BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy10985
(167 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3MZN|A Chain A, Crystal Structure Of Probable Glucarate Dehydratase From
Chromohalobacter Salexigens Dsm 3043
pdb|3MZN|B Chain B, Crystal Structure Of Probable Glucarate Dehydratase From
Chromohalobacter Salexigens Dsm 3043
pdb|3NFU|A Chain A, Crystal Structure Of Probable Glucarate Dehydratase From
Chromohalobacter Salexigens Dsm 3043 Complexed With
Magnesium
pdb|3NFU|B Chain B, Crystal Structure Of Probable Glucarate Dehydratase From
Chromohalobacter Salexigens Dsm 3043 Complexed With
Magnesium
Length = 450
Score = 28.1 bits (61), Expect = 2.6, Method: Compositional matrix adjust.
Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 10/66 (15%)
Query: 19 EFQTRTKLLFMIDNCADDWRIAMTWQRISQISMELAICAIHPVPGQHFFLWQTKLANKGG 78
EF+ RT L + A D++ +++ + + LA C HF+ Q +A G
Sbjct: 275 EFKKRTGLPTATNMIATDYKQLQYAVQLNSVDIPLADC--------HFWTMQGAVAV--G 324
Query: 79 ELCSRW 84
ELC+ W
Sbjct: 325 ELCNEW 330
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.333 0.140 0.472
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,652,318
Number of Sequences: 62578
Number of extensions: 151951
Number of successful extensions: 343
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 340
Number of HSP's gapped (non-prelim): 4
length of query: 167
length of database: 14,973,337
effective HSP length: 92
effective length of query: 75
effective length of database: 9,216,161
effective search space: 691212075
effective search space used: 691212075
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 48 (23.1 bits)