Diaphorina citri psyllid: psy1097


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MDFESEGIPDPPSGAIGVSNNRTSVVITWSSPPYDGGCMITGYVVEMKAGTQPWVELSESIGGGELFERVVADDFTLTERDCVLFLRQICEGVDYMHRNNIVHLDLKPENIMCVSRTSHHIKIIDFGLAQKINPDHPPRVLFGTPEFIPPEIINYEPIGIESDMWSIGVITYVLYLQCT
ccCEcccccccccccccccccccEEEEEEccccccccccEEEEEEEEECccccEEEEEEcccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccECcccccccEEECccccccEEEECccccEEcccccccEEccccccccccEEEccccccccccHHHHHHHHHHHccccc
*DFESEG**************RTSVVITWSSPPYDGGCMITGYVVEMKAGTQPWVELSESIGGGELFERVVADDFTLTERDCVLFLRQICEGVDYMHRNNIVHLDLKPENIMCVSRTSHHIKIIDFGLAQKINPDHPPRVLFGTPEFIPPEIINYEPIGIESDMWSIGVITYVLYLQCT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDFESEGIPDPPSGAIGVSNNRTSVVITWSSPPYDGGCMITGYVVEMKAGTQPWVELSESIGGGELFERVVADDFTLTERDCVLFLRQICEGVDYMHRNNIVHLDLKPENIMCVSRTSHHIKIIDFGLAQKINPDHPPRVLFGTPEFIPPEIINYEPIGIESDMWSIGVITYVLYLQCT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Myosin light chain kinase, smooth muscle Calcium/calmodulin-dependent myosin light chain kinase implicated in smooth muscle contraction via phosphorylation of myosin light chains (MLC). Also regulates actin-myosin interaction through a non-kinase activty. Phosphorylates PTK2B/PYK2 and myosin light-chains. Involved in the inflammatory response (e.g. apoptosis, vascular permeability, leukocyte diapedesis), cell motility and morphology, airway hyperreactivity and other activities relevant to asthma. Required for tonic airway smooth muscle contraction that is necessary for physiological and asthmatic airway resistance. Necessary for gastrointestinal motility. Implicated in the regulation of endothelial as well as vascular permeability, probably via the regulation of cytoskeletal rearrangements. In the nervous system it has been shown to control the growth initiation of astrocytic processes in culture and to participate in transmitter release at synapses formed between cultured sympathetic ganglion cells. Critical participant in signaling sequences that result in fibroblast apoptosis. Plays a role in the regulation of epithelial cell survival. Required for epithelial wound healing, especially during actomyosin ring contraction during purse-string wound closure. Mediates RhoA-dependent membrane blebbing. Triggers TRPC5 channel activity in a calcium-dependent signaling, by inducing its subcellular localization at the plasma membrane. Promotes cell migration (including tumor cells) and tumor metastasis. PTK2B/PYK2 activation by phosphorylation mediates ITGB2 activation and is thus essential to trigger neutrophil transmigration during acute lung injury (ALI). May regulate optic nerve head astrocyte migration. Probably involved in mitotic cytoskeletal regulation. Regulates tight junction probably by modulating ZO-1 exchange in the perijunctional actomyosin ring. Mediates burn-induced microvascular barrier injury; triggers endothelial contraction in the development of microvascular hyperpermeability by phosphorylating MLC. Essential for intestinal barrier dysfunction. Mediates Giardia spp.-mediated reduced epithelial barrier function during giardiasis intestinal infection via reorganization of cytoskeletal F-actin and tight junctional ZO-1. Necessary for hypotonicity-induced Ca(2+) entry and subsequent activation of volume-sensitive organic osmolyte/anion channels (VSOAC) in cervical cancer cells.confidentQ28824
Myosin light chain kinase, smooth muscle Calcium/calmodulin-dependent myosin light chain kinase implicated in smooth muscle contraction via phosphorylation of myosin light chains (MLC). Also regulates actin-myosin interaction through a non-kinase activty. Phosphorylates PTK2B/PYK2 and myosin light-chains. Involved in the inflammatory response (e.g. apoptosis, vascular permeability, leukocyte diapedesis), cell motility and morphology, airway hyperreactivity and other activities relevant to asthma. Required for tonic airway smooth muscle contraction that is necessary for physiological and asthmatic airway resistance. Necessary for gastrointestinal motility. Implicated in the regulation of endothelial as well as vascular permeability, probably via the regulation of cytoskeletal rearrangements. In the nervous system it has been shown to control the growth initiation of astrocytic processes in culture and to participate in transmitter release at synapses formed between cultured sympathetic ganglion cells. Critical participant in signaling sequences that result in fibroblast apoptosis. Plays a role in the regulation of epithelial cell