtfre~--aKa~~dhgAei~~~sp~vs~~  409 (448)
T KOG2418|consen  358 QAKVGSLDNAHHVPGGGNVKIVSEKLTFREK--AKAGSDHGAEIKPASPNVSSV  409 (448)
T ss_pred             hhhcccccccccccCCCceeeeeeecchhhh--ccccccCCceeeccCCccccc
Confidence            9999999999999999999999999999954  677888899999999988764


No 2  
>KOG2418|consensus
Probab=100.00  E-value=1.8e-36  Score=262.26  Aligned_cols=89  Identities=45%  Similarity=0.727  Sum_probs=85.7

Q ss_pred             cccc-cccccccc-CCccccCCCCc-eeEEEEEeecc-cccccccCCCCcccCCCCCeeEEEeeeccccCcccCCCCCCC
Q psy10937         42 KLEW-KAEPRIAA-KNDEYVPGGGD-KKIEVVKLNWN-AKPKVGSLDNATHKPGGGDKKIESVKLDFKDKAKPKVGSKDN  117 (131)
Q Consensus        42 K~d~-~~~sk~gs-~N~~h~PgGG~-vkI~s~Kld~~-~~SK~GS~dNi~H~PgGG~vkIes~Kldf~~ka~sKvGS~dn  117 (131)
                      -.|| ++.||||| +||+|+||||+ |||.++|+||+ ++||||||.||+|+||||+|+||+.||||+++||+|||||||
T Consensus       287 ~pdlkNVKSKIGSt~NiKhqpgGG~IVqIv~kk~dlshvtSKcGSLkNi~H~pGGG~V~Ies~KLDFk~~~qaKVGSldN  366 (448)
T KOG2418|consen  287 NPDLKNVKSKIGSTTNIKHQPGGGNIVQIVSKKRDLSHVTSKCGSLKNITHVPGGGNVQIESRKLDFKAAVQAKVGSLDN  366 (448)
T ss_pred             CchhhhhhhhccccccccccCCCCcEEEEEeechhhhhhhhhhcccccccccCCCceeeeeeeecchhhhhhhhcccccc
Confidence            3577 89999998 79999999999 99999999998 899999999999999999999999999999999999999999


Q ss_pred             CcccCCCCceeec
Q psy10937        118 LKHSPGGGTVKVL  130 (131)
Q Consensus       118 i~H~PgGG~vki~  130 (131)
                      ++|+||||||||.
T Consensus       367 ahhvPgggnvKI~  379 (448)
T KOG2418|consen  367 AHHVPGGGNVKIV  379 (448)
T ss_pred             cccccCCCceeee
Confidence            9999999999995


No 3  
>PF00418 Tubulin-binding:  Tau and MAP protein, tubulin-binding repeat;  InterPro: IPR001084 Microtubules consist of tubulins as well as a group of additional proteins collectively known as the Microtubule Associated Proteins (MAP). MAP's have been classified into two classes: high molecular weight MAP's and Tau protein. The Tau proteins promote microtubule assembly and stabilise microtubules. The C-terminal region of these proteins contains three or four tandem repeats of a conserved domain of about thirty amino acid residues which is implicated in tubulin-binding and which seems to have a stiffening effect on microtubules.; GO: 0007026 negative regulation of microtubule depolymerization
Probab=99.60  E-value=2.7e-16  Score=94.65  Aligned_cols=30  Identities=57%  Similarity=0.943  Sum_probs=16.2

Q ss_pred             eeEEEEEeecc-cccccccCCCCcccCCCCC
Q psy10937         65 KKIEVVKLNWN-AKPKVGSLDNATHKPGGGD   94 (131)
Q Consensus        65 vkI~s~Kld~~-~~SK~GS~dNi~H~PgGG~   94 (131)
                      |||+++||||+ ++|||||+||++|+||||+
T Consensus         1 VkI~~~K~d~~~v~SK~GS~~N~~H~PGGGn   31 (31)
T PF00418_consen    1 VKIESKKLDFSNVQSKCGSLDNIKHKPGGGN   31 (31)
T ss_pred             CceeeeccccccccccccccccccccCCCCC
Confidence            45555555553 4555555555555555553


