Diaphorina citri psyllid: psy10939

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MVDSYVNENQLFNGQIEEQKLDIKAQSKIGSLDNVKHKPGGGIEEQKLDIKAQSKIGSLDNVKHKPGGGEKKIFDDKDYLKQKAAGDSKPTSEVPSENQFH
cccccccccccccEEEEEEEEcEEEEccccccccccccccccccEEEccEEEccccccccccccccccccEEEECccccHHHHcccccccccccccccccc
**************QIEEQKLDIKA************K**GGIEEQKLDIKA********************IF***************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDSYVNENQLFNGQIEEQKLDIKAQSKIGSLDNVKHKPGGGIEEQKLDIKAQSKIGSLDNVKHKPGGGEKKIFDDKDYLKQKAAGDSKPTSEVPSENQFH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Microtubule-associated protein 4 Non-neuronal microtubule-associated protein. Promotes microtubule assembly.confidentP27816
Microtubule-associated protein 4 Non-neuronal microtubule-associated protein. Promotes microtubule assembly.confidentQ5M7W5
Microtubule-associated protein 4 Non-neuronal microtubule-associated protein. Promotes microtubule assembly.confidentP27546

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0008017 [MF]microtubule bindingprobableGO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0051301 [BP]cell divisionprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0072686 [CC]mitotic spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0071822 [BP]protein complex subunit organizationprobableGO:0043933, GO:0008150, GO:0071840, GO:0016043
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0000226 [BP]microtubule cytoskeleton organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted