Diaphorina citri psyllid: psy11033

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MRHDPHKLVEGCLVAGRAMGAKAAYIYIRGEFYNEASNMQVAISETLKIWSIHPPWYITVWTHGVAGRAMGAKAAYIYIRGEFYNEASNMQVAISEAYQAGLIGKNACGSGYDFDVFMHRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVSNVETVAVAPEICRRGGAWFASLGRPRNSGTKLFNISGHVNTPCTVEEEMSIPLKELIQRHAGDVIGGWDNLLAIIPGGSSTPLIPKR
cccccccccHHHHccccccccccEEEEEccccccccccccHHHHHccccccccccccHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHHHHccccccccccccccEEEEEECcccEEECcHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHccHHHHHccccccccccEEEEEECccccccEEEEcccccHHHHHHHHcccccccccEEEEECcccccccccccc
*****HK****CLVA***MGAKAAYIYIRGEFYNEASNMQVAISETLKIWSIHPPWYITVWTHGVAGRAMGAKAAYIYIRGEFYNEASNMQVAISEAYQAGLIGKNACGSGYDFDVFMHRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVSNVETVAVAPEICRRGGAWFASLGRPRNSGTKLFNISGHVNTPCTVEEEMSIPLKELIQRHAGDVIGGWDNLLAIIPGGSSTPLIP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRHDPHKLVEGCLVAGRAMGAKAAYIYIRGEFYNEASNMQVAISETLKIWSIHPPWYITVWTHGVAGRAMGAKAAYIYIRGEFYNEASNMQVAISEAYQAGLIGKNACGSGYDFDVFMHRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVSNVETVAVAPEICRRGGAWFASLGRPRNSGTKLFNISGHVNTPCTVEEEMSIPLKELIQRHAGDVIGGWDNLLAIIPGGSSTPLIPKR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADH-ubiquinone oxidoreductase 51 kDa subunit, mitochondrial Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentQ92406
NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentQ0MQI6
NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentQ91YT0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016020 [CC]membraneconfidentGO:0005575
GO:0005739 [CC]mitochondrionconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005747 [CC]mitochondrial respiratory chain complex IprobableGO:0044464, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043234, GO:0045271, GO:0032991, GO:0043231, GO:0030964, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0044444, GO:0005746, GO:0044429, GO:0044424, GO:0044425, GO:0070469, GO:0044422
GO:0051287 [MF]NAD bindingprobableGO:0050662, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:1901363, GO:1901265
GO:0030421 [BP]defecationprobableGO:0032501, GO:0007588, GO:0044707, GO:0008150, GO:0044699, GO:0003008
GO:0044281 [BP]small molecule metabolic processprobableGO:0044710, GO:0008150, GO:0008152
GO:0019915 [BP]lipid storageprobableGO:0008150, GO:0033036, GO:0010876, GO:0051179
GO:0044011 [BP]single-species biofilm formation on inanimate substrateprobableGO:0042710, GO:0009987, GO:0044764, GO:0008150, GO:0051703, GO:0044010, GO:0051704
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0040039 [BP]inductive cell migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0016477, GO:0051179, GO:0044699
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0009060 [BP]aerobic respirationprobableGO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0045333, GO:0008152, GO:0008150, GO:0006091, GO:0055114
GO:0006120 [BP]mitochondrial electron transport, NADH to ubiquinoneprobableGO:0044710, GO:0015980, GO:0006793, GO:0016310, GO:0009987, GO:0044237, GO:0006796, GO:0022900, GO:0045333, GO:0008152, GO:0022904, GO:0008150, GO:0006091, GO:0042775, GO:0042773, GO:0055114, GO:0006119
GO:0008406 [BP]gonad developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0045137, GO:0044767, GO:0003006, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0006810 [BP]transportprobableGO:0051234, GO:0008150, GO:0051179
GO:0042149 [BP]cellular response to glucose starvationprobableGO:0009267, GO:0051716, GO:0031669, GO:0033554, GO:0009605, GO:0050896, GO:0009987, GO:0031668, GO:0031667, GO:0008150, GO:0006950, GO:0071496, GO:0044763, GO:0044699, GO:0042594, GO:0007154, GO:0009991
GO:0051539 [MF]4 iron, 4 sulfur cluster bindingprobableGO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0033108 [BP]mitochondrial respiratory chain complex assemblyprobableGO:0006996, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0071840, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0044763, GO:0044699, GO:0034622, GO:0008150, GO:0009987, GO:0043623, GO:0007005
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0008137 [MF]NADH dehydrogenase (ubiquinone) activityprobableGO:0003824, GO:0016655, GO:0050136, GO:0016651, GO:0003674, GO:0003954, GO:0016491
GO:0036170 [BP]filamentous growth of a population of unicellular organisms in response to starvationprobableGO:0009991, GO:0040007, GO:0009605, GO:0030447, GO:0044182, GO:0031667, GO:0006950, GO:0008150, GO:0042594, GO:0050896, GO:0044699
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0010181 [MF]FMN bindingprobableGO:0043168, GO:0050662, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:1901265, GO:0003674, GO:0043167, GO:1901363, GO:0032553, GO:0005488
GO:0048598 [BP]embryonic morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0043050 [BP]pharyngeal pumpingprobableGO:0007631, GO:0050896, GO:0008150, GO:0042755, GO:0007610
GO:0040018 [BP]positive regulation of multicellular organism growthprobableGO:0040014, GO:0051240, GO:0050789, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0040008, GO:0045927
GO:0043054 [BP]dauer exitprobableGO:0040024, GO:0032502, GO:0032501, GO:0044707, GO:0002119, GO:0044767, GO:0071981, GO:0002164, GO:0008150, GO:0022611, GO:0009791, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I9V, chain 1
Confidence level:very confident
Coverage over the Query: 47-248
View the alignment between query and template
View the model in PyMOL
Template: 3I9V, chain 1
Confidence level:confident
Coverage over the Query: 1-51
View the alignment between query and template
View the model in PyMOL