Diaphorina citri psyllid: psy10941


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
AKFAFDIYDTEGNGQIDAVDLGRVLYALNLNPTLATIEKLGGTKKKVYEDFLECLKLYDKQEDGTMLGAELHHILISLGERMEESEVNEVLQDCLDAEDEDGFVQYAHSE
ccccccccccccccCEEHHHHHHHHHHccccccHHHHHHHcccccccHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccccccc
AKFAFDIYDTEGNGQIDAVDLGRVLYALNLNPTLATIEKLGGTKKKVYEDFLECLKLYDKQEDGTMLGAELHHILISLGERMEESEVNEVLQDCLDAEDEDGFVQYA***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AKFAFDIYDTEGNGQIDAVDLGRVLYALNLNPTLATIEKLGGTKKKVYEDFLECLKLYDKQEDGTMLGAELHHILISLGERMEESEVNEVLQDCLDAEDEDGFVQYAHSE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Myosin light polypeptide 6 Regulatory light chain of myosin. Does not bind calcium.confidentP02607
Myosin, essential light chain confidentP53014
Myosin, essential light chain confidentQ17133

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050998 [MF]nitric-oxide synthase bindingprobableGO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0008179 [MF]adenylate cyclase bindingprobableGO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0017111 [MF]nucleoside-triphosphatase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674
GO:0000922 [CC]spindle poleprobableGO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0007190 [BP]activation of adenylate cyclase activityprobableGO:0019220, GO:0031281, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0051339, GO:0045981, GO:0043085, GO:0009893, GO:0030819, GO:0030816, GO:0045761, GO:0045762, GO:0009891, GO:0030810, GO:0050789, GO:0065007, GO:0044093, GO:0051349, GO:0048518, GO:0065009, GO:0045935, GO:0045937, GO:0019219, GO:0050790, GO:0009889, GO:0050794, GO:0051174, GO:1900542, GO:0008150, GO:0051171, GO:0051173, GO:0030799, GO:0031279, GO:1900544, GO:1900371, GO:0030808, GO:0080090, GO:0030804, GO:0030801, GO:1900373, GO:0030802, GO:0030817, GO:0006140, GO:0030814, GO:0010562, GO:0048522
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008092 [MF]cytoskeletal protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0030235 [MF]nitric-oxide synthase regulator activityprobableGO:0030234, GO:0003674
GO:0030426 [CC]growth coneprobableGO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0005815 [CC]microtubule organizing centerprobableGO:0005856, GO:0005575, GO:0015630, GO:0043228, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043226, GO:0044422
GO:0060314 [BP]regulation of ryanodine-sensitive calcium-release channel activityprobableGO:1901019, GO:0032412, GO:0008150, GO:0022898, GO:0051924, GO:0050794, GO:0010959, GO:0032409, GO:0065007, GO:0051049, GO:0034762, GO:2001257, GO:0034765, GO:0065009, GO:0032879, GO:0050789, GO:0043269
GO:0016460 [CC]myosin II complexprobableGO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0016459, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0051000 [BP]positive regulation of nitric-oxide synthase activityprobableGO:0050999, GO:0032770, GO:0051341, GO:0019222, GO:0032768, GO:0050790, GO:0051353, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789, GO:0043085
GO:0030017 [CC]sarcomereprobableGO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SG6, chain A
Confidence level:very confident
Coverage over the Query: 1-109
View the alignment between query and template
View the model in PyMOL