BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy11018
         (121 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2LE3|A Chain A, N-Terminal Regulatory Segment Of Carnitine
          Palmitoyltransferase 1a
          Length = 42

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 28/42 (66%)

Query: 1  MAEAHSAVAFSFRITHEGWDVNFDREVLHLVWNSGVRSWKKR 42
          MAEAH AVAF F +T +G D+    E L  ++ SG+ SWKK+
Sbjct: 1  MAEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKK 42


>pdb|4A17|W Chain W, T.Thermophila 60s Ribosomal Subunit In Complex With
          Initiation Factor 6. This File Contains 5s Rrna, 5.8s
          Rrna And Proteins Of Molecule 2.
 pdb|4A1A|W Chain W, T.Thermophila 60s Ribosomal Subunit In Complex With
          Initiation Factor 6. This File Contains 5s Rrna, 5.8s
          Rrna And Proteins Of Molecule 3.
 pdb|4A1C|W Chain W, T.Thermophila 60s Ribosomal Subunit In Complex With
          Initiation Factor 6. This File Contains 5s Rrna, 5.8s
          Rrna And Proteins Of Molecule 4.
 pdb|4A1E|W Chain W, T.Thermophila 60s Ribosomal Subunit In Complex With
          Initiation Factor 6. This File Contains 5s Rrna, 5.8s
          Rrna And Proteins Of Molecule 1
          Length = 111

 Score = 25.8 bits (55), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 20 DVNFDREVLHLVWNSGVRSWKKRL-ARF-KRLKYRTGNFSAYFSL 62
          DV  D E+   +W++G+R+  +R+  R  KR     G  S +++L
Sbjct: 47 DVRIDTELNKFIWSNGIRNIPRRVRVRLCKRKNEEEGAQSQFYTL 91


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.139    0.451 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,782,132
Number of Sequences: 62578
Number of extensions: 138620
Number of successful extensions: 251
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 250
Number of HSP's gapped (non-prelim): 3
length of query: 121
length of database: 14,973,337
effective HSP length: 83
effective length of query: 38
effective length of database: 9,779,363
effective search space: 371615794
effective search space used: 371615794
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 45 (21.9 bits)