RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy1103
         (59 letters)



>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain. 
          Length = 260

 Score = 43.0 bits (102), Expect = 1e-06
 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 9/39 (23%)

Query: 21  PNTRVGTRRYMAPEVL--DETIDTKFFDAFKMADMYSLG 57
             T VGT  YMAPEVL        K        D++SLG
Sbjct: 155 LTTFVGTPWYMAPEVLLGGNGYGPK-------VDVWSLG 186


>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases.  Protein Kinases
           (PKs), catalytic (c) domain. PKs catalyze the transfer
           of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The PK family is part of a larger
           superfamily that includes the catalytic domains of RIO
           kinases, aminoglycoside phosphotransferase, choline
           kinase, phosphoinositide 3-kinase (PI3K), and
           actin-fragmin kinase. PKs make up a large family of
           serine/threonine kinases, protein tyrosine kinases
           (PTKs), and dual-specificity PKs that phosphorylate both
           serine/threonine and tyrosine residues of target
           proteins. Majority of protein phosphorylation, about
           95%, occurs on serine residues while only 1% occurs on
           tyrosine residues. Protein phosphorylation is a
           mechanism by which a wide variety of cellular proteins,
           such as enzymes and membrane channels, are reversibly
           regulated in response to certain stimuli. PKs often
           function as components of signal transduction pathways
           in which one kinase activates a second kinase, which in
           turn, may act on other kinases; this sequential action
           transmits a signal from the cell surface to target
           proteins, which results in cellular responses. The PK
           family is one of the largest known protein families with
           more than 100 homologous yeast enzymes and 550 human
           proteins. A fraction of PK family members are
           pseudokinases that lack crucial residues for catalytic
           activity. The mutiplicity of kinases allows for specific
           regulation according to substrate, tissue distribution,
           and cellular localization. PKs regulate many cellular
           processes including proliferation, division,
           differentiation, motility, survival, metabolism,
           cell-cycle progression, cytoskeletal rearrangement,
           immunity, and neuronal functions. Many kinases are
           implicated in the development of various human diseases
           including different types of cancer.
          Length = 215

 Score = 42.6 bits (101), Expect = 1e-06
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 5/50 (10%)

Query: 8   FCVSSETSEIDIAPNTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLG 57
           F +S   +       T VGT  YMAPEVL      K + + K +D++SLG
Sbjct: 137 FGLSKLLTSDKSLLKTIVGTPAYMAPEVLLG----KGYYSEK-SDIWSLG 181


>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic
           domain.  Phosphotransferases. Serine or
           threonine-specific kinase subfamily.
          Length = 254

 Score = 39.8 bits (94), Expect = 1e-05
 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 8/37 (21%)

Query: 22  NTRVGTRRYMAPEVLDET-IDTKFFDAFKMADMYSLG 57
            T VGT  YMAPEVL                D++SLG
Sbjct: 154 TTFVGTPEYMAPEVLLGKGYGKA-------VDIWSLG 183


>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function
           prediction only / Signal transduction mechanisms /
           Transcription / DNA replication, recombination, and
           repair].
          Length = 384

 Score = 38.2 bits (87), Expect = 5e-05
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 3/51 (5%)

Query: 7   EFCVSSETSEIDIAPNTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLG 57
                  TS I   P+T VGT  YMAPEVL   +      A   +D++SLG
Sbjct: 151 LLPDPGSTSSIPALPSTSVGTPGYMAPEVL---LGLSLAYASSSSDIWSLG 198


>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like
           protein kinase 3-like Protein Serine/Threonine Kinases. 
           Serine/threonine kinases (STKs), mammalian Ste20-like
           protein kinase 3 (MST3)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MST3-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of MST3, MST4,
           STK25, Schizosaccharomyces pombe Nak1 and Sid1,
           Saccharomyces cerevisiae sporulation-specific protein 1
           (SPS1), and related proteins. Nak1 is required by
           fission yeast for polarizing the tips of actin
           cytoskeleton and is involved in cell growth, cell
           separation, cell morphology and cell-cycle progression.
           Sid1 is a component in the septation initiation network
           (SIN) signaling pathway, and plays a role in
           cytokinesis. SPS1 plays a role in regulating proteins
           required for spore wall formation. MST4 plays a role in
           mitogen-activated protein kinase (MAPK) signaling during
           cytoskeletal rearrangement, morphogenesis, and
           apoptosis. MST3 phosphorylates the STK NDR and may play
           a role in cell cycle progression and cell morphology.
           STK25 may play a role in the regulation of cell
           migration and polarization.
          Length = 274

 Score = 36.8 bits (86), Expect = 1e-04
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 8/53 (15%)

Query: 8   FCVSSETSEIDIAPNTRVGTRRYMAPEVLDETI-DTKFFDAFKMADMYSLGPT 59
           F VS + +      NT VGT  +MAPEV+ ++  D K       AD++SLG T
Sbjct: 142 FGVSGQLTSTMSKRNTFVGTPFWMAPEVIKQSGYDEK-------ADIWSLGIT 187


>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control
           protein 7-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs),  (Cdc7)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Cdc7-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this subfamily include
           Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae
           Cdc15, Arabidopsis thaliana mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK) epsilon, and
           related proteins. MAPKKKs phosphorylate and activate
           MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. Fission yeast Cdc7
           is essential for cell division by playing a key role in
           the initiation of septum formation and cytokinesis.
           Budding yeast Cdc15 functions to coordinate mitotic exit
           with cytokinesis. Arabidopsis MAPKKK epsilon is required
           for pollen development in the plasma membrane.
          Length = 254

 Score = 34.9 bits (81), Expect = 6e-04
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 8/53 (15%)

Query: 8   FCVSSETSEIDIAPNTRVGTRRYMAPEVL-DETIDTKFFDAFKMADMYSLGPT 59
           F V+++ +++     + VGT  +MAPEV+      T        +D++SLG T
Sbjct: 143 FGVATKLNDVSKDDASVVGTPYWMAPEVIEMSGASTA-------SDIWSLGCT 188


>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen-Activated Protein
           Kinase Kinase Kinase.  Serine/threonine kinases (STKs),
           mitogen-activated protein kinase (MAPK) kinase kinase
           (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MAPKKK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called
           MAP/ERK kinase kinases (MEKKs) in some cases. They
           phosphorylate and activate MAPK kinases (MAPKKs or MKKs
           or MAP2Ks), which in turn phosphorylate and activate
           MAPKs during signaling cascades that are important in
           mediating cellular responses to extracellular signals.
           This subfamily is composed of the Apoptosis
           Signal-regulating Kinases ASK1 (or MAPKKK5) and ASK2 (or
           MAPKKK6), MEKK1, MEKK2, MEKK3, MEKK4, as well as plant
           and fungal MAPKKKs. Also included in this subfamily are
           the cell division control proteins Schizosaccharomyces
           pombe Cdc7 and Saccharomyces cerevisiae Cdc15.
          Length = 260

 Score = 34.5 bits (80), Expect = 0.001
 Identities = 13/45 (28%), Positives = 19/45 (42%), Gaps = 6/45 (13%)

Query: 13  ETSEIDIAPNTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLG 57
              E      +  GT  +MAPEV+      +       AD++SLG
Sbjct: 152 GDIETGEGTGSVRGTPYWMAPEVIRGEEYGRA------ADIWSLG 190


>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases.
           Protein Kinases (PKs), STE family, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The STE family is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases (STKs), protein
           tyrosine kinases (PTKs), RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase (PI3K). This family is composed of STKs, and
           some dual-specificity PKs that phosphorylate both
           threonine and tyrosine residues of target proteins. Most
           members are kinases involved in mitogen-activated
           protein kinase (MAPK) signaling cascades, acting as MAPK
           kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK
           kinase kinase kinases (MAP4Ks). The MAPK signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAPK, which is
           phosphorylated and activated by a MAPKK, which itself is
           phosphorylated and activated by a MAPKKK. Each MAPK
           cascade is activated either by a small GTP-binding
           protein or by an adaptor protein, which transmits the
           signal either directly to a MAPKKK to start the triple
           kinase core cascade or indirectly through a mediator
           kinase, a MAP4K. Other STE family members include
           p21-activated kinases (PAKs) and class III myosins,
           among others. PAKs are Rho family GTPase-regulated
           kinases that serve as important mediators in the
           function of Cdc42 (cell division cycle 42) and Rac.
           Class III myosins are motor proteins containing an
           N-terminal kinase catalytic domain and a C-terminal
           actin-binding domain, which can phosphorylate several
           cytoskeletal proteins, conventional myosin regulatory
           light chains, as well as autophosphorylate the
           C-terminal motor domain. They play an important role in
           maintaining the structural integrity of photoreceptor
           cell microvilli.
          Length = 253

 Score = 34.1 bits (79), Expect = 0.001
 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 8/39 (20%)

Query: 20  APNTRVGTRRYMAPEVL-DETIDTKFFDAFKMADMYSLG 57
           A NT VGT  +MAPEV+  +  D K       AD++SLG
Sbjct: 153 ARNTMVGTPYWMAPEVINGKPYDYK-------ADIWSLG 184


>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III
           myosin-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs), Class III myosin-like
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           class III myosin-like subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Class III myosins are motor
           proteins with an N-terminal kinase catalytic domain and
           a C-terminal actin-binding motor domain. Class III
           myosins are present in the photoreceptors of
           invertebrates and vertebrates and in the auditory hair
           cells of mammals. The kinase domain of myosin III can
           phosphorylate several cytoskeletal proteins,
           conventional myosin regulatory light chains, and can
           autophosphorylate the C-terminal motor domain. Myosin
           III may play an important role in maintaining the
           structural integrity of photoreceptor cell microvilli.
           It may also function as a cargo carrier during
           light-dependent translocation, in photoreceptor cells,
           of proteins such as transducin and arrestin. The
           Drosophila class III myosin, called NinaC (Neither
           inactivation nor afterpotential protein C), is critical
           in normal adaptation and termination of photoresponse.
           Vertebrates contain two isoforms of class III myosin,
           IIIA and IIIB. This subfamily also includes mammalian
           NIK-like embryo-specific kinase (NESK), Traf2- and
           Nck-interacting kinase (TNIK), mitogen-activated protein
           kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or
           MAP4K4) and MAPKKKK6 (or MAP4K6). MAP4Ks are involved in
           some MAPK signaling pathways by activating a MAPK kinase
           kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is
           activated either by a small GTP-binding protein or by an
           adaptor protein, which transmits the signal either
           directly to a MAP3K to start the triple kinase core
           cascade or indirectly through a mediator kinase, a
           MAP4K. MAPK signaling cascades are important in
           mediating cellular responses to extracellular signals.
          Length = 275

 Score = 34.2 bits (79), Expect = 0.001
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 13/59 (22%)

Query: 7   EFCVSSETSEIDIAPNTRVGTRRYMAPEV------LDETIDTKFFDAFKMADMYSLGPT 59
           +F VS++        NT +GT  +MAPEV       D + D +       +D++SLG T
Sbjct: 156 DFGVSAQLDSTLGRRNTFIGTPYWMAPEVIACDEQPDASYDAR-------SDVWSLGIT 207


>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein
           Serine/Threonine Kinase, Class IIIA myosin.
           Serine/threonine kinases (STKs), class IIIA myosin
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           class III myosin subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Class III myosins are motor
           proteins containing an N-terminal kinase catalytic
           domain and a C-terminal actin-binding domain. Class III
           myosins may play an important role in maintaining the
           structural integrity of photoreceptor cell microvilli.
           In photoreceptor cells, they may also function as cargo
           carriers during light-dependent translocation of
           proteins such as transducin and arrestin. Class IIIA
           myosin is highly expressed in retina and in inner ear
           hair cells. It is localized to the distal ends of
           actin-bundled structures. Mutations in human myosin IIIA
           are responsible for progressive nonsyndromic hearing
           loss. Human myosin IIIA possesses ATPase and kinase
           activities, and the ability to move actin filaments in a
           motility assay. It may function as a cellular
           transporter capable of moving along actin bundles in
           sensory cells.
          Length = 286

 Score = 33.8 bits (77), Expect = 0.002
 Identities = 21/58 (36%), Positives = 38/58 (65%), Gaps = 5/58 (8%)

Query: 4   EVLEFCVSSETSEIDIAPNTRVGTRRYMAPEVL--DETIDTKFFDAFKMADMYSLGPT 59
           ++++F VS++ +   +  NT VGT  +MAPEV+  ++ +D+  +DA    D++SLG T
Sbjct: 164 KLVDFGVSAQLTSTRLRRNTSVGTPFWMAPEVIACEQQLDST-YDA--RCDVWSLGIT 218


>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein
           Serine/Threonine Kinase, Class IIIB myosin.
           Serine/threonine kinases (STKs), class IIIB myosin
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           class III myosin subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Class III myosins are motor
           proteins containing an N-terminal kinase catalytic
           domain and a C-terminal actin-binding domain. Class III
           myosins may play an important role in maintaining the
           structural integrity of photoreceptor cell microvilli.
           They may also function as cargo carriers during
           light-dependent translocation, in photoreceptor cells,
           of proteins such as transducin and arrestin. Class IIIB
           myosin is expressed highly in retina. It is also present
           in the brain and testis. The human class IIIB myosin
           gene maps to a region that overlaps the locus for
           Bardet-Biedl syndrome, which is characterized by
           dysmorphic extremities, retinal dystrophy, obesity, male
           hypogenitalism, and renal abnormalities.
          Length = 291

