Query         psy11070
Match_columns 148
No_of_seqs    134 out of 1276
Neff          10.1
Searched_HMMs 46136
Date          Fri Aug 16 17:16:43 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy11070.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/11070hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 5.4E-24 1.2E-28  146.4   4.3  107   29-144   128-240 (279)
  2 KOG2462|consensus               99.9 3.1E-23 6.7E-28  142.7   6.9  104   29-141   159-265 (279)
  3 KOG1074|consensus               99.6 3.2E-17   7E-22  126.9   0.0   56   85-145   604-659 (958)
  4 KOG3576|consensus               99.6 2.3E-16   5E-21  104.6   3.6   89   50-145   111-199 (267)
  5 KOG3623|consensus               99.6 1.6E-16 3.5E-21  121.7   1.3   81   54-141   892-972 (1007)
  6 KOG3623|consensus               99.5 3.4E-15 7.5E-20  114.6   0.2  112   23-141   202-331 (1007)
  7 KOG3576|consensus               99.5 6.2E-15 1.3E-19   97.9   0.8  106   32-143   118-236 (267)
  8 KOG1074|consensus               99.3 8.7E-13 1.9E-17  102.8  -0.0   85   55-146   604-695 (958)
  9 KOG3608|consensus               99.2 4.1E-12 8.9E-17   90.9   2.8  105   32-145   180-318 (467)
 10 PHA00733 hypothetical protein   99.1 6.5E-11 1.4E-15   75.1   4.5   86   53-147    37-127 (128)
 11 PHA02768 hypothetical protein;  98.9 6.1E-10 1.3E-14   59.3   2.0   40   57-102     6-45  (55)
 12 KOG3608|consensus               98.9 4.4E-09 9.5E-14   75.6   6.3   81   57-143   264-345 (467)
 13 PHA02768 hypothetical protein;  98.8 1.7E-09 3.8E-14   57.6   1.9   43   86-135     5-47  (55)
 14 PF13465 zf-H2C2_2:  Zinc-finge  98.8 2.7E-09 5.8E-14   48.8   2.1   22  103-125     1-22  (26)
 15 PLN03086 PRLI-interacting fact  98.8 2.4E-08 5.2E-13   76.9   7.9   82   53-146   450-541 (567)
 16 PF13465 zf-H2C2_2:  Zinc-finge  98.7 2.4E-08 5.1E-13   45.6   2.7   26   73-100     1-26  (26)
 17 PHA00733 hypothetical protein   98.6 1.1E-07 2.4E-12   60.3   5.4   56   52-113    69-124 (128)
 18 PLN03086 PRLI-interacting fact  98.6   1E-07 2.3E-12   73.5   5.8   85   47-144   471-565 (567)
 19 KOG3993|consensus               98.3 1.1E-07 2.4E-12   69.9   0.5   86   56-147   267-384 (500)
 20 PHA00616 hypothetical protein   98.3 2.7E-07 5.8E-12   46.9   1.6   31   87-120     2-32  (44)
 21 COG5189 SFP1 Putative transcri  98.3 3.2E-07 6.9E-12   65.4   1.7   73   53-140   346-419 (423)
 22 PHA00616 hypothetical protein   98.3 4.8E-07   1E-11   46.0   1.7   33   56-90      1-33  (44)
 23 PHA00732 hypothetical protein   98.1 3.6E-06 7.8E-11   48.8   2.8   48   56-113     1-49  (79)
 24 PHA00732 hypothetical protein   98.1   4E-06 8.7E-11   48.6   2.9   46   86-142     1-47  (79)
 25 PF00096 zf-C2H2:  Zinc finger,  97.8   2E-05 4.2E-10   34.6   2.2   22   57-80      1-22  (23)
 26 PF05605 zf-Di19:  Drought indu  97.7 0.00011 2.4E-09   39.4   4.6   50   87-143     3-53  (54)
 27 PF00096 zf-C2H2:  Zinc finger,  97.7   4E-05 8.7E-10   33.5   2.4   22  118-141     1-22  (23)
 28 KOG3993|consensus               97.6 1.5E-05 3.2E-10   59.1   0.6   27  115-143   456-482 (500)
 29 PF13894 zf-C2H2_4:  C2H2-type   97.6 7.6E-05 1.6E-09   32.7   2.6   23  118-142     1-23  (24)
 30 PF05605 zf-Di19:  Drought indu  97.5 0.00032 6.9E-09   37.7   4.4   49   56-111     2-52  (54)
