BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy11046
(550 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3ECI|A Chain A, Microtubule-Associated Protein 1 Light Chain 3 Alpha
Isoform A (Map1alc3)
pdb|3ECI|B Chain B, Microtubule-Associated Protein 1 Light Chain 3 Alpha
Isoform A (Map1alc3)
Length = 122
Score = 28.9 bits (63), Expect = 8.8, Method: Composition-based stats.
Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 7/65 (10%)
Query: 335 KVSNISHIENMLPNKQLINIEENK-------LDKSSDSMTCEFNMSALSSLLRKQCEQNP 387
+ + I + P+K + IE K LDK+ + NMS L ++R++ + NP
Sbjct: 17 RCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNP 76
Query: 388 SASYF 392
+ ++F
Sbjct: 77 TQAFF 81
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.312 0.130 0.377
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,205,717
Number of Sequences: 62578
Number of extensions: 584846
Number of successful extensions: 832
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 831
Number of HSP's gapped (non-prelim): 2
length of query: 550
length of database: 14,973,337
effective HSP length: 104
effective length of query: 446
effective length of database: 8,465,225
effective search space: 3775490350
effective search space used: 3775490350
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 54 (25.4 bits)