 Score = 33.4 bits (76), Expect = 0.002
 Identities = 21/58 (36%), Positives = 36/58 (62%), Gaps = 5/58 (8%)

Query: 4   EVLEFCVSSETSEIDIAPNTRVGTRRYMAPEVL--DETIDTKFFDAFKMADMYSLGPT 59
           ++++F VS++ +   +  NT VGT  +MAPEV+  ++  D   +DA    D++SLG T
Sbjct: 168 KLVDFGVSAQLTSTRLRRNTSVGTPFWMAPEVIACEQQYDYS-YDA--RCDVWSLGIT 222


>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like
           Protein Serine/Threonine Kinases.  Serine/threonine
           kinases (STKs), Nak1 subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The Nak1 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. This subfamily is composed of
           Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae
           Kic1p (kinase that interacts with Cdc31p) and related
           proteins. Nak1 (also known as N-rich kinase 1), is
           required by fission yeast for polarizing the tips of
           actin cytoskeleton and is involved in cell growth, cell
           separation, cell morphology and cell-cycle progression.
           Kic1p is required by budding yeast for cell integrity
           and morphogenesis. Kic1p interacts with Cdc31p, the
           yeast homologue of centrin, and phosphorylates
           substrates in a Cdc31p-dependent manner.
          Length = 277

 Score = 33.2 bits (76), Expect = 0.003
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 5/53 (9%)

Query: 7   EFCVSSETSEIDIAPNTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLGPT 59
           +F V++  ++     +T VGT  +MAPEV+ E    K++D    AD++SLG T
Sbjct: 144 DFGVAALLNQNSSKRSTFVGTPYWMAPEVITE---GKYYDT--KADIWSLGIT 191


>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, STK25 or Yeast
           Sps1/Ste20-related kinase 1.  Serine/threonine kinases
           (STKs), STK25 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The STK25 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. STK25 is also called Ste20/oxidant stress
           response kinase 1 (SOK1) or yeast Sps1/Ste20-related
           kinase 1 (YSK1). STK25 is localized in the Golgi
           apparatus through its interaction with the Golgi matrix
           protein GM130. It may play a role in the regulation of
           cell migration and polarization. STK25 binds and
           phosphorylates CCM3 (cerebral cavernous malformation 3),
           also called PCD10 (programmed cell death 10), and may
           play a role in apoptosis. Human STK25 is a candidate
           gene responsible for pseudopseudohypoparathyroidism
           (PPHP), a disease that shares features with the Albright
           hereditary osteodystrophy (AHO) phenotype.
          Length = 277

 Score = 33.1 bits (75), Expect = 0.003
 Identities = 22/53 (41%), Positives = 34/53 (64%), Gaps = 6/53 (11%)

Query: 7   EFCVSSETSEIDIAPNTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLGPT 59
           +F V+ + ++  I  NT VGT  +MAPEV+ ++     +D FK AD++SLG T
Sbjct: 144 DFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSA----YD-FK-ADIWSLGIT 190


>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein
           Serine/Threonine Kinases, Mammalian Ste20-like protein
           kinase 1 and 2.  Serine/threonine kinases (STKs),
           mammalian Ste20-like protein kinase 1 (MST1) and MST2
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MST1/2 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of MST1, MST2, and
           related proteins including Drosophila Hippo and
           Dictyostelium discoideum Krs1 (kinase responsive to
           stress 1). MST1/2 and Hippo are involved in a conserved
           pathway that governs cell contact inhibition, organ size
           control, and tumor development. MST1 activates the
           mitogen-activated protein kinases (MAPKs) p38 and c-Jun
           N-terminal kinase (JNK) through MKK7 (a MAPK kinase) and
           MEKK1 (a MAPK kinase kinase) by acting as a MAPK kinase
           kinase kinase (MAPKKKK). Activation of JNK by MST1 leads
           to caspase activation and apoptosis. MST1 has also been
           implicated in cell proliferation and differentiation.
           Krs1 may regulate cell growth arrest and apoptosis in
           response to cellular stress.
          Length = 256

 Score = 33.0 bits (76), Expect = 0.003
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 8/53 (15%)

Query: 8   FCVSSETSEIDIAPNTRVGTRRYMAPEVLDET-IDTKFFDAFKMADMYSLGPT 59
           F VS + ++     NT +GT  +MAPEV+ E   + K       AD++SLG T
Sbjct: 143 FGVSGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNNK-------ADIWSLGIT 188


>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mammalian Ste20-like protein
           kinase 4.  Serine/threonine kinases (STKs), mammalian
           Ste20-like protein kinase 4 (MST4) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MST4 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MST4 is sometimes
           referred to as MASK (MST3 and SOK1-related kinase). It
           plays a role in mitogen-activated protein kinase (MAPK)
           signaling during cytoskeletal rearrangement,
           morphogenesis, and apoptosis. It influences cell growth
           and transformation by modulating the extracellular
           signal-regulated kinase (ERK) pathway. MST4 may also
           play a role in tumor formation and progression. It
           localizes in the Golgi apparatus by interacting with the
           Golgi matrix protein GM130 and may play a role in cell
           migration.
          Length = 277

 Score = 33.1 bits (75), Expect = 0.003
 Identities = 21/54 (38%), Positives = 33/54 (61%), Gaps = 8/54 (14%)

Query: 7   EFCVSSETSEIDIAPNTRVGTRRYMAPEVLDETI-DTKFFDAFKMADMYSLGPT 59
           +F V+ + ++  I  NT VGT  +MAPEV+ ++  D+K       AD++SLG T
Sbjct: 144 DFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSK-------ADIWSLGIT 190


>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein
           Kinase, MAP/ERK Kinase.  Protein kinases (PKs), MAP/ERK
           kinase (MEK) subfamily, catalytic (c) domain. PKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine or tyrosine residues on protein
           substrates. The MEK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1
           and MEK2 are dual-specificity PKs that phosphorylate and
           activate the downstream targets, ERK(extracellular
           signal-regulated kinase) 1 and ERK2, on specific
           threonine and tyrosine residues. The ERK cascade starts
           with extracellular signals including growth factors,
           hormones, and neurotransmitters, which act through
           receptors and ion channels to initiate intracellular
           signaling that leads to the activation at the MAPKKK
           (Raf-1 or MOS) level, which leads to the transmission of
           signals to MEK1/2, and finally to ERK1/2. The ERK
           cascade plays an important role in cell proliferation,
           differentiation, oncogenic transformation, and cell
           cycle control, as well as in apoptosis and cell survival
           under certain conditions. This cascade has also been
           implicated in synaptic plasticity, migration,
           morphological determination, and stress response
           immunological reactions. Gain-of-function mutations in
           genes encoding ERK cascade proteins, including MEK1/2,
           cause cardiofaciocutaneous (CFC) syndrome, a condition
           leading to multiple congenital anomalies and mental
           retardation in patients.
          Length = 308

 Score = 32.8 bits (75), Expect = 0.004
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 2/30 (6%)

Query: 7   EFCVSSETSEIDIAPNTRVGTRRYMAPEVL 36
           +F VS +   ID   N+ VGTR YM+PE L
Sbjct: 143 DFGVSGQL--IDSMANSFVGTRSYMSPERL 170


>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Traf2- and Nck-interacting
           kinase.  Serine/threonine kinases (STKs), Traf2- and
           Nck-interacting kinase (TNIK) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The TNIK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Members of this
           subfamily contain an N-terminal catalytic domain and a
           C-terminal citron homology (CNH) regulatory domain,
           similar to mitogen-activated protein kinase (MAPK),
           kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks
           participate in some MAPK signaling pathways by
           activating a MAPK kinase kinase (MAPKKK or MAP3K or
           MKKK). TNIK is an effector of Rap2, a small GTP-binding
           protein from the Ras family. TNIK specifically activates
           the c-Jun N-terminal kinase (JNK) pathway and plays a
           role in regulating the actin cytoskeleton.
          Length = 272

 Score = 32.0 bits (72), Expect = 0.007
 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 5/58 (8%)

Query: 4   EVLEFCVSSETSEIDIAPNTRVGTRRYMAPEVL--DETIDTKFFDAFKMADMYSLGPT 59
           ++++F VS++        NT +GT  +MAPEV+  DE  D  +   FK +D++SLG T
Sbjct: 151 KLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATY--DFK-SDLWSLGIT 205


>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Phosphoinositide-dependent
           kinase 1.  Serine/Threonine Kinases (STKs),
           Phosphoinositide-dependent kinase 1 (PDK1) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PDK1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase (PI3K). PDK1
           carries an N-terminal catalytic domain and a C-terminal
           pleckstrin homology (PH) domain that binds
           phosphoinositides. It phosphorylates the activation loop
           of AGC kinases that are regulated by PI3K such as PKB,
           SGK, and PKC, among others, and is crucial for their
           activation. Thus, it contributes in regulating many
           processes including metabolism, growth, proliferation,
           and survival. PDK1 also has the ability to
           autophosphorylate and is constitutively active in
           mammalian cells. PDK1 is essential for normal embryo
           development and is important in regulating cell volume.
          Length = 280

 Score = 31.8 bits (73), Expect = 0.008
 Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 10/52 (19%)

Query: 10  VSSETSEIDIAPNTR----VGTRRYMAPEVLDETIDTKFFDAFKMADMYSLG 57
            ++           R    VGT  Y++PE+L+E        A K +D+++LG
Sbjct: 164 DATNIDSQIEKNRRRFASFVGTAEYVSPELLNEK------PAGKSSDLWALG 209


>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein
           Serine/Threonine Kinases, Oxidative stress response
           kinase and Ste20-related proline alanine-rich kinase.
           Serine/threonine kinases (STKs), oxidative stress
           response kinase (OSR1) and Ste20-related proline
           alanine-rich kinase (SPAK) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The OSR1 and SPAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. SPAK is also referred to as STK39 or PASK
           (proline-alanine-rich STE20-related kinase). OSR1 and
           SPAK regulate the activity of cation-chloride
           cotransporters through direct interaction and
           phosphorylation. They are also implicated in
           cytoskeletal rearrangement, cell differentiation,
           transformation and proliferation. OSR1 and SPAK contain
           a conserved C-terminal (CCT) domain, which recognizes a
           unique motif ([RK]FX[VI]) present in their activating
           kinases (WNK1/WNK4) and their substrates.
          Length = 267

 Score = 31.6 bits (72), Expect = 0.010
 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 5/38 (13%)

Query: 22  NTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLGPT 59
            T VGT  +MAPEV+++      +D FK AD++S G T
Sbjct: 164 KTFVGTPCWMAPEVMEQ---VHGYD-FK-ADIWSFGIT 196


>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), AGC (Protein Kinases A, G and C) family,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The AGC family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and Phosphoinositide 3-Kinase (PI3K). Members of
           this family include cAMP-dependent Protein Kinase (PKA),
           cGMP-dependent Protein Kinase (PKG), Protein Kinase C
           (PKC), Protein Kinase B (PKB), G protein-coupled
           Receptor Kinase (GRK), Serum- and Glucocorticoid-induced
           Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase
           (p70S6K or S6K), among others. AGC kinases share an
           activation mechanism based on the phosphorylation of up
           to three sites: the activation loop (A-loop), the
           hydrophobic motif (HM) and the turn motif.
           Phosphorylation at the A-loop is required of most AGC
           kinases, which results in a disorder-to-order transition
           of the A-loop. The ordered conformation results in the
           access of substrates and ATP to the active site. A
           subset of AGC kinases with C-terminal extensions
           containing the HM also requires phosphorylation at this
           site. Phosphorylation at the HM allows the C-terminal
           extension to form an ordered structure that packs into
           the hydrophobic pocket of the catalytic domain, which
           then reconfigures the kinase into an active bi-lobed
           state. In addition, growth factor-activated AGC kinases
           such as PKB, p70S6K, RSK, MSK, PKC, and SGK, require
           phosphorylation at the turn motif (also called tail or
           zipper site), located N-terminal to the HM at the
           C-terminal extension. AGC kinases regulate many cellular
           processes including division, growth, survival,
           metabolism, motility, and differentiation. Many are
           implicated in the development of various human diseases.
          Length = 250

 Score = 31.3 bits (72), Expect = 0.014
 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 6/36 (16%)

Query: 22  NTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLG 57
           NT  GT  Y+APEVL            K  D +SLG
Sbjct: 151 NTFCGTPEYLAPEVLLGK------GYGKAVDWWSLG 180


>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein
           Serine/Threonine Kinase, beta-adrenergic receptor
           kinase.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily,
           beta-adrenergic receptor kinase (beta-ARK) group,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The GRK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. GRKs
           phosphorylate and regulate G protein-coupled receptors
           (GPCRs), the largest superfamily of cell surface
           receptors which regulate some part of nearly all
           physiological functions. Phosphorylated GPCRs bind to
           arrestins, which prevents further G protein signaling
           despite the presence of activating ligand. There are
           seven types of GRKs, named GRK1 to GRK7. The beta-ARK
           group is composed of GRK2, GRK3, and similar proteins.
           GRK2 and GRK3 are both widely expressed in many tissues,
           although GRK2 is present at higher levels. They contain
           an N-terminal RGS homology (RH) domain, a central
           catalytic domain, and C-terminal pleckstrin homology
           (PH) domain that mediates PIP2 and G protein
           betagamma-subunit translocation to the membrane. GRK2
           (also called beta-ARK or beta-ARK1) is important in
           regulating several cardiac receptor responses. It plays
           a role in cardiac development and in hypertension.
           Deletion of GRK2 in mice results in embryonic lethality,
           caused by hypoplasia of the ventricular myocardium. GRK2
           also plays important roles in the liver (as a regulator
           of portal blood pressure), in immune cells, and in the
           nervous system. Altered GRK2 expression has been
           reported in several disorders including major
           depression, schizophrenia, bipolar disorder, and
           Parkinsonism.
          Length = 278

