BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy11046
         (550 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3ECI|A Chain A, Microtubule-Associated Protein 1 Light Chain 3 Alpha
           Isoform A (Map1alc3)
 pdb|3ECI|B Chain B, Microtubule-Associated Protein 1 Light Chain 3 Alpha
           Isoform A (Map1alc3)
          Length = 122

 Score = 28.9 bits (63), Expect = 8.8,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 7/65 (10%)

Query: 335 KVSNISHIENMLPNKQLINIEENK-------LDKSSDSMTCEFNMSALSSLLRKQCEQNP 387
           +   +  I +  P+K  + IE  K       LDK+   +    NMS L  ++R++ + NP
Sbjct: 17  RCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNP 76

Query: 388 SASYF 392
           + ++F
Sbjct: 77  TQAFF 81


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.312    0.130    0.377 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,205,717
Number of Sequences: 62578
Number of extensions: 584846
Number of successful extensions: 832
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 831
Number of HSP's gapped (non-prelim): 2
length of query: 550
length of database: 14,973,337
effective HSP length: 104
effective length of query: 446
effective length of database: 8,465,225
effective search space: 3775490350
effective search space used: 3775490350
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 54 (25.4 bits)