No 4  
>PF00418 Tubulin-binding:  Tau and MAP protein, tubulin-binding repeat;  InterPro: IPR001084 Microtubules consist of tubulins as well as a group of additional proteins collectively known as the Microtubule Associated Proteins (MAP). MAP's have been classified into two classes: high molecular weight MAP's and Tau protein. The Tau proteins promote microtubule assembly and stabilise microtubules. The C-terminal region of these proteins contains three or four tandem repeats of a conserved domain of about thirty amino acid residues which is implicated in tubulin-binding and which seems to have a stiffening effect on microtubules.; GO: 0007026 negative regulation of microtubule depolymerization
Probab=99.57  E-value=9.8e-16  Score=92.22  Aligned_cols=31  Identities=61%  Similarity=0.965  Sum_probs=29.8

Q ss_pred             eeEEEeeeccccCcccCCCCCCCCcccCCCCc
Q psy10937         95 KKIESVKLDFKDKAKPKVGSKDNLKHSPGGGT  126 (131)
Q Consensus        95 vkIes~Kldf~~ka~sKvGS~dni~H~PgGG~  126 (131)
                      |||+++||||+ +|+|||||+||++|+|||||
T Consensus         1 VkI~~~K~d~~-~v~SK~GS~~N~~H~PGGGn   31 (31)
T PF00418_consen    1 VKIESKKLDFS-NVQSKCGSLDNIKHKPGGGN   31 (31)
T ss_pred             Cceeeeccccc-cccccccccccccccCCCCC
Confidence            79999999999 69999999999999999997


No 5  
>PF01307 Plant_vir_prot:  Plant viral movement protein;  InterPro: IPR001896 This family of membrane/coat proteins are found in a number of different ssRNA plant virus families that include Potexvirus, Hordeivirus and Carlavirus.
Probab=12.99  E-value=1.2e+02  Score=22.35  Aligned_cols=12  Identities=42%  Similarity=0.769  Sum_probs=7.2

Q ss_pred             CCCCcccCCCCc
Q psy10937        115 KDNLKHSPGGGT  126 (131)
Q Consensus       115 ~dni~H~PgGG~  126 (131)
                      .||++|.|=||.
T Consensus        36 GDniH~LPhGG~   47 (104)
T PF01307_consen   36 GDNIHSLPHGGR   47 (104)
T ss_pred             CCCCCCCCCCCc
Confidence            466666666653


No 6  
>TIGR00307 S8e ribosomal protein S8.e. Archaeal and eukaryotic ribosomal protein S8. This model could easily have been split into two models, one for eukaryotic S8 and one for archaeal S8; eukaryotic forms invariably have in insert of about 80 residues that archaeal forms of S8 do not.
Probab=11.53  E-value=1.9e+02  Score=22.26  Aligned_cols=48  Identities=27%  Similarity=0.481  Sum_probs=29.6

Q ss_pred             CcccCCCCceeeeeecccc-----ccccccccCCcc-ccCCCCceeEEEEEeec
Q psy10937         27 AHYKPGGGKVKIENRKLEW-----KAEPRIAAKNDE-YVPGGGDKKIEVVKLNW   74 (131)
Q Consensus        27 ikh~PGGG~vkI~~~K~d~-----~~~sk~gs~N~~-h~PgGG~vkI~s~Kld~   74 (131)
                      -+.+|.||......+|=-|     -+.|++|.+-++ -.--||+.++.-..+|+
T Consensus         8 ~~rk~TGGr~~~~rkKRk~ElGr~pa~T~ig~~r~~~vR~rGGn~K~Ralr~~~   61 (127)
T TIGR00307         8 SRRKPTGGKYRQARKKRKYELGREPAETKIGERRIKKVRTRGGNKKVRLLRDET   61 (127)
T ss_pred             CcccCCCCccccccccchhhcCCCccccccCccEEEEEEcCCCceEEEEEEeee
Confidence            3567788877765444333     355667665333 34557777777777776