 Score = 31.1 bits (70), Expect = 0.014
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 5/37 (13%)

Query: 21  PNTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLG 57
           P+  VGT  YMAPEVL + +    +D+   AD +SLG
Sbjct: 152 PHASVGTHGYMAPEVLQKGVA---YDS--SADWFSLG 183


>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine
           Kinase, Cell Cycle-Related Kinase.  Serine/Threonine
           Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CCRK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CCRK was previously called p42. It is a
           Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK)
           which is essential for the activation of CDK2. It is
           indispensable for cell growth and has been implicated in
           the progression of glioblastoma multiforme. In the
           heart, a splice variant of CCRK with a different
           C-terminal half is expressed, this variant promotes
           cardiac cell growth and survival and is significantly
           down-regulated during the development of heart failure.
          Length = 286

 Score = 31.1 bits (71), Expect = 0.014
 Identities = 11/34 (32%), Positives = 15/34 (44%), Gaps = 6/34 (17%)

Query: 15  SEIDIAPNTRVGTRRYMAPEVL------DETIDT 42
            E     + +V TR Y APE+L      D  +D 
Sbjct: 151 EEEPRLYSHQVATRWYRAPELLYGARKYDPGVDL 184


>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 2.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek2 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. The Nek2
           subfamily includes Aspergillus nidulans NIMA kinase, the
           founding member of the Nek family, which was identified
           in a screen for cell cycle mutants prevented from
           entering mitosis. NIMA is essential for mitotic entry
           and progression through mitosis, and its degradation is
           essential for mitotic exit. NIMA is involved in nuclear
           membrane fission. Vertebrate Nek2 is a cell
           cycle-regulated STK, localized in centrosomes and
           kinetochores, that regulates centrosome splitting at the
           G2/M phase. It also interacts with other mitotic kinases
           such as Polo-like kinase 1 and may play a role in
           spindle checkpoint. An increase in the expression of the
           human NEK2 gene is strongly associated with the
           progression of non-Hodgkin lymphoma.
          Length = 265

 Score = 31.1 bits (71), Expect = 0.015
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 8/37 (21%)

Query: 22  NTRVGTRRYMAPEVL-DETIDTKFFDAFKMADMYSLG 57
            T VGT  YM+PE L   + D K       +D++SLG
Sbjct: 168 KTYVGTPYYMSPEQLNHMSYDEK-------SDIWSLG 197


>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of
           cAMP-dependent protein kinase-like Protein
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), Fission yeast Suppressor of loss of
           cAMP-dependent protein kinase (Sck1)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Sck1-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of fungal proteins
           with similarity to the Schizosaccharomyces pombe STK
           Sck1. Sck1 plays a role in trehalase activation
           triggered by glucose and a nitrogen source. Trehalase
           catalyzes the cleavage of the disaccharide trehalose to
           glucose. Trehalose, as a carbohydrate reserve and stress
           metabolite, plays an important role in the response of
           yeast to environmental changes.
          Length = 330

 Score = 31.1 bits (70), Expect = 0.015
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 5/51 (9%)

Query: 7   EFCVSSETSEIDIAPNTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLG 57
           +F +S      +   NT  GT  Y+APEVL   +D K +   K  D +SLG
Sbjct: 139 DFGLSKANLTDNKTTNTFCGTTEYLAPEVL---LDEKGYT--KHVDFWSLG 184


>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mammalian Ste20-like protein
           kinase 3.  Serine/threonine kinases (STKs), mammalian
           Ste20-like protein kinase 3 (MST3) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MST3 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MST3
           phosphorylates the STK NDR and may play a role in cell
           cycle progression and cell morphology. It may also
           regulate paxillin and consequently, cell migration. MST3
           is present in human placenta, where it plays an
           essential role in the oxidative stress-induced apoptosis
           of trophoblasts in normal spontaneous delivery.
           Dysregulation of trophoblast apoptosis may result in
           pregnancy complications such as preeclampsia and
           intrauterine growth retardation.
          Length = 277

 Score = 31.2 bits (70), Expect = 0.017
 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 8/57 (14%)

Query: 4   EVLEFCVSSETSEIDIAPNTRVGTRRYMAPEVLDETI-DTKFFDAFKMADMYSLGPT 59
           ++ +F V+ + ++  I  NT VGT  +MAPEV+ ++  D+K       AD++SLG T
Sbjct: 141 KLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSK-------ADIWSLGIT 190


>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity
           Protein Kinase, Mitogen-Activated Protein Kinase Kinase.
            Protein kinases (PKs), MAP kinase kinase (MAPKK)
           subfamily, catalytic (c) domain. PKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK or MAP2K), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK or
           MAP3K). MAPKKs are dual-specificity PKs that
           phosphorylate their downstream targets, MAPKs, at
           specific threonine and tyrosine residues. There are
           three MAPK subfamilies: extracellular signal-regulated
           kinase (ERK), c-Jun N-terminal kinase (JNK), and p38. In
           mammalian cells, there are seven MAPKKs (named MKK1-7)
           and 20 MAPKKKs. Each MAPK subfamily can be activated by
           at least two cognate MAPKKs and by multiple MAPKKKs.
          Length = 265

 Score = 30.7 bits (70), Expect = 0.018
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 10/52 (19%)

Query: 7   EFCVSSETSEIDIAPNTRVGTRRYMAPEVLD-ETIDTKFFDAFKMADMYSLG 57
           +F VS +   ++    T VGT  YMAPE +       K       +D++SLG
Sbjct: 144 DFGVSGQL--VNSLAKTFVGTSSYMAPERIQGNDYSVK-------SDIWSLG 186


>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine
           Kinase, Never In Mitosis gene A-related kinase.
           Serine/Threonine Kinases (STKs), Never In Mitosis gene A
           (NIMA)-related kinase (Nek) family, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. The Nek family is
           composed of 11 different mammalian members (Nek1-11)
           with similarity to the catalytic domain of Aspergillus
           nidulans NIMA kinase, the founding member of the Nek
           family which was identified in a screen for cell cycle
           mutants that were prevented from entering mitosis. Neks
           contain a conserved N-terminal catalytic domain and a
           more divergent C-terminal regulatory region of various
           sizes and structures. They are involved in the
           regulation of downstream processes following the
           activation of Cdc2, and many of their functions are cell
           cycle-related. They play critical roles in microtubule
           dynamics during ciliogenesis and mitosis.
          Length = 258

 Score = 29.8 bits (68), Expect = 0.040
 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 8/37 (21%)

Query: 22  NTRVGTRRYMAPEVL-DETIDTKFFDAFKMADMYSLG 57
            T VGT  Y++PE+  ++  + K       +D++SLG
Sbjct: 161 KTVVGTPYYLSPELCQNKPYNYK-------SDIWSLG 190


>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity
           Protein Kinases, MAP kinase kinases 3 and 6.  Protein
           kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6
           subfamily, catalytic (c) domain. PKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MKK3 and MKK6 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising the MAP kinase
           (MAPK), which is phosphorylated and activated by a MAPK
           kinase (MAPKK or MKK), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK).
           MKK3 and MKK6 are dual-specificity PKs that
           phosphorylate and activate their downstream target, p38
           MAPK, on specific threonine and tyrosine residues.
           MKK3/6 plays roles in the regulation of cell cycle
           progression, cytokine- and stress-induced apoptosis,
           oncogenic transformation, and adult tissue regeneration.
           In addition, MKK6 plays a critical role in osteoclast
           survival in inflammatory disease while MKK3 is
           associated with tumor invasion, progression, and poor
           patient survival in glioma.
          Length = 283

 Score = 30.1 bits (68), Expect = 0.040
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 18  DIAPNTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLGPT 59
            +A     G + YMAPE ++  ++ K +D    +D++SLG T
Sbjct: 157 SVAKTIDAGCKPYMAPERINPELNQKGYDV--KSDVWSLGIT 196


>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 4.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4
           (MEKK4) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK4 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK4 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates MAPK kinases (MAPKKs or
           MKKs or MAP2Ks), which in turn phosphorylate and
           activate MAPKs during signaling cascades that are
           important in mediating cellular responses to
           extracellular signals. MEKK4 activates the c-Jun
           N-terminal kinase (JNK) and p38 MAPK signaling pathways
           by directly activating their respective MAPKKs,
           MKK4/MKK7 and MKK3/MKK6. JNK and p38 are collectively
           known as stress-activated MAPKs, as they are activated
           in response to a variety of environmental stresses and
           pro-inflammatory cytokines. MEKK4 also plays roles in
           the re-polarization of the actin cytoskeleton in
           response to osmotic stress, in the proper closure of the
           neural tube, in cardiovascular development, and in
           immune responses.
          Length = 264

 Score = 29.6 bits (67), Expect = 0.048
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 3/36 (8%)

Query: 22  NTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLG 57
            +  GT  YMAPEV+          A   AD++SLG
Sbjct: 161 QSLAGTPAYMAPEVITGGKGKGHGRA---ADIWSLG 193


>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein
           Serine/Threonine Kinase, G protein-coupled Receptor
           Kinase 3.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily, GRK3
           isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The GRK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. GRKs phosphorylate and regulate G
           protein-coupled receptors (GPCRs), the largest
           superfamily of cell surface receptors which regulate
           some part of nearly all physiological functions.
           Phosphorylated GPCRs bind to arrestins, which prevents
           further G protein signaling despite the presence of
           activating ligand. There are seven types of GRKs, named
           GRK1 to GRK7. GRK3 (also known as beta-adrenergic
           receptor kinase 2) is widely expressed in many tissues.
           GRK3-deficient mice show a lack of olfactory receptor
           desensitization and altered regulation of the M2
           muscarinic airway. GRK3 is involved in modulating the
           cholinergic response of airway smooth muscles. It also
           plays a role in dopamine receptor regulation. GRK3
           promoter polymorphisms may be associated with bipolar
           disorder.
          Length = 279

 Score = 29.6 bits (66), Expect = 0.049
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 5/37 (13%)

Query: 21  PNTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLG 57
           P+  VGT  YMAPEVL +      +D+   AD +SLG
Sbjct: 152 PHASVGTHGYMAPEVLQKGTA---YDS--SADWFSLG 183


>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein
           Serine/Threonine Kinases, Mitogen-Activated Protein
           Kinase Kinase Kinase Kinase 4 and 6.  Serine/threonine
           kinases (STKs), mitogen-activated protein kinase (MAPK)
           kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6
           (or MAP4K6) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The MAP4K4/MAP4K6 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Members of this subfamily
           contain an N-terminal catalytic domain and a C-terminal
           citron homology (CNH) regulatory domain. MAP4Ks (or
           MAPKKKKs) are involved in MAPK signaling pathways that
           are important in mediating cellular responses to
           extracellular signals by activating a MAPK kinase kinase
           (MAPKKK or MAP3K or MKKK). Each MAPK cascade is
           activated either by a small GTP-binding protein or by an
           adaptor protein, which transmits the signal either
           directly to a MAP3K to start the triple kinase core
           cascade or indirectly through a mediator kinase, a
           MAP4K. MAP4K4 is also called Nck Interacting kinase
           (NIK). It facilitates the activation of the MAPKs,
           extracellular signal-regulated kinase (ERK) 1, ERK2, and
           c-Jun N-terminal kinase (JNK), by phosphorylating and
           activating MEKK1. MAP4K4 plays a role in tumor necrosis
           factor (TNF) alpha-induced insulin resistance. MAP4K4
           silencing in skeletal muscle cells from type II diabetic
           patients restores insulin-mediated glucose uptake.
           MAP4K4, through JNK, also plays a broad role in cell
           motility, which impacts inflammation, homeostasis, as
           well as the invasion and spread of cancer. MAP4K4 is
           found to be highly expressed in most tumor cell lines
           relative to normal tissue. MAP4K6 (also called MINK for
           Misshapen/NIKs-related kinase) is activated after Ras
           induction and mediates activation of p38 MAPK. MAP4K6
           plays a role in cell cycle arrest, cytoskeleton
           organization, cell adhesion, and cell motility.
          Length = 282

 Score = 29.6 bits (66), Expect = 0.057
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 5/58 (8%)

Query: 4   EVLEFCVSSETSEIDIAPNTRVGTRRYMAPEVL--DETIDTKFFDAFKMADMYSLGPT 59
           ++++F VS++        NT +GT  +MAPEV+  DE  D  +      +D++SLG T
Sbjct: 161 KLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATY---DYRSDIWSLGIT 215


