Diaphorina citri psyllid: psy11066


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70
MSLVMLQELASEFPDVVFLKVDVDESEDIAMAYDISSMPTFVFVKSTAKVEQFSGANFDKLRSTVLANRS
ccHHHHHHHHHHccccEEEEEEccccHHHHHHcccccccEEEEEEccEEEEEEEcccHHHHHHHHHHHcc
MSLVMLQELASEFPDVVFLKVDVDESEDIAMAYDISSMPTFVFVKSTAKVEQFSGANFDKLRSTVLA***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLVMLQELASEFPDVVFLKVDVDESEDIAMAYDISSMPTFVFVKSTAKVEQFSGANFDKLRSTVLANRS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thioredoxin-2 Participates as a hydrogen donor in redox reactions through the reversible oxidation of its active center dithiol to a disulfide, accompanied by the transfer of 2 electrons and 2 protons. It is involved in many cellular processes, including deoxyribonucleotide synthesis, repair of oxidatively damaged proteins, protein folding, sulfur metabolism, and redox homeostasis. Thioredoxin-dependent enzymes include phosphoadenosine-phosphosulfate reductase MET16, alkyl-hydroperoxide reductase DOT5, thioredoxin peroxidases TSA1 and TSA2, alkyl hydroperoxide reductase AHP1, and peroxiredoxin HYR1. Thioredoxin is also involved in protection against reducing stress. As part of the LMA1 complex, it is involved in the facilitation of vesicle fusion such as homotypic vacuole and ER-derived COPII vesicle fusion with the Golgi. This activity does not require the redox mechanism. Through its capacity to inactivate the stress response transcription factor YAP1 and its regulator the hydroperoxide stress sensor HYR1, it is involved in feedback regulation of stress response gene expression upon oxidative stress.confidentP22803
Thioredoxin-2 Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. As a reducing substrate of peroxiredoxin 1, thioredoxin 2 is preferred over thioredoxin 1.confidentQ9V429

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006457 [BP]protein foldingprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0006888 [BP]ER to Golgi vesicle-mediated transportprobableGO:0051234, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0070013 [CC]intracellular organelle lumenprobableGO:0005575, GO:0043233, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0043229, GO:0005623, GO:0044424, GO:0043226, GO:0044422
GO:0016209 [MF]antioxidant activityprobableGO:0003674
GO:0009570 [CC]chloroplast stromaprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0050790 [BP]regulation of catalytic activityprobableGO:0008150, GO:0065009, GO:0065007, GO:0050789, GO:0019222
GO:0006890 [BP]retrograde vesicle-mediated transport, Golgi to ERprobableGO:0009987, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0000806 [CC]Y chromosomeprobableGO:0043232, GO:0044464, GO:0000803, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0008047 [MF]enzyme activator activityprobableGO:0030234, GO:0003674
GO:0009534 [CC]chloroplast thylakoidprobableGO:0009579, GO:0005737, GO:0031984, GO:0005575, GO:0043231, GO:0044464, GO:0031976, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0009536, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0016671 [MF]oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptorprobableGO:0003824, GO:0003674, GO:0016667, GO:0016491
GO:0034614 [BP]cellular response to reactive oxygen speciesprobableGO:1901700, GO:1901701, GO:0051716, GO:0070887, GO:0050896, GO:0009987, GO:0000302, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0042221, GO:0034599, GO:0006979, GO:0044699
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0042144 [BP]vacuole fusion, non-autophagicprobableGO:0006996, GO:0007033, GO:0016044, GO:0071840, GO:0009987, GO:0016043, GO:0061025, GO:0061024, GO:0044763, GO:0006944, GO:0008150, GO:0044699
GO:0045454 [BP]cell redox homeostasisprobableGO:0019725, GO:0009987, GO:0050794, GO:0042592, GO:0044763, GO:0008150, GO:0065007, GO:0065008, GO:0050789, GO:0044699
GO:0005758 [CC]mitochondrial intermembrane spaceprobableGO:0005737, GO:0005575, GO:0043231, GO:0043229, GO:0031970, GO:0044464, GO:0044444, GO:0005739, GO:0031975, GO:0044446, GO:0005740, GO:0031967, GO:0031974, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0044429
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0015036 [MF]disulfide oxidoreductase activityprobableGO:0003824, GO:0003674, GO:0016667, GO:0016491

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VIM, chain A
Confidence level:very confident
Coverage over the Query: 2-69
View the alignment between query and template
View the model in PyMOL