survival. Required for epithelial wound healing, especially during actomyosin ring contraction during purse-string wound closure. Mediates RhoA-dependent membrane blebbing. Triggers TRPC5 channel activity in a calcium-dependent signaling, by inducing its subcellular localization at the plasma membrane. Promotes cell migration (including tumor cells) and tumor metastasis. PTK2B/PYK2 activation by phosphorylation mediates ITGB2 activation and is thus essential to trigger neutrophil transmigration during acute lung injury (ALI). May regulate optic nerve head astrocyte migration. Probably involved in mitotic cytoskeletal regulation. Regulates tight junction probably by modulating ZO-1 exchange in the perijunctional actomyosin ring. Mediates burn-induced microvascular barrier injury; triggers endothelial contraction in the development of microvascular hyperpermeability by phosphorylating MLC. Essential for intestinal barrier dysfunction. Mediates Giardia spp.-mediated reduced epithelial barrier function during giardiasis intestinal infection via reorganization of cytoskeletal F-actin and tight junctional ZO-1. Necessary for hypotonicity-induced Ca(2+) entry and subsequent activation of volume-sensitive organic osmolyte/anion channels (VSOAC) in cervical cancer cells. Responsible for high proliferative ability of breast cancer cells through anti-apoptosis.confidentQ15746
Myosin light chain kinase, smooth muscle Calcium/calmodulin-dependent myosin light chain kinase implicated in smooth muscle contraction via phosphorylation of myosin light chains (MLC). Also regulates actin-myosin interaction through a non-kinase activty. Phosphorylates PTK2B/PYK2 and myosin light-chains. Involved in the inflammatory response (e.g. apoptosis, vascular permeability, leukocyte diapedesis), cell motility and morphology, airway hyperreactivity and other activities relevant to asthma. Required for tonic airway smooth muscle contraction that is necessary for physiological and asthmatic airway resistance. Necessary for gastrointestinal motility. Implicated in the regulation of endothelial as well as vascular permeability, probably via the regulation of cytoskeletal rearrangements. In the nervous system it has been shown to control the growth initiation of astrocytic processes in culture and to participate in transmitter release at synapses formed between cultured sympathetic ganglion cells. Critical participant in signaling sequences that result in fibroblast apoptosis. Plays a role in the regulation of epithelial cell survival. Required for epithelial wound healing, especially during actomyosin ring contraction during purse-string wound closure. Mediates RhoA-dependent membrane blebbing. Triggers TRPC5 channel activity in a calcium-dependent signaling, by inducing its subcellular localization at the plasma membrane. Promotes cell migration (including tumor cells) and tumor metastasis. PTK2B/PYK2 activation by phosphorylation mediates ITGB2 activation and is thus essential to trigger neutrophil transmigration during acute lung injury (ALI). May regulate optic nerve head astrocyte migration. Probably involved in mitotic cytoskeletal regulation. Regulates tight junction probably by modulating ZO-1 exchange in the perijunctional actomyosin ring. Mediates burn-induced microvascular barrier injury; triggers endothelial contraction in the development of microvascular hyperpermeability by phosphorylating MLC. Essential for intestinal barrier dysfunction. Mediates Giardia spp.-mediated reduced epithelial barrier function during giardiasis intestinal infection via reorganization of cytoskeletal F-actin and tight junctional ZO-1. Necessary for hypotonicity-induced Ca(2+) entry and subsequent activation of volume-sensitive organic osmolyte/anion channels (VSOAC) in cervical cancer cells.confidentP29294

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005516 [MF]calmodulin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0031672 [CC]A bandprobableGO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0004683 [MF]calmodulin-dependent protein kinase activityprobableGO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0007243 [BP]intracellular protein kinase cascadeprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0045859 [BP]regulation of protein kinase activityprobableGO:0042325, GO:0032268, GO:0019220, GO:0019222, GO:0050790, GO:0060255, GO:0051246, GO:0043549, GO:0031323, GO:0051338, GO:0050794, GO:0051174, GO:0065007, GO:0031399, GO:0008150, GO:0065009, GO:0001932, GO:0050789, GO:0080090