>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine
           Kinase, Apoptosis signal-regulating kinase.
           Serine/threonine kinases (STKs), Apoptosis
           signal-regulating kinase (ASK) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ASK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Subfamily members
           are mitogen-activated protein kinase (MAPK) kinase
           kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1,
           ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate
           MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. ASK1 (also called
           MAPKKK5) functions in the c-Jun N-terminal kinase (JNK)
           and p38 MAPK signaling pathways by directly activating
           their respective MAPKKs, MKK4/MKK7 and MKK3/MKK6. It
           plays important roles in cytokine and stress responses,
           as well as in reactive oxygen species (ROS)-mediated
           cellular responses. ASK1 is implicated in various
           diseases mediated by oxidative stress including
           inschemic heart disease, hypertension, vessel injury,
           brain ischemia, Fanconi anemia, asthma, and pulmonary
           edema, among others. ASK2 (also called MAPKKK6)
           functions only in a heteromeric complex with ASK1, and
           can activate ASK1 by direct phosphorylation. The
           function of MAPKKK15 is still unknown.
          Length = 268

 Score = 29.4 bits (66), Expect = 0.057
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 7   EFCVSSETSEIDIAPNTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLGPT 59
           +F  S   + I+    T  GT +YMAPEV+D+    + + A   AD++SLG T
Sbjct: 152 DFGTSKRLAGINPCTETFTGTLQYMAPEVIDKGP--RGYGA--PADIWSLGCT 200


>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Yank1.  Serine/Threonine
           Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Yank1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This subfamily
           contains uncharacterized STKs with similarity to the
           human protein designated Yank1 or STK32A.
          Length = 258

 Score = 29.2 bits (66), Expect = 0.072
 Identities = 9/15 (60%), Positives = 10/15 (66%)

Query: 22  NTRVGTRRYMAPEVL 36
            +  GT  YMAPEVL
Sbjct: 157 TSTSGTPGYMAPEVL 171


>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein
           Kinase, MAP/ERK Kinase 2.  Protein kinases (PKs),
           MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MEK subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising the MAP kinase
           (MAPK), which is phosphorylated and activated by a MAPK
           kinase (MAPKK or MKK), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK).
           MEK2 is a dual-specificity PK that phosphorylates and
           activates the downstream targets, extracellular
           signal-regulated kinase (ERK) 1 and ERK2, on specific
           threonine and tyrosine residues. The ERK cascade starts
           with extracellular signals including growth factors,
           hormones, and neurotransmitters, which act through
           receptors and ion channels to initiate intracellular
           signaling that leads to the activation at the MAPKKK
           (Raf-1 or MOS) level, which leads to the transmission of
           signals to MEK2, and finally to ERK1/2. The ERK cascade
           plays an important role in cell proliferation,
           differentiation, oncogenic transformation, and cell
           cycle control, as well as in apoptosis and cell survival
           under certain conditions. Gain-of-function mutations in
           genes encoding  ERK cascade proteins, including MEK2,
           cause cardiofaciocutaneous (CFC) syndrome, a condition
           leading to multiple congenital anomalies and mental
           retardation in patients.
          Length = 331

 Score = 29.2 bits (65), Expect = 0.080
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 4   EVLEFCVSSETSEIDIAPNTRVGTRRYMAPEVLDET 39
           ++ +F VS +   ID   N+ VGTR YM+PE L  T
Sbjct: 144 KLCDFGVSGQL--IDSMANSFVGTRSYMSPERLQGT 177


>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein
           Serine/Threonine Kinases, Never In Mitosis gene
           A-related kinase 6 and 7.  Serine/Threonine Kinases
           (STKs), Never In Mitosis gene A (NIMA)-related kinase 6
           (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The Nek6/7 subfamily is part of a family of 11 different
           Neks (Nek1-11) that are involved in cell cycle control.
           The Nek family is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Nek6 and Nek7 are the shortest Neks,
           consisting only of the catalytic domain and a very short
           N-terminal extension. They show distinct expression
           patterns and both appear to be downstream substrates of
           Nek9. They are required for mitotic spindle formation
           and cytokinesis. They may also be regulators of the p70
           ribosomal S6 kinase.
          Length = 267

 Score = 28.9 bits (65), Expect = 0.085
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 10/47 (21%)

Query: 11  SSETSEIDIAPNTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLG 57
           SS+T     A ++ VGT  YM+PE + E      ++ FK +D++SLG
Sbjct: 157 SSKT----TAAHSLVGTPYYMSPERIHEN----GYN-FK-SDIWSLG 193


>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein
           Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1. 
           Serine/threonine kinases (STKs), plant MAP/ERK kinase
           kinase 1 (MEKK1)-like subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The plant MEKK1 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein STKs, protein tyrosine kinases, RIO
           kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This subfamily is
           composed of plant mitogen-activated protein kinase
           (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks)
           including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1
           is a MAPKKK that phosphorylates and activates MAPK
           kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. Arabidopsis thaliana
           MEKK1 activates MPK4, a MAPK that regulates systemic
           acquired resistance. MEKK1 also participates in the
           regulation of temperature-sensitive and tissue-specific
           cell death.
          Length = 258

 Score = 28.9 bits (65), Expect = 0.091
 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 5/35 (14%)

Query: 25  VGTRRYMAPEVLDETIDTKFFDAFKMADMYSLGPT 59
            G+  +MAPEV+ +            AD++SLG T
Sbjct: 162 KGSPYWMAPEVIAQQGGYGL-----AADIWSLGCT 191


>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein
           Serine/Threonine Kinase, cGMP-dependent protein kinase. 
           Serine/Threonine Kinases (STKs), cGMP-dependent protein
           kinase (cGK or PKG) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The cGK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Mammals have two cGK isoforms
           from different genes, cGKI and cGKII. cGKI exists as two
           splice variants, cGKI-alpha and cGKI-beta. cGK consists
           of an N-terminal regulatory domain containing a
           dimerization and an autoinhibitory pseudosubstrate
           region, two cGMP-binding domains, and a C-terminal
           catalytic domain. Binding of cGMP to both binding sites
           releases the inhibition of the catalytic center by the
           pseudosubstrate region, allowing autophosphorylation and
           activation of the kinase. cGKI is a  soluble protein
           expressed in all smooth muscles, platelets, cerebellum,
           and kidney. It is also expressed at lower concentrations
           in other tissues. cGKII is a membrane-bound protein that
           is most abundantly expressed in the intestine. It is
           also present in the brain nuclei, adrenal cortex,
           kidney, lung, and prostate. cGKI is involved in the
           regulation of smooth muscle tone, smooth cell
           proliferation, and platelet activation. cGKII plays a
           role in the regulation of secretion, such as renin
           secretion by the kidney and aldosterone secretion by the
           adrenal. It also regulates bone growth and the circadian
           rhythm.
          Length = 262

 Score = 28.7 bits (65), Expect = 0.098
 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 6/35 (17%)

Query: 23  TRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLG 57
           T  GT  Y+APE+    I  K +D     D +SLG
Sbjct: 151 TFCGTPEYVAPEI----ILNKGYDFS--VDYWSLG 179


>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like
           Protein Serine/Threonine Kinases.  Serine/threonine
           kinases (STKs), Ste20-like kinase (SLK)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The SLK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of the subfamily include SLK, STK10
           (also called LOK for lymphocyte-oriented kinase), SmSLK
           (Schistosoma mansoni SLK), and related proteins. SLK
           promotes apoptosis through apoptosis signal-regulating
           kinase 1 (ASK1) and the mitogen-activated protein kinase
           (MAPK) p38. It also plays a role in mediating actin
           reorganization. STK10 is responsible in regulating the
           CD28 responsive element in T cells, as well as leukocyte
           function associated antigen (LFA-1)-mediated lymphocyte
           adhesion. SmSLK is capable of activating the MAPK Jun
           N-terminal kinase (JNK) pathway in human embryonic
           kidney (HEK) cells as well as in Xenopus oocytes. It may
           participate in regulating MAPK cascades during
           host-parasite interactions.
          Length = 280

 Score = 28.6 bits (64), Expect = 0.11
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 7   EFCVSSETSEIDIAPNTRVGTRRYMAPEVLD-ETIDTKFFDAFKMADMYSLGPT 59
           +F VS++        +T +GT  +MAPEV+  ET     +D    AD++SLG T
Sbjct: 146 DFGVSAKNKSTLQKRDTFIGTPYWMAPEVVACETFKDNPYDY--KADIWSLGIT 197


>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like
           Protein Serine/Threonine Kinases.  Serine/Threonine
           Kinases (STKs), Microtubule-associated serine/threonine
           (MAST) kinase subfamily, fungal Rim15-like kinases,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAST kinase
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this group include Saccharomyces
           cerevisiae Rim15, Schizosaccharomyces pombe cek1, and
           similar fungal proteins. They contain a central
           catalytic domain, which contains an insert relative to
           MAST kinases. In addition, Rim15 contains a C-terminal
           signal receiver (REC) domain while cek1 contains an
           N-terminal PAS domain. Rim15 (or Rim15p) functions as a
           regulator of meiosis. It acts as a downstream effector
           of PKA and regulates entry into stationary phase (G0).
           Thus, it plays a crucial role in regulating yeast
           proliferation, differentiation, and aging. Cek1 may
           facilitate progression of mitotic anaphase.
          Length = 260

 Score = 28.6 bits (64), Expect = 0.11
 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 6/43 (13%)

Query: 15  SEIDIAPNTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLG 57
           S   +     VGT  Y+APE +    D       KM+D +SLG
Sbjct: 144 SRNGLENKKFVGTPDYLAPETILGVGDD------KMSDWWSLG 180


>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine
           Kinase, G protein-coupled Receptor Kinase.
           Serine/Threonine Kinases (STKs), G protein-coupled
           Receptor Kinase (GRK) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The GRK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. GRKs phosphorylate and
           regulate G protein-coupled receptors (GPCRs), the
           largest superfamily of cell surface receptors, which
           regulate some part of nearly all physiological
           functions. Phosphorylated GPCRs bind to arrestins, which
           prevents further G protein signaling despite the
           presence of activating ligand. GRKs contain a central
           catalytic domain, flanked by N- and C-terminal
           extensions. The N-terminus contains an RGS (regulator of
           G protein signaling) homology (RH) domain and several
           motifs. The C-terminus diverges among different groups
           of GRKs. There are seven types of GRKs, named GRK1 to
           GRK7. They are subdivided into three main groups: visual
           (GRK1/7); beta-adrenergic receptor kinases (GRK2/3); and
           GRK4-like (GRK4/5/6). Expression of GRK2/3/5/6 is
           widespread while GRK1/4/7 show a limited tissue
           distribution. The substrate spectrum of the widely
           expressed GRKs partially overlaps. GRKs play important
           roles in the cardiovascular, immune, respiratory,
           skeletal, and nervous systems.
          Length = 277

 Score = 28.6 bits (64), Expect = 0.13
 Identities = 12/30 (40%), Positives = 14/30 (46%)

Query: 21  PNTRVGTRRYMAPEVLDETIDTKFFDAFKM 50
              R GT  YMAPEVL   +     D F +
Sbjct: 151 IKGRAGTPGYMAPEVLQGEVYDFSVDWFAL 180


>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein
           Kinase, MAP/ERK Kinase 1.  Protein kinases (PKs),
           MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MEK subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising the MAP kinase
           (MAPK), which is phosphorylated and activated by a MAPK
           kinase (MAPKK or MKK), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK).
           MEK1 is a dual-specificity PK that phosphorylates and
           activates the downstream targets, extracellular
           signal-regulated kinase (ERK) 1 and ERK2, on specific
           threonine and tyrosine residues. The ERK cascade starts
           with extracellular signals including growth factors,
           hormones, and neurotransmitters, which act through
           receptors and ion channels to initiate intracellular
           signaling that leads to the activation at the MAPKKK
           (Raf-1 or MOS) level, which leads to the transmission of
           signals to MEK1, and finally to ERK1/2. The ERK cascade
           plays an important role in cell proliferation,
           differentiation, oncogenic transformation, and cell
           cycle control, as well as in apoptosis and cell survival
           under certain conditions. Gain-of-function mutations in
           genes encoding ERK cascade proteins, including MEK1,
           cause cardiofaciocutaneous (CFC) syndrome, a condition
           leading to multiple congenital anomalies and mental
           retardation in patients. MEK1 also plays a role in cell
           cycle control.
          Length = 333

 Score = 28.5 bits (63), Expect = 0.13
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 4   EVLEFCVSSETSEIDIAPNTRVGTRRYMAPEVLDET 39
           ++ +F VS +   ID   N+ VGTR YM+PE L  T
Sbjct: 144 KLCDFGVSGQL--IDSMANSFVGTRSYMSPERLQGT 177


>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase;
           Provisional.
          Length = 353

 Score = 28.3 bits (63), Expect = 0.19
 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 22  NTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLG 57
           N+ VGT  YM+PE ++  ++   +D +   D++SLG
Sbjct: 226 NSSVGTIAYMSPERINTDLNHGAYDGYA-GDIWSLG 260


>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein
           Kinase, MAP kinase kinase 4.  Protein kinases (PKs), MAP
           kinase kinase 4 (MKK4) subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MKK4 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising of the MAP
           kinase (MAPK), which is phosphorylated and activated by
           a MAPK kinase (MAPKK or MKK), which itself is
           phosphorylated and activated by a MAPK kinase kinase
           (MAPKKK or MKKK). MKK4 is a dual-specificity PK that
           phosphorylates and activates the downstream targets,
           c-Jun N-terminal kinase (JNK) and p38 MAPK, on specific
           threonine and tyrosine residues. JNK and p38 are
           collectively known as stress-activated MAPKs, as they
           are activated in response to a variety of environmental
           stresses and pro-inflammatory cytokines. Their
           activation is associated with the induction of cell
           death. Mice deficient in MKK4 die during embryogenesis
           and display anemia, severe liver hemorrhage, and
           abnormal hepatogenesis. MKK4 may also play roles in the
           immune system and in cardiac hypertrophy. It plays a
           major role in cancer as a tumor and metastasis
           suppressor. Under certain conditions, MKK4 is
           pro-oncogenic.
          Length = 288