 31 PF13912 zf-C2H2_6:  C2H2-type   97.4 7.9E-05 1.7E-09   34.0   1.4   25  117-143     1-25  (27)
 32 PF12756 zf-C2H2_2:  C2H2 type   97.3 0.00035 7.6E-09   42.0   3.3   74   58-143     1-74  (100)
 33 PF13894 zf-C2H2_4:  C2H2-type   97.3 0.00036 7.7E-09   30.5   2.5   22   57-80      1-22  (24)
 34 PF13912 zf-C2H2_6:  C2H2-type   97.2 0.00035 7.6E-09   31.7   2.0   23   87-111     2-24  (27)
 35 smart00355 ZnF_C2H2 zinc finge  96.9  0.0012 2.6E-08   29.1   2.6   23  118-142     1-23  (26)
 36 PF09237 GAGA:  GAGA factor;  I  96.7  0.0026 5.7E-08   33.2   3.1   28   84-113    22-49  (54)
 37 PRK04860 hypothetical protein;  96.7  0.0018   4E-08   42.7   2.9   37   86-129   119-155 (160)
 38 smart00355 ZnF_C2H2 zinc finge  96.6  0.0026 5.7E-08   28.0   2.6   19   63-81      5-23  (26)
 39 PF13909 zf-H2C2_5:  C2H2-type   96.6  0.0023   5E-08   28.1   2.1   23  118-143     1-23  (24)
 40 PF09237 GAGA:  GAGA factor;  I  96.4  0.0063 1.4E-07   31.8   3.3   33   52-86     20-52  (54)
 41 PF12874 zf-met:  Zinc-finger o  95.6  0.0078 1.7E-07   26.6   1.4   17   63-79      5-21  (25)
 42 PF12874 zf-met:  Zinc-finger o  95.5   0.014 3.1E-07   25.7   2.0   17   93-109     5-21  (25)
 43 PF13909 zf-H2C2_5:  C2H2-type   95.1   0.027 5.9E-07   24.5   2.2   22   57-81      1-22  (24)
 44 COG5048 FOG: Zn-finger [Genera  94.4  0.0079 1.7E-07   45.1  -0.9   67   55-124   288-358 (467)
 45 KOG4173|consensus               94.2   0.022 4.7E-07   38.8   1.1   85   55-146    78-173 (253)
 46 PRK04860 hypothetical protein;  93.7   0.047   1E-06   36.1   1.9   39   56-102   119-157 (160)
 47 PF12171 zf-C2H2_jaz:  Zinc-fin  93.1   0.022 4.7E-07   25.7  -0.3   21   57-79      2-22  (27)
 48 PF13913 zf-C2HC_2:  zinc-finge  91.8    0.21 4.5E-06   22.1   2.1   20   57-79      3-22  (25)
 49 smart00451 ZnF_U1 U1-like zinc  91.7    0.19   4E-06   23.9   2.0   22  117-140     3-24  (35)
 50 COG5048 FOG: Zn-finger [Genera  90.5    0.05 1.1E-06   40.8  -1.1   57   85-146   288-350 (467)
 51 KOG2893|consensus               90.2   0.056 1.2E-06   37.7  -0.9   33   93-131    15-47  (341)
 52 KOG1146|consensus               89.7    0.12 2.7E-06   44.2   0.5   79   51-141   460-540 (1406)
 53 PF12756 zf-C2H2_2:  C2H2 type   88.0     0.6 1.3E-05   27.6   2.6   24   56-81     50-73  (100)
 54 KOG1146|consensus               87.6    0.55 1.2E-05   40.5   2.9   22  117-140   589-610 (1406)
 55 COG5189 SFP1 Putative transcri  87.3    0.38 8.3E-06   35.2   1.6   25  116-140   348-372 (423)
 56 TIGR00373 conserved hypothetic  86.1     2.1 4.5E-05   28.3   4.6   45   82-138   105-149 (158)
 57 PF02892 zf-BED:  BED zinc fing  84.1    0.97 2.1E-05   22.8   1.9   26  115-140    14-41  (45)
 58 PRK06266 transcription initiat  83.6     3.3 7.1E-05   27.9   4.7   43   83-137   114-156 (178)
 59 COG2888 Predicted Zn-ribbon RN  78.3       3 6.5E-05   22.7   2.5   31   86-124    27-57  (61)
 60 smart00614 ZnF_BED BED zinc fi  77.7     2.8   6E-05   21.7   2.3   22  119-140    20-44  (50)
 61 COG4049 Uncharacterized protei  77.1     1.5 3.2E-05   23.5   1.0   26   82-109    13-38  (65)
 62 PRK14890 putative Zn-ribbon RN  77.1     2.9 6.4E-05   22.7   2.2   30   86-124    25-55  (59)
 63 cd00350 rubredoxin_like Rubred  76.3     1.8 3.9E-05   20.4   1.2   10   57-68      2-11  (33)
