Diaphorina citri psyllid: psy10949


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160---
MTPQRPNYIMGSLNFQSFYLNKVVNCAEGGLVRLWIQVLRELRRGVQLKKVCHTRNPIEYQMTPYEILMDDIRSRRYKLKQVTVDGSIPPRVKKDAHAIILEFIRSRPPLRKASDRKLPPRQYESTPRERLLEDIKKGSNHRLRHRESRPDRTARKALLYSRV
cccccccHHHcccccccccHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccc
*******YIMGSLNFQSFYLNKVVNCAEGGLVRLWIQVLRELRRGVQLKKVCHTRNPIEYQMTPYEILMDDIRSRRYKLKQVTVDGSIPPRVKKDAHAIILEFIRSRP************************************************AL**S**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTPQRPNYIMGSLNFQSFYLNKVVNCAEGGLVRLWIQVLRELRRGVQLKKVCHTRNPIEYQMTPYEILMDDIRSRRYKLKQVTVDGSIPPRVKKDAHAIILEFIRSRPPLRKASDRKLPPRQYESTPRERLLEDIKKGSNHRLRHRESRPDRTARKALLYSRV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein spire Acts as a actin nucleation factor, remains associated with the slow-growing pointed end of the new filament. Involved in vesicle transport processes providing a novel link between actin organization and intracellular transport. Required for localization of determinants within the developing oocyte to the posterior pole and to the dorsal anterior corner. Links Rho family signaling and Jnk function to the actin cytoskeleton.confidentQ29KT5
Protein spire homolog 1 Acts as a actin nucleation factor, remains associated with the slow-growing pointed end of the new filament. Involved in vesicle transport processes providing a novel link between actin organization and intracellular transport.confidentQ1LYM3
Protein spire homolog 2 Acts as a actin nucleation factor, remains associated with the slow-growing pointed end of the new filament. Involved in vesicle transport processes providing a novel link between actin organization and intracellular transport.confidentQ8K1S6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0051295 [BP]establishment of meiotic spindle localizationprobableGO:0048610, GO:0051653, GO:0008104, GO:0000226, GO:0051656, GO:0044699, GO:0051321, GO:0000003, GO:0071840, GO:0016043, GO:0007049, GO:0033036, GO:0006996, GO:0009987, GO:0051293, GO:0044763, GO:0051649, GO:0051234, GO:0051179, GO:0051640, GO:0051641, GO:0031503, GO:0007017, GO:0007010, GO:0022402, GO:0008150
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0045010 [BP]actin nucleationprobableGO:0033043, GO:0043933, GO:0030036, GO:0051128, GO:0008064, GO:0071840, GO:0050789, GO:0044699, GO:0030832, GO:0030833, GO:0071822, GO:0030838, GO:0051495, GO:0051493, GO:0016043, GO:0090066, GO:0065007, GO:0032271, GO:0032273, GO:0048518, GO:0065008, GO:0051130, GO:0032970, GO:0030029, GO:0009987, GO:0031334, GO:0050794, GO:0044763, GO:0032956, GO:0043254, GO:0006996, GO:0007015, GO:0007010, GO:0010638, GO:0044087, GO:0008150, GO:0032535, GO:0048522
GO:0048193 [BP]Golgi vesicle transportprobableGO:0009987, GO:0016192, GO:0046907, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MN7, chain S
Confidence level:very confident
Coverage over the Query: 62-76,102-106
View the alignment between query and template
View the model in PyMOL
Template: 4EFH, chain B
Confidence level:confident
Coverage over the Query: 94-113
View the alignment between query and template
View the model in PyMOL
Template: 1S0P, chain A
Confidence level:probable
Coverage over the Query: 8-48
View the alignment between query and template
View the model in PyMOL