 Score = 27.7 bits (62), Expect = 0.21
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 5/42 (11%)

Query: 19  IAPNTRVGTRRYMAPEVLDETIDTKFFDAFKM-ADMYSLGPT 59
           IA     G R YMAP    E ID    D + + +D++SLG T
Sbjct: 162 IAKTRDAGCRPYMAP----ERIDPSARDGYDVRSDVWSLGIT 199


>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein
           Serine/Threonine Kinase, G protein-coupled Receptor
           Kinase 7.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily, GRK7
           isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The GRK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. GRKs phosphorylate and regulate G
           protein-coupled receptors (GPCRs), the largest
           superfamily of cell surface receptors, which regulate
           some part of nearly all physiological functions.
           Phosphorylated GPCRs bind to arrestins, which prevents
           further G protein signaling despite the presence of
           activating ligand. There are seven types of GRKs, named
           GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs
           to the visual group of GRKs. It is primarily found in
           the retina and plays a role in the regulation of opsin
           light receptors. GRK7 is located in retinal cone outer
           segments and plays an important role in regulating
           photoresponse of the cones.
          Length = 277

 Score = 27.6 bits (61), Expect = 0.26
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 24  RVGTRRYMAPEVLDETIDTKFFDAFKM 50
           R GT  YMAPE+L E   +   D F M
Sbjct: 154 RAGTNGYMAPEILKEEPYSYPVDWFAM 180


>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein
           Serine/Threonine Kinase, 70 kDa ribosomal protein S6
           kinase.  Serine/Threonine Kinases (STKs), 70 kDa
           ribosomal protein S6 kinase (p70S6K) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The p70S6K subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. p70S6K (or S6K)
           contains only one catalytic kinase domain, unlike p90
           ribosomal S6 kinases (RSKs). It acts as a downstream
           effector of the STK mTOR (mammalian Target of Rapamycin)
           and plays a role in the regulation of the translation
           machinery during protein synthesis. p70S6K also plays a
           pivotal role in regulating cell size and glucose
           homeostasis. Its targets include S6, the translation
           initiation factor eIF3, and the insulin receptor
           substrate IRS-1, among others. Mammals contain two
           isoforms of p70S6K, named S6K1 and S6K2 (or S6K-beta).
          Length = 323

 Score = 27.8 bits (62), Expect = 0.26
 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 4/56 (7%)

Query: 7   EFCVSSETSEIDIAPNTRVGTRRYMAPEVLDETIDTKFFDAFK----MADMYSLGP 58
           +F +  E+       +T  GT  YMAPE+L  +   K  D +     M DM +  P
Sbjct: 143 DFGLCKESIHEGTVTHTFCGTIEYMAPEILMRSGHGKAVDWWSLGALMYDMLTGAP 198


>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR
           kinase-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Rho-associated
           coiled-coil containing protein kinase (ROCK) and Nuclear
           Dbf2-Related (NDR)-like kinase subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ROCK- and NDR-like
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this subfamily include ROCK and
           ROCK-like proteins such as DMPK, MRCK, and CRIK, as well
           as NDR and NDR-like proteins such as LATS, CBK1 and
           Sid2p. ROCK and CRIK are effectors of the small GTPase
           Rho, while MRCK is an effector of the small GTPase
           Cdc42. NDR and NDR-like kinases contain an N-terminal
           regulatory (NTR) domain and an insert within the
           catalytic domain that contains an auto-inhibitory
           sequence. Proteins in this subfamily are involved in
           regulating many cellular functions including
           contraction, motility, division, proliferation,
           apoptosis, morphogenesis, and cytokinesis.
          Length = 350

 Score = 27.6 bits (62), Expect = 0.27
 Identities = 10/15 (66%), Positives = 12/15 (80%)

Query: 22  NTRVGTRRYMAPEVL 36
           N+ VGT  Y+APEVL
Sbjct: 188 NSTVGTPDYIAPEVL 202


>gnl|CDD|133408 cd04781, HTH_MerR-like_sg6, Helix-Turn-Helix DNA binding domain
          of putative transcription regulators from the MerR
          superfamily.  Putative helix-turn-helix (HTH) MerR-like
          transcription regulators (subgroup 6) with at least two
          conserved cysteines present in the C-terminal portion
          of the protein. Based on sequence similarity, these
          proteins are predicted to function as transcription
          regulators that mediate responses to stress in
          eubacteria. They belong to the MerR superfamily of
          transcription regulators that promote transcription of
          various stress regulons by reconfiguring the operator
          sequence located between the -35 and -10 promoter
          elements. A typical MerR regulator is comprised of two
          distinct domains that harbor the regulatory
          (effector-binding) site and the active (DNA-binding)
          site. Their N-terminal domains are homologous and
          contain a DNA-binding winged HTH motif, while the
          C-terminal domains are often dissimilar and bind
          specific coactivator molecules such as metal ions,
          drugs, and organic substrates.
          Length = 120

 Score = 27.2 bits (61), Expect = 0.30
 Identities = 10/19 (52%), Positives = 11/19 (57%)

Query: 19 IAPNTRVGTRRYMAPEVLD 37
          IA   R G RR   P+VLD
Sbjct: 26 IASIGRRGLRRQYDPQVLD 44


>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine
           Kinase, Thousand-and-one amino acids proteins.
           Serine/threonine kinases (STKs), thousand-and-one amino
           acids (TAO) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The TAO subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. TAO proteins possess mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
           activity. They activate the MAPKs, p38 and c-Jun
           N-terminal kinase (JNK), by phosphorylating and
           activating the respective MAP/ERK kinases (MEKs, also
           known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK
           signaling cascades are important in mediating cellular
           responses to extracellular signals. Vertebrates contain
           three TAO subfamily members, named TAO1, TAO2, and TAO3.
          Length = 307

 Score = 27.5 bits (61), Expect = 0.33
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 3/38 (7%)

Query: 22  NTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLGPT 59
           N+ VGT  +MAPEV+   +D   +D     D++SLG T
Sbjct: 169 NSFVGTPYWMAPEVI-LAMDEGQYDG--KVDVWSLGIT 203


>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Serum- and
           Glucocorticoid-induced Kinase 1.  Serine/Threonine
           Kinases (STKs), Serum- and Glucocorticoid-induced Kinase
           (SGK) subfamily, SGK1 isoform, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The SGK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. There are three isoforms of
           SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously
           expressed and is under transcriptional control of
           numerous stimuli including cell stress (cell shrinkage),
           serum, hormones (gluco- and mineralocorticoids),
           gonadotropins, growth factors, interleukin-6, and other
           cytokines. It plays roles in sodium retention and
           potassium elimination in the kidney, nutrient transport,
           salt sensitivity, memory consolidation, and cardiac
           repolarization. A common SGK1 variant is associated with
           increased blood pressure and body weight. SGK1 may also
           contribute to tumor growth, neurodegeneration, fibrosing
           disease, and ischemia.
          Length = 325

 Score = 27.3 bits (60), Expect = 0.39
 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 5/57 (8%)

Query: 7   EFCVSSETSEIDIAPNTRVGTRRYMAPEVL-----DETIDTKFFDAFKMADMYSLGP 58
           +F +  E  E +   +T  GT  Y+APEVL     D T+D     A     +Y L P
Sbjct: 139 DFGLCKENIEHNGTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPP 195


>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Serum- and
           Glucocorticoid-induced Kinase 2.  Serine/Threonine
           Kinases (STKs), Serum- and Glucocorticoid-induced Kinase
           (SGK) subfamily, SGK2 isoform, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The SGK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. There are three isoforms of
           SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more
           restricted distribution that SGK1 and is most abundantly
           expressed in epithelial tissues including kidney, liver,
           pancreas, and the choroid plexus of the brain. In vitro
           cellular assays show that SGK2 can stimulate the
           activity of ion channels, the glutamate transporter
           EEAT4, and the glutamate receptors, GluR6 and GLUR1.
          Length = 321

 Score = 27.2 bits (60), Expect = 0.39
 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 5/57 (8%)

Query: 7   EFCVSSETSEIDIAPNTRVGTRRYMAPEVL-----DETIDTKFFDAFKMADMYSLGP 58
           +F +  E  E +   +T  GT  Y+APEVL     D T+D     A     +Y L P
Sbjct: 139 DFGLCKEGVEPEETTSTFCGTPEYLAPEVLRKEPYDRTVDWWCLGAVLYEMLYGLPP 195


>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like
           dual-specificity MAP kinase kinases.  Protein kinases
           (PKs), MAP kinase kinase (MAPKK) subfamily, fungal
           Byr1-like proteins, catalytic (c) domain. PKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK).
           Members of this group include the MAPKKs Byr1 from
           Schizosaccharomyces pombe, FUZ7 from Ustilago maydis,
           and related proteins. Byr1 phosphorylates its downstream
           target, the MAPK Spk1, and is regulated by the MAPKKK
           Byr2. The Spk1 cascade is pheromone-responsive and is
           essential for sporulation and sexual differentiation in
           fission yeast. FUZ7 phosphorylates and activates its
           target, the MAPK Crk1, which is required in mating and
           virulence in U. maydis.
          Length = 284

 Score = 27.1 bits (60), Expect = 0.40
 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 2/28 (7%)

Query: 7   EFCVSSETSEIDIAPNTRVGTRRYMAPE 34
           +F VS E   I+   +T VGT  YM+PE
Sbjct: 147 DFGVSGEL--INSIADTFVGTSTYMSPE 172


>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled
           Receptor Kinase 4-like Protein Serine/Threonine Kinases.
            Serine/Threonine Kinases (STKs), G protein-coupled
           Receptor Kinase (GRK) subfamily, GRK4-like group,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The GRK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. GRKs
           phosphorylate and regulate G protein-coupled receptors
           (GPCRs), the largest superfamily of cell surface
           receptors which regulate some part of nearly all
           physiological functions. Phosphorylated GPCRs bind to
           arrestins, which prevents further G protein signaling
           despite the presence of activating ligand. There are
           seven types of GRKs, named GRK1 to GRK7. Members of the
           GRK4-like group include GRK4, GRK5, GRK6, and similar
           GRKs. GRKs in this group contain an N-terminal RGS
           homology (RH) domain and a catalytic domain, but lack a
           G protein betagamma-subunit binding domain. They are
           localized to the plasma membrane through
           post-translational lipid modification or direct binding
           to PIP2.
          Length = 285

 Score = 27.1 bits (60), Expect = 0.42
 Identities = 10/13 (76%), Positives = 11/13 (84%)

Query: 24  RVGTRRYMAPEVL 36
           RVGT  YMAPEV+
Sbjct: 161 RVGTVGYMAPEVV 173


>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine
           Kinase, p21-activated kinase.  Serine/threonine kinases
           (STKs), p21-activated kinase (PAK) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PAK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PAKs are Rho
           family GTPase-regulated kinases that serve as important
           mediators in the function of Cdc42 (cell division cycle
           42) and Rac. PAKs are implicated in the regulation of
           many cellular processes including growth factor
           receptor-mediated proliferation, cell polarity, cell
           motility, cell death and survival, and actin
           cytoskeleton organization. PAK deregulation is
           associated with tumor development. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group I PAKs contain a PBD (p21-binding domain)
           overlapping with an AID (autoinhibitory domain), a
           C-terminal catalytic domain, SH3 binding sites and a
           non-classical SH3 binding site for PIX (PAK-interacting
           exchange factor). Group II PAKs contain a PBD and a
           catalytic domain, but lack other motifs found in group I
           PAKs. Since group II PAKs do not contain an obvious AID,
           they may be regulated differently from group I PAKs.
           Group I PAKs interact with the SH3 containing proteins
           Nck, Grb2 and PIX; no such binding has been demonstrated
           for group II PAKs.
          Length = 286

 Score = 27.2 bits (61), Expect = 0.43
 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 8/37 (21%)

Query: 22  NTRVGTRRYMAPEV-LDETIDTKFFDAFKMADMYSLG 57
           N+ VGT  +MAPEV   +    K        D++SLG
Sbjct: 174 NSVVGTPYWMAPEVIKRKDYGPK-------VDIWSLG 203


>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine
           Kinase, Ste20-like kinase.  Serine/threonine kinases
           (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The SLK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. SLK promotes
           apoptosis through apoptosis signal-regulating kinase 1
           (ASK1) and the mitogen-activated protein kinase (MAPK)
           p38. It acts as a MAPK kinase kinase (MAPKKK) by
           phosphorylating ASK1, resulting in the phosphorylation
           of p38. SLK also plays a role in mediating actin
           reorganization. It is part of a microtubule-associated
           complex that is targeted at adhesion sites, and is
           required in focal adhesion turnover and in regulating
           cell migration.
          Length = 282

 Score = 26.9 bits (59), Expect = 0.44
 Identities = 20/54 (37%), Positives = 34/54 (62%), Gaps = 3/54 (5%)