No 7  
>PF10267 Tmemb_cc2:  Predicted transmembrane and coiled-coil 2 protein;  InterPro: IPR019394  This family of transmembrane coiled-coil containing proteins is conserved from worms to humans. Its function is unknown. 
Probab=10.32  E-value=1.3e+02  Score=27.06  Aligned_cols=18  Identities=22%  Similarity=0.254  Sum_probs=15.0

Q ss_pred             cccccccccCcCCcccCC
Q psy10937         15 KKVTSKIGSLQNAHYKPG   32 (131)
Q Consensus        15 ~~V~SKiGS~dNikh~PG   32 (131)
                      .-+++|.||.|||-|...
T Consensus       129 ~likNkFGSADNI~sl~~  146 (395)
T PF10267_consen  129 HLIKNKFGSADNISSLKD  146 (395)
T ss_pred             hcccCCCCCCCccccccc
Confidence            347899999999988754


No 8  
>PF15462 Barttin:  Bartter syndrome, infantile, with sensorineural deafness (Barttin)
Probab=10.13  E-value=1.1e+02  Score=25.79  Aligned_cols=14  Identities=14%  Similarity=0.437  Sum_probs=11.8

Q ss_pred             ccCCCCcccccccc
Q psy10937          8 AAPSPNLKKVTSKI   21 (131)
Q Consensus         8 ~~p~Pdl~~V~SKi   21 (131)
                      -+++|||++||-|+
T Consensus        81 dQSLPdfshIQmKv   94 (224)
T PF15462_consen   81 DQSLPDFSHIQMKV   94 (224)
T ss_pred             hcCCCchhhheeee
Confidence            47899999999765


No 9  
>COG3586 Uncharacterized conserved protein [Function unknown]
Probab=9.77  E-value=1.9e+02  Score=21.72  Aligned_cols=33  Identities=27%  Similarity=0.374  Sum_probs=22.6

Q ss_pred             EEEeeccc----ccccccCCCCcccCCCCCeeEEEeee
Q psy10937         69 VVKLNWNA----KPKVGSLDNATHKPGGGDKKIESVKL  102 (131)
Q Consensus        69 s~Kld~~~----~SK~GS~dNi~H~PgGG~vkIes~Kl  102 (131)
                      +-++.|+.    .-+|--..|+.| ||-|++.|+-.-+
T Consensus        48 ~l~m~~~el~d~kg~~kDVsNiG~-~g~GD~Ei~i~~~   84 (101)
T COG3586          48 SLNMPFNELQDPKGLAKDVSNIGH-WGNGDVEIGIEDL   84 (101)
T ss_pred             EEecccCcccCccchhhcccccCC-CcCCcEEEEEeeh
Confidence            44455542    455667889999 9999999975433


No 10 
>PF02395 Peptidase_S6:  Immunoglobulin A1 protease Serine protease Prosite pattern;  InterPro: IPR000710 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This group of serine peptidases belong to the MEROPS peptidase family S6 (clan PA(S)). The type sample being the IgA1-specific serine endopeptidase from Neisseria gonorrhoeae []. These cleave prolyl bonds in the hinge regions of immunoglobulin A heavy chains. Similar specificity is shown by the unrelated family of M26 metalloendopeptidases.; GO: 0004252 serine-type endopeptidase activity, 0006508 proteolysis; PDB: 3SZE_A 3H09_B 3SYJ_A 1WXR_A 3AK5_B.
Probab=9.59  E-value=1.3e+02  Score=29.19  Aligned_cols=16  Identities=31%  Similarity=0.609  Sum_probs=8.3

Q ss_pred             ccCCCCcccccccccc
Q psy10937          8 AAPSPNLKKVTSKIGS   23 (131)
Q Consensus         8 ~~p~Pdl~~V~SKiGS   23 (131)
                      .+|||||+.|...-|.
T Consensus        53 ~~PMpDFS~vs~~~G~   68 (769)
T PF02395_consen   53 KAPMPDFSSVSRNKGV   68 (769)
T ss_dssp             SSB---GCCB-TTTSS
T ss_pred             CCCCCCcchhccCCce
Confidence            3889999888776443


Done!