GO:0035914 [BP]skeletal muscle cell differentiationprobableGO:0030154, GO:0014706, GO:0051146, GO:0061061, GO:0007275, GO:0044699, GO:0007517, GO:0048869, GO:0007519, GO:0048513, GO:0032502, GO:0032501, GO:0009987, GO:0009888, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0071346 [BP]cellular response to interferon-gammaprobableGO:0002376, GO:0051716, GO:0034097, GO:0071345, GO:0050896, GO:0045087, GO:0009987, GO:0006950, GO:0034341, GO:0006952, GO:0071310, GO:0044763, GO:0008150, GO:0070887, GO:0006955, GO:0042221, GO:0010033, GO:0044699
GO:0051592 [BP]response to calcium ionprobableGO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0055003 [BP]cardiac myofibril assemblyprobableGO:0022607, GO:0055013, GO:0031032, GO:0030154, GO:0048468, GO:0030036, GO:0010927, GO:0014706, GO:0072358, GO:0051146, GO:0061061, GO:0009653, GO:0007275, GO:0044699, GO:0030029, GO:0048869, GO:0030239, GO:0016043, GO:0032989, GO:0048513, GO:0071840, GO:0048646, GO:0032502, GO:0055001, GO:0055002, GO:0032501, GO:0055006, GO:0055007, GO:0009987, GO:0035051, GO:0009888, GO:0044767, GO:0044763, GO:0048731, GO:0070925, GO:0006996, GO:0007507, GO:0007010, GO:0044707, GO:0048856, GO:0072359, GO:0048738, GO:0044085, GO:0060537, GO:0008150, GO:0042692
GO:0055008 [BP]cardiac muscle tissue morphogenesisprobableGO:0072359, GO:0072358, GO:0061061, GO:0009653, GO:0007275, GO:0044699, GO:0007517, GO:0048513, GO:0048729, GO:0048644, GO:0032502, GO:0009887, GO:0032501, GO:0009888, GO:0003007, GO:0008150, GO:0007507, GO:0044707, GO:0048856, GO:0014706, GO:0048738, GO:0044767, GO:0060537, GO:0048731, GO:0060415
GO:0051015 [MF]actin filament bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0018107 [BP]peptidyl-threonine phosphorylationprobableGO:0044267, GO:0006468, GO:0009987, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0018210, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0030030 [BP]cell projection organizationprobableGO:0009987, GO:0016043, GO:0008150, GO:0044699, GO:0044763, GO:0071840
GO:0001725 [CC]stress fiberprobableGO:0032432, GO:0005856, GO:0043228, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043226, GO:0044422, GO:0042641
GO:0032154 [CC]cleavage furrowprobableGO:0005575, GO:0044464, GO:0032153, GO:0032155, GO:0005623
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0044093 [BP]positive regulation of molecular functionprobableGO:0008150, GO:0065009, GO:0065007
GO:0010506 [BP]regulation of autophagyprobableGO:0009894, GO:0031329, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030335 [BP]positive regulation of cell migrationprobableGO:0051272, GO:0030334, GO:0040017, GO:0040012, GO:0008150, GO:0051270, GO:2000145, GO:2000147, GO:0048518, GO:0065007, GO:0032879, GO:0050794, GO:0050789, GO:0048522
GO:0010628 [BP]positive regulation of gene expressionprobableGO:0009893, GO:0019222, GO:0060255, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0010468, GO:0010604
GO:0051649 [BP]establishment of localization in cellprobableGO:0009987, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0019899 [MF]enzyme bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0032880 [BP]regulation of protein localizationprobableGO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0014069 [CC]postsynaptic densityprobableGO:0030425, GO:0043229, GO:0043228, GO:0044430, GO:0044327, GO:0043226, GO:0005856, GO:0044446, GO:0044309, GO:0097458, GO:0044456, GO:0043005, GO:0042995, GO:0043197, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044422, GO:0045202
GO:0005865 [CC]striated muscle thin filamentprobableGO:0036379, GO:0044446, GO:0043228, GO:0015629, GO:0043232, GO:0005856, GO:0044464, GO:0044444, GO:0005623, GO:0005737, GO:0030016, GO:0030017, GO:0043229, GO:0044430, GO:0043292, GO:0005575, GO:0044424, GO:0005622, GO:0043226, GO:0044422, GO:0044449
GO:0060298 [BP]positive regulation of sarcomere organizationprobableGO:0022603, GO:0051128, GO:0051147, GO:0050789, GO:0051495, GO:0033043, GO:0051493, GO:0060284, GO:0065007, GO:1902115, GO:0048518, GO:0051130, GO:0050793, GO:0032970, GO:0050794, GO:0051153, GO:0045595, GO:0008150, GO:0032956, GO:0010638, GO:0060297, GO:0044087, GO:0048522
GO:0030027 [CC]lamellipodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0043621 [MF]protein self-associationprobableGO:0003674, GO:0005488, GO:0005515
GO:0043195 [CC]terminal boutonprobableGO:0044306, GO:0043679, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0044456, GO:0045202, GO:0043005, GO:0033267, GO:0042995