 64 smart00531 TFIIE Transcription  76.2     9.9 0.00021   24.7   5.0   40   83-129    96-135 (147)
 65 PF09538 FYDLN_acid:  Protein o  73.7     1.8   4E-05   26.6   1.0   30   57-101    10-39  (108)
 66 COG4049 Uncharacterized protei  73.4     2.3 4.9E-05   22.8   1.2   30   49-80     10-39  (65)
 67 cd00729 rubredoxin_SM Rubredox  72.9     3.1 6.7E-05   19.8   1.5    9  116-124    17-25  (34)
 68 PF13878 zf-C2H2_3:  zinc-finge  72.8     5.3 0.00011   19.9   2.4   26  118-143    14-39  (41)
 69 PF13451 zf-trcl:  Probable zin  72.5     1.8   4E-05   22.6   0.7   20  115-134     2-21  (49)
 70 COG0068 HypF Hydrogenase matur  71.9    0.48   1E-05   38.4  -2.2   61   58-130   125-186 (750)
 71 KOG2186|consensus               71.3     2.7   6E-05   29.8   1.6   49   57-112     4-52  (276)
 72 PF13719 zinc_ribbon_5:  zinc-r  71.2     4.7  0.0001   19.5   2.0    9  117-125    25-33  (37)
 73 TIGR02098 MJ0042_CXXC MJ0042 f  70.4     4.6  0.0001   19.4   1.9    7   63-69      7-13  (38)
 74 KOG2785|consensus               68.5     7.2 0.00016   29.4   3.3   26   56-83    166-191 (390)
 75 PF13717 zinc_ribbon_4:  zinc-r  67.9     6.9 0.00015   18.8   2.2    8   63-70      7-14  (36)
 76 KOG2231|consensus               66.5     8.2 0.00018   31.5   3.4   15   66-80    122-136 (669)
 77 COG5236 Uncharacterized conser  64.6       5 0.00011   30.0   1.8   24   57-80    152-175 (493)
 78 TIGR00373 conserved hypothetic  61.6     6.4 0.00014   25.9   1.8   35   52-99    105-139 (158)
 79 PF12013 DUF3505:  Protein of u  61.0     9.4  0.0002   23.3   2.4   31   47-82     74-108 (109)
 80 KOG4173|consensus               60.5       3 6.4E-05   28.8   0.1   79   29-112    79-171 (253)
 81 PRK06266 transcription initiat  60.3     5.3 0.00012   26.9   1.3   35   53-100   114-148 (178)
 82 PF15269 zf-C2H2_7:  Zinc-finge  60.2     8.5 0.00018   19.6   1.7   22  118-141    21-42  (54)
 83 TIGR02300 FYDLN_acid conserved  59.6     5.8 0.00012   25.2   1.2   32   57-103    10-41  (129)
 84 smart00531 TFIIE Transcription  59.2      13 0.00027   24.2   2.9   39   53-99     96-134 (147)
 85 PF12013 DUF3505:  Protein of u  59.1      11 0.00024   22.9   2.5   25  118-144    81-109 (109)
 86 COG3364 Zn-ribbon containing p  58.8     7.8 0.00017   23.5   1.6   14   86-101     2-15  (112)
 87 PRK00398 rpoP DNA-directed RNA  57.9     4.1   9E-05   20.7   0.3    8  118-125    22-29  (46)
 88 COG1592 Rubrerythrin [Energy p  56.5     8.5 0.00018   25.7   1.7   10  115-124   147-156 (166)
 89 PF05443 ROS_MUCR:  ROS/MUCR tr  56.3      12 0.00027   23.9   2.4   29   53-86     69-97  (132)
 90 smart00659 RPOLCX RNA polymera  55.4      13 0.00029   18.8   2.0    9  117-125    19-27  (44)
 91 KOG2231|consensus               55.4      25 0.00054   28.9   4.4   21   88-110   184-204 (669)
 92 KOG2593|consensus               54.6      18 0.00039   27.9   3.3   37   83-125   125-161 (436)
 93 PF07754 DUF1610:  Domain of un  54.5     7.6 0.00017   17.0   0.8    8  117-124    16-23  (24)
 94 PF09845 DUF2072:  Zn-ribbon co  54.4      10 0.00022   24.2   1.8   13   57-71      2-14  (131)
 95 TIGR00622 ssl1 transcription f  53.8      17 0.00037   22.6   2.6   78   55-142    14-104 (112)