Query: 7   EFCVSSETSEIDIAPNTRVGTRRYMAPE-VLDETIDTKFFDAFKMADMYSLGPT 59
           +F VS++ +      ++ +GT  +MAPE V+ ET   + +D +K AD++SLG T
Sbjct: 146 DFGVSAKNTRTIQRRDSFIGTPYWMAPEVVMCETSKDRPYD-YK-ADVWSLGIT 197


>gnl|CDD|188169 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reductase.  This model
           represent acetoacetyl-CoA reductase, a member of the
           family short-chain-alcohol dehydrogenases. Note that,
           despite the precision implied by the enzyme name, the
           reaction of EC 1.1.1.36 is defined more generally as
           (R)-3-hydroxyacyl-CoA + NADP+ = 3-oxoacyl-CoA + NADPH.
           Members of this family may act in the biosynthesis of
           poly-beta-hydroxybutyrate (e.g. Rhizobium meliloti) and
           related poly-beta-hydroxyalkanoates. Note that the
           member of this family from Azospirillum brasilense,
           designated NodG, appears to lack acetoacetyl-CoA
           reductase activity and to act instead in the production
           of nodulation factor. This family is downgraded to
           subfamily for this NodG. Other proteins designated NodG,
           as from Rhizobium, belong to related but distinct
           protein families.
          Length = 242

 Score = 26.6 bits (59), Expect = 0.55
 Identities = 14/45 (31%), Positives = 18/45 (40%), Gaps = 4/45 (8%)

Query: 10  VSSETSEIDIAPN----TRVGTRRYMAPEVLDETIDTKFFDAFKM 50
           V +E   ID+  N    TR  T + M  E     IDT     F +
Sbjct: 72  VEAELGPIDVLVNNAGITRDATFKKMTYEQWSAVIDTNLNSVFNV 116


>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein
           Serine/Threonine Kinase, STK10 or Lymphocyte-oriented
           kinase.  Serine/threonine kinases (STKs), STK10
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           STK10 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Other names for STK10 include
           lymphocyte-oriented kinase (LOK) and Xenopus polo-like
           kinase kinase 1 (xPlkk1). STK10 is highly expressed in
           lymphocytes and is responsible in regulating leukocyte
           function associated antigen (LFA-1)-mediated lymphocyte
           adhesion. It plays a role in regulating the CD28
           responsive element in T cells, and may also function as
           a regulator of polo-like kinase 1 (Plk1), a protein
           which is overexpressed in multiple tumor types.
          Length = 292

 Score = 26.5 bits (58), Expect = 0.63
 Identities = 20/54 (37%), Positives = 34/54 (62%), Gaps = 3/54 (5%)

Query: 7   EFCVSSETSEIDIAPNTRVGTRRYMAPE-VLDETIDTKFFDAFKMADMYSLGPT 59
           +F VS++  +     ++ +GT  +MAPE V+ ET+    +D +K AD++SLG T
Sbjct: 153 DFGVSAKNVKTLQRRDSFIGTPYWMAPEVVMCETMKDTPYD-YK-ADIWSLGIT 204


>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein
           Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2,
            and similar domains.  Serine/Threonine Kinases (STKs),
           Chlamydomonas reinhardtii Never In Mitosis gene A
           (NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Chlamydomonas
           reinhardtii CNK2-like subfamily belongs to the
           (NIMA)-related kinase (Nek) family. The Nek family
           includes seven different Chlamydomonas Neks (CNKs 1-6
           and Fa2). This subfamily includes CNK1, and -2.  The Nek
           family is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase.  Chlamydomonas reinhardtii CNK2 has both
           cilliary and cell cycle functions. It influences
           flagellar length through promoting flagellar
           disassembly, and it regulates cell size, through
           influencing the size threshold at which cells commit to
           mitosis.
          Length = 256

 Score = 26.6 bits (59), Expect = 0.65
 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 8/37 (21%)

Query: 22  NTRVGTRRYMAPEVL-DETIDTKFFDAFKMADMYSLG 57
            T++GT  YMAPEV        K       +D++SLG
Sbjct: 159 KTQIGTPHYMAPEVWKGRPYSYK-------SDIWSLG 188


>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated
           protein kinase kinase kinase kinase-like Protein
           Serine/Threonine Kinases.  Serine/threonine kinases
           (STKs), mitogen-activated protein kinase (MAPK) kinase
           kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAP4K3-like
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily includes MAP4K3, MAP4K1,
           MAP4K2, MAP4K5, and related proteins. Vertebrate members
           contain an N-terminal catalytic domain and a C-terminal
           citron homology (CNH) regulatory domain, similar to
           MAP4K4/6. MAP4Ks are involved in some MAPK signaling
           pathways that are important in mediating cellular
           responses to extracellular signals by activating a MAPK
           kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK
           cascade is activated either by a small GTP-binding
           protein or by an adaptor protein, which transmits the
           signal either directly to a MAP3K to start the triple
           kinase core cascade or indirectly through a mediator
           kinase, a MAP4K. MAP4K1, also called haematopoietic
           progenitor kinase 1 (HPK1), is a hematopoietic-specific
           STK involved in many cellular signaling cascades
           including MAPK, antigen receptor, apoptosis, growth
           factor, and cytokine signaling. It participates in the
           regulation of T cell receptor signaling and T
           cell-mediated immune responses. MAP4K2 was referred to
           as germinal center (GC) kinase because of its preferred
           location in GC B cells. MAP4K3 plays a role in the
           nutrient-responsive pathway of mTOR (mammalian target of
           rapamycin) signaling. It is required in the activation
           of S6 kinase by amino acids and for the phosphorylation
           of the mTOR-regulated inhibitor of eukaryotic initiation
           factor 4E. MAP4K5, also called germinal center
           kinase-related enzyme (GCKR), has been shown to activate
           the MAPK c-Jun N-terminal kinase (JNK).
          Length = 262

 Score = 26.5 bits (59), Expect = 0.66
 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 11/57 (19%)

Query: 7   EFCVSSETSEIDIAPNTRVGTRRYMAPEVLDETI----DTKFFDAFKMADMYSLGPT 59
           +F VS++ +       + +GT  +MAPEV         D K        D+++LG T
Sbjct: 144 DFGVSAQLTATIAKRKSFIGTPYWMAPEVAAVERKGGYDGK-------CDIWALGIT 193


>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and
           Dbf2p-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), ROCK- and NDR-like
           subfamily, fungal Sid2p- and Dbf2p-like proteins,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Sid2p- and
           Dbf2p-like group is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This group contains fungal kinases including
           Schizosaccharomyces pombe Sid2p and Saccharomyces
           cerevisiae Dbf2p. Group members show similarity to NDR
           kinases in that they contain an N-terminal regulatory
           (NTR) domain and an insert within the catalytic domain
           that contains an auto-inhibitory sequence. Sid2p plays a
           crucial role in the septum initiation network (SIN) and
           in the initiation of cytokinesis. Dbf2p is important in
           regulating the mitotic exit network (MEN) and in
           cytokinesis.
          Length = 333

 Score = 26.6 bits (59), Expect = 0.72
 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 8/40 (20%)

Query: 7   EFCVSSETSEIDIAPNTRVGTRRYMAPEVL-----DETID 41
           +F +S     +  A N+ VG+  YMAPEVL     D T+D
Sbjct: 144 DFGLSKGI--VTYA-NSVVGSPDYMAPEVLRGKGYDFTVD 180


>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal
           Byr2-like MAP Kinase Kinase Kinases.  Serine/threonine
           kinases (STKs), mitogen-activated protein kinase (MAPK)
           kinase kinase (MAPKKK) subfamily, fungal Byr2-like
           proteins, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MAPKKK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this group include the MAPKKKs
           Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae
           and Cryptococcus neoformans Ste11, and related proteins.
           They contain an N-terminal SAM (sterile alpha-motif)
           domain, which mediates protein-protein interaction, and
           a C-terminal catalytic domain. MAPKKKs phosphorylate and
           activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which
           in turn phosphorylate and activate MAPKs during
           signaling cascades that are important in mediating
           cellular responses to extracellular signals. Fission
           yeast Byr2 is regulated by Ras1. It responds to
           pheromone signaling and controls mating through the MAPK
           pathway. Budding yeast Ste11 functions in MAPK cascades
           that regulate mating, high osmolarity glycerol, and
           filamentous growth responses.
          Length = 267

 Score = 26.3 bits (58), Expect = 0.81
 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 6/32 (18%)

Query: 26  GTRRYMAPEVLDETIDTKFFDAFKMADMYSLG 57
           G+  +MAPEV+ +T  T      + AD++SLG
Sbjct: 174 GSVFWMAPEVVKQTSYT------RKADIWSLG 199


>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein
           Serine/Threonine Kinase, Large Tumor Suppressor.
           Serine/Threonine Kinases (STKs), Large Tumor Suppressor
           (LATS) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           LATS subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. LATS was originally identified in Drosophila
           using a screen for genes whose inactivation led to
           overproliferation of cells. In tetrapods, there are two
           LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in
           mice results in the development of various tumors,
           including sarcomas and ovarian cancer. LATS functions as
           a tumor suppressor and is implicated in cell cycle
           regulation.
          Length = 376

 Score = 26.3 bits (58), Expect = 0.81
 Identities = 12/22 (54%), Positives = 14/22 (63%)

Query: 25  VGTRRYMAPEVLDETIDTKFFD 46
           VGT  Y+APEVL  T  T+  D
Sbjct: 205 VGTPNYIAPEVLLRTGYTQLCD 226


>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed.
          Length = 932

 Score = 26.3 bits (58), Expect = 0.88
 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 6/37 (16%)

Query: 21  PNTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLG 57
           P   VGT  YMAPE L          A +  D+Y+LG
Sbjct: 188 PGKIVGTPDYMAPERLLGV------PASESTDIYALG 218


>gnl|CDD|173646 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of the Protein
           Tyrosine Kinases, Apoptosis-associated tyrosine kinases
           1 and 3.  Protein Tyrosine Kinase (PTK) family;
           Apoptosis-associated tyrosine kinase 1 (Aatyk1) and
           Aatyk3; catalytic (c) domain. The PTKc family is part of
           a larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. Aatyk1 and Aatyk3 are
           members of the Aatyk subfamily of proteins. Aatyk3 is a
           receptor kinase containing a transmembrane segment and a
           long C-terminal cytoplasmic tail with a catalytic
           domain. Aatyk1 has a similar domain arrangement but
           without the transmembrane segment and is thus, a
           cytoplasmic (or nonreceptor) kinase. The expression of
           Aatyk1 (also referred simply as Aatyk) is upregulated
           during growth arrest and apoptosis in myeloid cells.
           Aatyk1 has been implicated in neural differentiation,
           and is a regulator of the Na-K-2Cl cotransporter, a
           membrane protein involved in cell proliferation and
           survival, epithelial transport, and blood pressure
           control. The function of Aatyk3 is still unknown.
          Length = 269

 Score = 26.1 bits (57), Expect = 0.90
 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%)

Query: 29  RYMAPEVLDETIDTKFF-DAFKMADMYSLGPT 59
           R++APE++DE        D  K ++++SLG T
Sbjct: 167 RWIAPELVDEVHGNLLVVDQTKESNVWSLGVT 198


>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine
           Kinase, cAMP-dependent protein kinase.  Serine/Threonine
           Kinases (STKs), cAMP-dependent protein kinase (PKA)
           subfamily, catalytic (c) subunit. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PKA
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase (PI3K). This subfamily is composed of the
           cAMP-dependent proteins kinases, PKA and PRKX. The
           inactive PKA holoenzyme is a heterotetramer composed of
           two phosphorylated and active catalytic (C) subunits
           with a dimer of regulatory (R) subunits. Activation is
           achieved through the binding of the important second
           messenger cAMP to the R subunits, which leads to the
           dissociation of PKA into the R dimer and two active C
           subunits. PKA is present ubiquitously in cells and
           interacts with many different downstream targets. It
           plays a role in the regulation of diverse processes such
           as growth, development, memory, metabolism, gene
           expression, immunity, and lipolysis.
          Length = 290

 Score = 26.0 bits (58), Expect = 0.92
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 6/35 (17%)

Query: 23  TRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLG 57
           T  GT  Y+APE+    I +K +   K  D ++LG
Sbjct: 157 TLCGTPEYLAPEI----ILSKGYG--KAVDWWALG 185


>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of
           Phototropin-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Phototropin-like
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           phototropin-like subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Included in this subfamily
           are plant phototropins and predominantly uncharacterized
           fungal STKs whose catalytic domains resemble the
           phototropin kinase domain. One protein from Neurospora
           crassa is called nrc-2. Phototropins are blue-light
           receptors that control responses such as phototropism,
           stromatal opening, and chloroplast movement in order to
           optimize the photosynthetic efficiency of plants. They
           are light-activated STKs that contain an N-terminal
           photosensory domain and a C-terminal catalytic domain.
           The N-terminal domain contains two LOV (Light, Oxygen or
           Voltage) domains that binds FMN. Photoexcitation of the
           LOV domains results in autophosphorylation at multiple
           sites and activation of the catalytic domain. Neurospora
           crassa nrc-2 plays a role in growth and development by
           controlling entry into the conidiation program.
          Length = 316

 Score = 26.1 bits (58), Expect = 1.0
 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 5/31 (16%)