GO:0051928 [BP]positive regulation of calcium ion transportprobableGO:0010959, GO:0051050, GO:0051049, GO:0051924, GO:0043270, GO:0065007, GO:0048518, GO:0008150, GO:0032879, GO:0050789, GO:0043269
GO:0016192 [BP]vesicle-mediated transportprobableGO:0006810, GO:0008150, GO:0051179, GO:0051234
GO:0008307 [MF]structural constituent of muscleprobableGO:0003674, GO:0005198
GO:0071476 [BP]cellular hypotonic responseprobableGO:0009628, GO:0051716, GO:0009987, GO:0050896, GO:0071470, GO:0008150, GO:0006950, GO:0006970, GO:0006971, GO:0033554, GO:0044763, GO:0071214, GO:0044699
GO:0009967 [BP]positive regulation of signal transductionprobableGO:0009966, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0048769 [BP]sarcomerogenesisprobableGO:0022607, GO:0031032, GO:0030154, GO:0048468, GO:0030036, GO:0010927, GO:0051146, GO:0061061, GO:0009653, GO:0044699, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048646, GO:0032502, GO:0055001, GO:0055002, GO:0030029, GO:0030239, GO:0009987, GO:0044767, GO:0044763, GO:0070925, GO:0006996, GO:0007010, GO:0048856, GO:0044085, GO:0008150, GO:0042692
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0060048 [BP]cardiac muscle contractionprobableGO:0032501, GO:0044707, GO:0006936, GO:0008015, GO:0006941, GO:0003012, GO:0060047, GO:0008150, GO:0003015, GO:0003013, GO:0044699, GO:0003008
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0032971 [BP]regulation of muscle filament slidingprobableGO:0051270, GO:0044057, GO:0060341, GO:0006937, GO:0051049, GO:0032386, GO:0032970, GO:0050794, GO:0065007, GO:0090257, GO:0051239, GO:0008150, GO:0032879, GO:0050789
GO:0017148 [BP]negative regulation of translationprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:2000112, GO:0031324, GO:0031323, GO:0050789, GO:0051248, GO:0010605, GO:0019222, GO:0010608, GO:0051246, GO:2000113, GO:0065007, GO:0031326, GO:0048519, GO:0010468, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0032269, GO:0032268, GO:0010556, GO:0006417, GO:0010558, GO:0048523
GO:0006917 [BP]induction of apoptosisprobableGO:0050789, GO:0043067, GO:0050794, GO:0043065, GO:0048518, GO:0012502, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0051726 [BP]regulation of cell cycleprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0008021 [CC]synaptic vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0030182 [BP]neuron differentiationprobableGO:0032502, GO:0048699, GO:0009987, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0009611 [BP]response to woundingprobableGO:0006950, GO:0008150, GO:0050896
GO:0007015 [BP]actin filament organizationprobableGO:0006996, GO:0007010, GO:0071822, GO:0030029, GO:0043933, GO:0071840, GO:0009987, GO:0030036, GO:0044763, GO:0016043, GO:0008150, GO:0044699
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0000794 [CC]condensed nuclear chromosomeprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005694, GO:0000793, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0004687 [MF]myosin light chain kinase activityprobableGO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0014866 [BP]skeletal myofibril assemblyprobableGO:0022607, GO:0031032, GO:0030154, GO:0048468, GO:0030036, GO:0010927, GO:0051146, GO:0061061, GO:0009653, GO:0044699, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048646, GO:0032502, GO:0055001, GO:0055002, GO:0030029, GO:0030239, GO:0009987, GO:0044767, GO:0044763, GO:0070925, GO:0006996, GO:0007010, GO:0048856, GO:0044085, GO:0008150, GO:0042692
GO:0090303 [BP]positive regulation of wound healingprobableGO:0080134, GO:0048584, GO:0048583, GO:0061041, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0045214 [BP]sarcomere organizationprobableGO:0022607, GO:0031032, GO:0030154, GO:0048468, GO:0030036, GO:0010927, GO:0051146, GO:0061061, GO:0009653, GO:0044699, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048646, GO:0032502, GO:0055001, GO:0055002, GO:0030029, GO:0030239, GO:0009987, GO:0044767, GO:0044763, GO:0070925, GO:0006996, GO:0007010, GO:0048856, GO:0044085, GO:0008150, GO:0042692

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UTO, chain A
Confidence level:very confident
Coverage over the Query: 44-179
View the alignment between query and template
View the model in PyMOL
Template: 4AOJ, chain A
Confidence level:very confident
Coverage over the Query: 17-127,141-178
View the alignment between query and template
View the model in PyMOL
Template: 3LPW, chain A
Confidence level:probable
Coverage over the Query: 3-60
View the alignment between query and template
View the model in PyMOL