BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy10996
         (192 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1U5M|A Chain A, Structure Of A Chordin-Like Cysteine-Rich Repeat (Vwc
           Module) From Collagen Iia
          Length = 73

 Score = 27.3 bits (59), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 23/58 (39%), Gaps = 2/58 (3%)

Query: 123 SGCTVGNVTYQENQEWRLDACTSCVCKDRSHHCTQRICSVT--CSNPMTIPNQCCPLC 178
             C      Y +   W+ + C  CVC   +  C   IC     C +P     +CCP+C
Sbjct: 8   GSCVQDGQRYNDKDVWKPEPCRICVCDTGTVLCDDIICEDVKDCLSPEIPFGECCPIC 65


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.135    0.480 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,447,110
Number of Sequences: 62578
Number of extensions: 263486
Number of successful extensions: 533
Number of sequences better than 100.0: 44
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 37
Number of HSP's that attempted gapping in prelim test: 508
Number of HSP's gapped (non-prelim): 58
length of query: 192
length of database: 14,973,337
effective HSP length: 93
effective length of query: 99
effective length of database: 9,153,583
effective search space: 906204717
effective search space used: 906204717
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 49 (23.5 bits)