Query: 10  VSSETSEIDIAP-----NTRVGTRRYMAPEV 35
           V+S  SE          N+ VGT  Y+APEV
Sbjct: 173 VNSIPSETFSEEPSFRSNSFVGTEEYIAPEV 203


>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, G protein-coupled Receptor
           Kinase 4.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily, GRK4
           isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The GRK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. GRKs phosphorylate and regulate G
           protein-coupled receptors (GPCRs), the largest
           superfamily of cell surface receptors which regulate
           some part of nearly all physiological functions.
           Phosphorylated GPCRs bind to arrestins, which prevents
           further G protein signaling despite the presence of
           activating ligand. There are seven types of GRKs, named
           GRK1 to GRK7. GRK4 has a limited tissue distribution. It
           is mainly found in the testis, but is also present in
           the cerebellum and kidney. It is expressed as multiple
           splice variants with different domain architectures. It
           is post-translationally palmitoylated and localized in
           the membrane. GRK4 polymorphisms are associated with
           hypertension and salt sensitivity, as they cause
           hyperphosphorylation, desensitization, and
           internalization of the dopamine 1 (D1) receptor while
           increasing the expression of the angiotensin II type 1
           receptor. GRK4 plays a crucial role in the D1 receptor
           regulation of sodium excretion and blood pressure.
          Length = 285

 Score = 26.1 bits (57), Expect = 1.1
 Identities = 10/14 (71%), Positives = 12/14 (85%)

Query: 24  RVGTRRYMAPEVLD 37
           RVGT  YMAPEV++
Sbjct: 161 RVGTVGYMAPEVIN 174


>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant
           dual-specificity MAP kinase kinases and similar
           proteins.  Protein kinases (PKs), MAP kinase kinase
           (MAPKK) subfamily, Plant MAPKKs and similar proteins,
           catalytic (c) domain. PKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine or
           tyrosine residues on protein substrates. The MAPKK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein serine/threonine
           kinases, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. The mitogen-activated protein
           (MAP) kinase signaling pathways are important mediators
           of cellular responses to extracellular signals. The
           pathways involve a triple kinase core cascade comprising
           of the MAP kinase (MAPK), which is phosphorylated and
           activated by a MAPK kinase (MAPKK or MKK), which itself
           is phosphorylated and activated by a MAPK kinase kinase
           (MAPKKK or MKKK). Members of this group include MAPKKs
           from plants, kinetoplastids, alveolates, and mycetozoa.
           The MAPKK, LmxPK4, from Leishmania mexicana, is
           important in differentiation and virulence.
           Dictyostelium discoideum MEK1 is required for proper
           chemotaxis. MEK1 null mutants display severe defects in
           cell polarization and directional movement. Plants
           contain multiple MAPKKs like other eukaryotes. The
           Arabidopsis genome encodes for 10 MAPKKs while poplar
           and rice contain 13 MAPKKs each. The functions of these
           proteins have not been fully elucidated. There is
           evidence to suggest that MAPK cascades are involved in
           plant stress responses. In Arabidopsis, MKK3 plays a
           role in pathogen signaling, MKK2 is involved in cold and
           salt stress signaling, MKK4/MKK5 participates in innate
           immunity, and MKK7 regulates basal and systemic acquired
           resistance.
          Length = 264

 Score = 25.6 bits (57), Expect = 1.1
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 8/51 (15%)

Query: 8   FCVSSETSEIDIAPNTRVGTRRYMAPEVLD-ETIDTKFFDAFKMADMYSLG 57
           F +S          NT VGT  YM+PE +  E+       ++  AD++SLG
Sbjct: 144 FGISKVLENTLDQCNTFVGTVTYMSPERIQGES------YSYA-ADIWSLG 187


>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein
           Serine/Threonine Kinase, G protein-coupled Receptor
           Kinase 5.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily, GRK5
           isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The GRK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. GRKs phosphorylate and regulate G
           protein-coupled receptors (GPCRs), the largest
           superfamily of cell surface receptors which regulate
           some part of nearly all physiological functions.
           Phosphorylated GPCRs bind to arrestins, which prevents
           further G protein signaling despite the presence of
           activating ligand. There are seven types of GRKs, named
           GRK1 to GRK7. GRK5 is widely expressed in many tissues.
           It associates with the membrane though an N-terminal
           PIP2 binding domain and also binds phospholipids via its
           C-terminus. GRK5 deficiency is associated with early
           Alzheimer's disease in humans and mouse models. GRK5
           also plays a crucial role in the pathogenesis of
           sporadic Parkinson's disease. It participates in the
           regulation and desensitization of PDGFRbeta, a receptor
           tyrosine kinase involved in a variety of downstream
           cellular effects including cell growth, chemotaxis,
           apoptosis, and angiogenesis. GRK5 also regulates
           Toll-like receptor 4, which is involved in innate and
           adaptive immunity.
          Length = 285

 Score = 25.7 bits (56), Expect = 1.3
 Identities = 11/14 (78%), Positives = 12/14 (85%)

Query: 24  RVGTRRYMAPEVLD 37
           RVGT  YMAPEVL+
Sbjct: 161 RVGTVGYMAPEVLN 174


>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine
           Kinase, Serum- and Glucocorticoid-induced Kinase.
           Serine/Threonine Kinases (STKs), Serum- and
           Glucocorticoid-induced Kinase (SGK) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The SGK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. There are three
           isoforms of SGK, named SGK1, SGK2, and SGK3 (also called
           cytokine-independent survival kinase CISK). SGKs are
           activated by insulin and growth factors via
           phosphoinositide 3-kinase and PDK1. They activate ion
           channels, ion carriers, and the Na-K-ATPase, as well as
           regulate the activity of enzymes and transcription
           factors. SGKs play important roles in transport, hormone
           release, neuroexcitability, cell proliferation, and
           apoptosis.
          Length = 323

 Score = 25.5 bits (56), Expect = 1.4
 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 5/57 (8%)

Query: 7   EFCVSSETSEIDIAPNTRVGTRRYMAPEVL-----DETIDTKFFDAFKMADMYSLGP 58
           +F +  E  E     +T  GT  Y+APEVL     D T+D     A     +Y L P
Sbjct: 139 DFGLCKEGIEHSKTTSTFCGTPEYLAPEVLRKQPYDRTVDWWCLGAVLYEMLYGLPP 195


>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Thousand-and-one amino acids 2.
            Serine/threonine kinases (STKs), thousand-and-one amino
           acids 2 (TAO2) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The TAO subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. TAO proteins possess mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
           activity. MAPK signaling cascades are important in
           mediating cellular responses to extracellular signals.
           Human TAO2 is also known as prostate-derived Ste20-like
           kinase (PSK) and was identified in a screen for
           overexpressed RNAs in prostate cancer. TAO2 activates
           both p38 and c-Jun N-terminal kinase (JNK), by
           phosphorylating and activating the respective MAP/ERK
           kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6
           and MKK4/MKK7. TAO2 contains a long C-terminal extension
           with autoinhibitory segments. It is activated by the
           release of this inhibition and the phosphorylation of
           its activation loop serine. TAO2 functions as a
           regulator of actin cytoskeletal and microtubule
           organization. In addition, it regulates the transforming
           growth factor-activated kinase 1 (TAK1), which is a
           MAPKKK that plays an essential role in the signaling
           pathways of tumor necrosis factor (TNF), interleukin 1
           (IL-1), and Toll-like receptor (TLR).
          Length = 308

 Score = 25.8 bits (56), Expect = 1.4
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 4/42 (9%)

Query: 19  IAP-NTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLGPT 59
           +AP N  VGT  +MAPEV+   +D   +D     D++SLG T
Sbjct: 165 MAPANXFVGTPYWMAPEVI-LAMDEGQYDG--KVDVWSLGIT 203


>gnl|CDD|236468 PRK09330, PRK09330, cell division protein FtsZ; Validated.
          Length = 384

 Score = 25.5 bits (57), Expect = 1.6
 Identities = 10/19 (52%), Positives = 12/19 (63%), Gaps = 2/19 (10%)

Query: 34  EVLDETIDTKFFDAFKMAD 52
           EV+D+   T   DAFK AD
Sbjct: 173 EVVDK--KTPLLDAFKAAD 189


>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ
           cell-Associated Kinase-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Male germ
           cell-Associated Kinase (MAK)-like subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of human MAK and
           MAK-related kinase (MRK), Saccharomyces cerevisiae
           Ime2p, Schizosaccharomyces pombe Mei4-dependent protein
           3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5,
           Arabidopsis thaliana MHK, and similar proteins. These
           proteins play important roles during meiosis. MAK is
           highly expressed in testicular cells specifically in the
           meiotic phase, but is not essential for spermatogenesis
           and fertility. It functions as a coactivator of the
           androgen receptor in prostate cells. MRK, also called
           Intestinal Cell Kinase (ICK), is expressed ubiquitously,
           with highest expression in the ovary and uterus. A
           missense mutation in MRK causes
           endocrine-cerebro-osteodysplasia (ECO), suggesting that
           this protein plays an important role in the development
           of many organs. MAK and MRK may be involved in
           regulating cell cycle and cell fate. Ime2p is a
           meiosis-specific kinase that is important during meiotic
           initiation and during the later stages of meiosis. Mde3
           functions downstream of the transcription factor Mei-4
           which is essential for meiotic prophase I.
          Length = 283

 Score = 25.6 bits (57), Expect = 1.6
 Identities = 8/12 (66%), Positives = 9/12 (75%)

Query: 25  VGTRRYMAPEVL 36
           V TR Y APE+L
Sbjct: 159 VSTRWYRAPEIL 170


>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein
           Serine/Threonine Kinase, Thousand-and-one amino acids 3.
            Serine/threonine kinases (STKs), thousand-and-one amino
           acids 3 (TAO3) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The TAO subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. TAO proteins possess mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
           activity. MAPK signaling cascades are important in
           mediating cellular responses to extracellular signals.
           TAO3 is also known as JIK (JNK inhibitory kinase) or KFC
           (kinase from chicken). It specifically activates c-Jun
           N-terminal kinase (JNK), presumably by phosphorylating
           and activating MKK4/MKK7. In Saccharomyces cerevisiae,
           TAO3 is a component of the RAM (regulation of Ace2p
           activity and cellular morphogenesis) signaling pathway.
           TAO3 is upregulated in retinal ganglion cells after
           axotomy, and may play a role in apoptosis.
          Length = 313

 Score = 25.4 bits (55), Expect = 1.6
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 3/38 (7%)

Query: 22  NTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLGPT 59
           N+ VGT  +MAPEV+   +D   +D     D++SLG T
Sbjct: 175 NSFVGTPYWMAPEVI-LAMDEGQYDG--KVDVWSLGIT 209


>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein
           Serine/Threonine Kinase, G protein-coupled Receptor
           Kinase 6.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily, GRK6
           isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The GRK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. GRKs phosphorylate and regulate G
           protein-coupled receptors (GPCRs), the largest
           superfamily of cell surface receptors which regulate
           some part of nearly all physiological functions.
           Phosphorylated GPCRs bind to arrestins, which prevents
           further G protein signaling despite the presence of
           activating ligand. There are seven types of GRKs, named
           GRK1 to GRK7. GRK6 is widely expressed in many tissues.
           t is expressed as multiple splice variants with
           different domain architectures. It is
           post-translationally palmitoylated and localized in the
           membrane. GRK6 plays important roles in the regulation
           of dopamine, M3 muscarinic, opioid, and chemokine
           receptor signaling. It also plays maladaptive roles in
           addiction and Parkinson's disease. GRK6-deficient mice
           exhibit altered dopamine receptor regulation, decreased
           lymphocyte chemotaxis, and increased acute inflammation
           and neutrophil chemotaxis.
          Length = 285

 Score = 25.0 bits (54), Expect = 2.2
 Identities = 10/13 (76%), Positives = 11/13 (84%)

Query: 24  RVGTRRYMAPEVL 36
           RVGT  YMAPEV+
Sbjct: 161 RVGTVGYMAPEVV 173


>gnl|CDD|225988 COG3457, COG3457, Predicted amino acid racemase [Amino acid
           transport and metabolism].
          Length = 353

 Score = 25.1 bits (55), Expect = 2.2
 Identities = 11/57 (19%), Positives = 20/57 (35%)

Query: 3   PEVLEFCVSSETSEIDIAPNTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLGPT 59
            E     + SE  E+   P+  +G   Y     +D  I  +   A    D+  +  +
Sbjct: 240 LEQDAMLLESEIIEVKDKPSYPIGEGFYRRSGFVDAGIRLRAIAAIGEQDVDVVNLS 296


>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Thousand-and-one amino acids 1.
            Serine/threonine kinases (STKs), thousand-and-one amino
           acids 1 (TAO1) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The TAO subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. TAO proteins possess mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
           activity. MAPK signaling cascades are important in
           mediating cellular responses to extracellular signals.
           TAO1 is sometimes referred to as prostate-derived
           sterile 20-like kinase 2 (PSK2). TAO1 activates the p38
           MAPK through direct interaction with and activation of
           MEK3. TAO1 is highly expressed in the brain and may play
           a role in neuronal apoptosis. TAO1 interacts with the
           checkpoint proteins BubR1 and Mad2, and plays an
           important role in regulating mitotic progression, which
           is required for both chromosome congression and
           checkpoint-induced anaphase delay. TAO1 may play a role
           in protecting genomic stability.
          Length = 317

 Score = 24.7 bits (53), Expect = 2.9
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 3/38 (7%)

Query: 22  NTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLGPT 59
           N+ VGT  +MAPEV+   +D   +D     D++SLG T
Sbjct: 179 NSFVGTPYWMAPEVI-LAMDEGQYDG--KVDVWSLGIT 213


>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated
           serine/threonine kinase-like proteins.  Serine/Threonine
           Kinases (STKs), Microtubule-associated serine/threonine
           (MAST) kinase subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The MAST kinase subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. The MAST kinase subfamily
           includes MAST kinases, MAST-like (MASTL) kinases, and
           fungal kinases with similarity to Saccharomyces
           cerevisiae Rim15 and Schizosaccharomyces pombe cek1.
           MAST kinases contain an N-terminal domain of unknown
           function, a central catalytic domain, and a C-terminal
           PDZ domain that mediates protein-protein interactions.
           MASTL kinases carry only a catalytic domain which
           contains a long insert relative to other kinases. The
           fungal kinases in this subfamily harbor other domains in
           addition to a central catalytic domain, which also
           contains an insert relative to MAST kinases like MASTL.
           Rim15 contains a C-terminal signal receiver (REC) domain
           while cek1 contains an N-terminal PAS domain. MAST
           kinases are cytoskeletal associated kinases of unknown
           function that are also expressed at neuromuscular
           junctions and postsynaptic densities. The fungal
           proteins Rim15 and cek1 are involved in the regulation
           of meiosis and mitosis, respectively.
          Length = 265

 Score = 24.5 bits (54), Expect = 3.0
 Identities = 10/22 (45%), Positives = 13/22 (59%), Gaps = 1/22 (4%)

Query: 16  EIDIAPNTR-VGTRRYMAPEVL 36
             D   + R VGT  Y+APEV+
Sbjct: 152 NDDEKEDKRIVGTPDYIAPEVI 173


>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Citron Rho-interacting kinase. 
           Serine/Threonine Kinases (STKs), Citron Rho-interacting
           kinase (CRIK) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The CRIK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CRIK is also called citron kinase. It contains
           a catalytic domain, a central coiled-coil domain, and a
           C-terminal region containing a Rho-binding domain (RBD),
           a zinc finger, and a pleckstrin homology (PH) domain, in
           addition to other motifs. CRIK, an effector of the small
           GTPase Rho, plays an important function during
           cytokinesis and affects its contractile process.
           CRIK-deficient mice show severe ataxia and epilepsy as a
           result of abnormal cytokinesis and massive apoptosis in
           neuronal precursors. A Down syndrome critical region
           protein TTC3 interacts with CRIK and inhibits
           CRIK-dependent neuronal differentiation and neurite
           extension.
          Length = 330

 Score = 24.4 bits (53), Expect = 3.5
 Identities = 9/12 (75%), Positives = 10/12 (83%)

Query: 25  VGTRRYMAPEVL 36
           VGT  Y+APEVL
Sbjct: 164 VGTPDYIAPEVL 175


>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine
           Kinase, Protein Kinase N.  Serine/Threonine Kinases
           (STKs), Protein Kinase N (PKN) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKN subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKN has a
           C-terminal catalytic domain that is highly homologous to
           PKCs. Its unique N-terminal regulatory region contains
           antiparallel coiled-coil (ACC) domains. In mammals,
           there are three PKN isoforms from different genes
           (designated PKN-alpha, beta, and gamma), which show
           different enzymatic properties, tissue distribution, and
           varied functions. PKN can be activated by the small
           GTPase Rho, and by fatty acids such as arachidonic and
           linoleic acids. It is involved in many biological
           processes including cytokeletal regulation, cell
           adhesion, vesicle transport, glucose transport,
           regulation of meiotic maturation and embryonic cell
           cycles, signaling to the nucleus, and tumorigenesis.
          Length = 324

 Score = 24.6 bits (54), Expect = 3.7
 Identities = 12/24 (50%), Positives = 15/24 (62%)

Query: 23  TRVGTRRYMAPEVLDETIDTKFFD 46
           T  GT  ++APEVL ET  T+  D
Sbjct: 160 TFCGTPEFLAPEVLTETSYTRAVD 183


>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine
           Kinase, Protein Kinase B.  Serine/Threonine Kinases
           (STKs), Protein Kinase B (PKB) or Akt subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase (PI3K). There are
           three PKB isoforms from different genes, PKB-alpha (or
           Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
           contains an N-terminal pleckstrin homology (PH) domain
           and a C-terminal catalytic domain. It is activated
           downstream of PI3K and plays important roles in diverse
           cellular functions including cell survival, growth,
           proliferation, angiogenesis, motility, and migration.
           PKB also has a central role in a variety of human
           cancers, having been implicated in tumor initiation,
           progression, and metastasis.
          Length = 323

 Score = 24.4 bits (53), Expect = 4.3
 Identities = 9/16 (56%), Positives = 12/16 (75%)

Query: 23  TRVGTRRYMAPEVLDE 38
           T  GT  Y+APEVL++
Sbjct: 154 TFCGTPEYLAPEVLED 169


>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein
           Serine/Threonine Kinase, Serum- and
           Glucocorticoid-induced Kinase 3.  Serine/Threonine
           Kinases (STKs), Serum- and Glucocorticoid-induced Kinase
           (SGK) subfamily, SGK3 isoform, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The SGK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. There are three isoforms of
           SGK, named SGK1, SGK2, and SGK3 (also called
           cytokine-independent survival kinase CISK). SGK3 is
           expressed in most tissues and is most abundant in the
           embryo and adult heart and spleen. It was originally
           discovered in a screen for antiapoptotic genes. It
           phosphorylates and inhibits the proapoptotic proteins,
           Bad and FKHRL1. SGK3 also regulates many transporters,
           ion channels, and receptors. It plays a critical role in
           hair follicle morphogenesis and hair cycling.
          Length = 325

 Score = 24.2 bits (52), Expect = 4.5
 Identities = 17/57 (29%), Positives = 23/57 (40%), Gaps = 5/57 (8%)

Query: 7   EFCVSSETSEIDIAPNTRVGTRRYMAPEVL-----DETIDTKFFDAFKMADMYSLGP 58
           +F +  E         T  GT  Y+APEV+     D T+D     A     +Y L P
Sbjct: 139 DFGLCKEGIAQSDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPP 195


>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein
           Kinase, MAP kinase kinase 7.  Protein kinases (PKs), MAP
           kinase kinase 7 (MKK7) subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MKK7 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising the MAP kinase
           (MAPK), which is phosphorylated and activated by a MAPK
           kinase (MAPKK or MKK), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK).
           MKK7 is a dual-specificity PK that phosphorylates and
           activates its downstream target, c-Jun N-terminal kinase
           (JNK), on specific threonine and tyrosine residues.
           Although MKK7 is capable of dual phosphorylation, it
           prefers to phosphorylate the threonine residue of JNK.
           Thus, optimal activation of JNK requires both MKK4 (not
           included in this subfamily) and MKK7. MKK7 is primarily
           activated by cytokines. MKK7 is essential for liver
           formation during embryogenesis. It plays roles in G2/M
           cell cycle arrest and cell growth. In addition, it is
           involved in the control of programmed cell death, which
           is crucial in oncogenesis, cancer chemoresistance, and
           antagonism to TNFalpha-induced killing, through its
           inhibition by Gadd45beta and the subsequent suppression
           of the JNK cascade.
          Length = 296

 Score = 24.3 bits (53), Expect = 4.9
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 3/44 (6%)

Query: 17  IDIAPNTR-VGTRRYMAPEVLDETIDTKFFDAFKMADMYSLGPT 59
           +D    TR  G   YMAPE +D       +D    AD++SLG +
Sbjct: 166 VDSKAKTRSAGCAAYMAPERIDPPDPNPKYDI--RADVWSLGIS 207


>gnl|CDD|153378 cd07366, 3MGA_Dioxygenase, Subunit B of the Class III Extradiol
           ring-cleavage dioxygenase, 3-O-Methylgallate
           Dioxygenase, which catalyzes the oxidization and
           subsequent ring-opening of 3-O-Methylgallate.
           3-O-Methylgallate Dioxygenase catalyzes the oxidization
           and subsequent ring-opening of 3-O-Methylgallate (3MGA)
           between carbons 2 and 3. 3-O-Methylgallate Dioxygenase
           is a key enzyme in the syringate degradation pathway, in
           which the syringate is first converted to
           3-O-Methylgallate by O-demethylase. This enzyme is a
           member of the class III extradiol dioxygenase family, a
           group of enzymes which uses a non-heme Fe(II) to cleave
           aromatic rings between a hydroxylated carbon and an
           adjacent non-hydroxylated carbon. LigAB-like enzymes are
           usually composed of two subunits, designated A and B,
           which form a tetramer composed of two copies of each
           subunit. This model represents the catalytic subunit, B.
          Length = 328

 Score = 23.9 bits (52), Expect = 5.4
 Identities = 8/22 (36%), Positives = 11/22 (50%)

Query: 35  VLDETIDTKFFDAFKMADMYSL 56
           V+DE  D +  DA +  D   L
Sbjct: 250 VIDEEFDRRILDALRNRDAEFL 271


>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein
           Serine/Threonine Kinase, 90 kDa ribosomal protein S6
           kinase.  Serine/Threonine Kinases (STKs), 90 kDa
           ribosomal protein S6 kinase (RSK) subfamily, N-terminal
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The RSK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. RSKs contain an
           N-terminal kinase domain (NTD) from the AGC family and a
           C-terminal kinase domain (CTD) from the CAMK family.
           They are activated by signaling inputs from
           extracellular regulated kinase (ERK) and
           phosphoinositide dependent kinase 1 (PDK1). ERK
           phosphorylates and activates the CTD of RSK, serving as
           a docking site for PDK1, which phosphorylates and
           activates the NTD, which in turn phosphorylates all
           known RSK substrates. RSKs act as downstream effectors
           of mitogen-activated protein kinase (MAPK) and play key
           roles in mitogen-activated cell growth, differentiation,
           and survival. Mammals possess four RSK isoforms (RSK1-4)
           from distinct genes. RSK proteins are also referred to
           as MAP kinase-activated protein kinases (MAPKAPKs),
           p90-RSKs, or p90S6Ks.
          Length = 318

 Score = 24.0 bits (52), Expect = 5.7
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 6/54 (11%)

Query: 4   EVLEFCVSSETSEIDIAPNTRVGTRRYMAPEVLDETIDTKFFDAFKMADMYSLG 57
           ++ +F +S E+ + +    +  GT  YMAPEV++    T      + AD +S G
Sbjct: 138 KLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVVNRRGHT------QSADWWSFG 185


>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine
           Kinase, Protein Kinase C.  Serine/Threonine Kinases
           (STKs), Protein Kinase C (PKC) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           PKCs undergo three phosphorylations in order to take
           mature forms. In addition, classical PKCs depend on
           calcium, DAG (1,2-diacylglycerol), and in most cases,
           phosphatidylserine (PS) for activation. Novel PKCs are
           calcium-independent, but require DAG and PS for
           activity, while atypical PKCs only require PS. PKCs
           phosphorylate and modify the activities of a wide
           variety of cellular proteins including receptors,
           enzymes, cytoskeletal proteins, transcription factors,
           and other kinases. They play a central role in signal
           transduction pathways that regulate cell migration and
           polarity, proliferation, differentiation, and apoptosis.
           Also included in this subfamily are the PKC-like
           proteins, called PKNs.
          Length = 318

 Score = 23.5 bits (51), Expect = 9.5
 Identities = 8/18 (44%), Positives = 11/18 (61%)

Query: 22  NTRVGTRRYMAPEVLDET 39
           +T  GT  Y+APE+L   
Sbjct: 154 STFCGTPDYIAPEILSYQ 171


>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related
           kinase-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related
           (NDR) kinase subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The NDR subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. NDR kinase contains an N-terminal regulatory
           (NTR) domain and an insert within the catalytic domain
           that contains an auto-inhibitory sequence. Like many
           other AGC kinases, NDR kinase requires phosphorylation
           at two sites, the activation loop (A-loop) and the
           hydrophobic motif (HM), for activity. NDR kinases
           regulate mitosis, cell growth, embryonic development,
           and neurological processes. They are also required for
           proper centrosome duplication. Higher eukaryotes contain
           two NDR isoforms, NDR1 and NDR2. This subfamily also
           contains fungal NDR-like kinases.
          Length = 364

 Score = 23.5 bits (51), Expect = 9.7
 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 6/33 (18%)

Query: 25  VGTRRYMAPEVLDETIDTKFFDAFKMADMYSLG 57
           VGT  Y+APEV  +T         K  D +SLG
Sbjct: 200 VGTPDYIAPEVFLQT------GYNKECDWWSLG 226


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.319    0.133    0.382 

Gapped
Lambda     K      H
   0.267   0.0818    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 2,898,284
Number of extensions: 190573
Number of successful extensions: 300
Number of sequences better than 10.0: 1
Number of HSP's gapped: 300
Number of HSP's successfully gapped: 87
Length of query: 59
Length of database: 10,937,602
Length adjustment: 31
Effective length of query: 28
Effective length of database: 9,562,628
Effective search space: 267753584
Effective search space used: 267753584
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (24.0 bits)