 96 PF04959 ARS2:  Arsenite-resist  53.1      12 0.00027   26.0   2.1   28   53-82     74-102 (214)
 97 COG5236 Uncharacterized conser  52.6      29 0.00062   26.2   4.0   77   58-144   222-306 (493)
 98 KOG4377|consensus               52.5     5.4 0.00012   30.4   0.3   76   52-130   267-360 (480)
 99 KOG4167|consensus               50.7     3.9 8.5E-05   33.5  -0.6   25   56-82    792-816 (907)
100 PF09986 DUF2225:  Uncharacteri  49.8     3.4 7.3E-05   28.7  -1.0   17   55-73      4-20  (214)
101 COG1996 RPC10 DNA-directed RNA  48.4      14 0.00031   19.3   1.4   11   86-98      6-16  (49)
102 COG1675 TFA1 Transcription ini  45.4      54  0.0012   22.2   4.2   42   81-134   108-149 (176)
103 COG4957 Predicted transcriptio  43.8      14  0.0003   23.7   1.1   25   57-86     77-101 (148)
104 PF04959 ARS2:  Arsenite-resist  43.0      21 0.00046   24.9   2.0   25  116-142    76-100 (214)
105 PHA00626 hypothetical protein   41.6      38 0.00083   18.2   2.4   13   56-70     23-35  (59)
106 KOG2186|consensus               41.4      24 0.00051   25.3   2.1   46   87-140     4-49  (276)
107 KOG4167|consensus               41.1     6.9 0.00015   32.2  -0.6   26   86-113   792-817 (907)
108 PF11931 DUF3449:  Domain of un  40.3     9.4  0.0002   26.2   0.0   23  115-138    99-121 (196)
109 smart00734 ZnF_Rad18 Rad18-lik  40.3      36 0.00078   15.0   1.9   19   58-79      3-21  (26)
110 COG5152 Uncharacterized conser  39.6      27 0.00058   24.1   2.0   41   93-140   213-255 (259)
111 PF11789 zf-Nse:  Zinc-finger o  37.0      30 0.00066   18.5   1.7   34   85-125    23-56  (57)
112 PF14353 CpXC:  CpXC protein     36.8      55  0.0012   20.4   3.1    9   58-68      3-11  (128)
113 TIGR02605 CxxC_CxxC_SSSS putat  35.7     8.7 0.00019   19.9  -0.6   11   57-69      6-16  (52)
114 KOG3408|consensus               34.8      29 0.00064   21.9   1.5   24   84-109    55-78  (129)
115 COG4530 Uncharacterized protei  34.2      39 0.00085   20.9   2.0   13   54-68     24-36  (129)
116 KOG2636|consensus               34.0      31 0.00066   26.9   1.8   28  109-138   394-421 (497)
117 KOG2593|consensus               33.9      37  0.0008   26.3   2.2   39   52-97    124-162 (436)
118 PF02176 zf-TRAF:  TRAF-type zi  33.8      40 0.00086   17.7   1.9   21  101-122    23-43  (60)
119 KOG4124|consensus               33.2      16 0.00034   27.5   0.2   53   53-108   175-232 (442)
120 COG1198 PriA Primosomal protei  33.0      13 0.00029   30.8  -0.2   14  111-125   470-483 (730)
121 PF08790 zf-LYAR:  LYAR-type C2  32.3     7.7 0.00017   17.7  -0.9   10   57-68      1-10  (28)
122 PF06397 Desulfoferrod_N:  Desu  31.9      24 0.00052   17.1   0.7   10  116-125     5-14  (36)
123 KOG2785|consensus               29.4      73  0.0016   24.3   3.1   22   57-80      4-25  (390)
124 KOG3002|consensus               29.3 1.2E+02  0.0025   22.5   4.1   85   54-145    78-165 (299)
125 KOG2482|consensus               29.0      36 0.00079   25.6   1.5   23   56-80    195-217 (423)
126 COG1198 PriA Primosomal protei  27.9      57  0.0012   27.3   2.5   15   81-97    470-484 (730)
127 PF08274 PhnA_Zn_Ribbon:  PhnA   27.6      34 0.00075   15.8   0.8    9  116-124    18-26  (30)
128 PF04423 Rad50_zn_hook:  Rad50   26.9      49  0.0011   17.3   1.4    7  119-125    22-28  (54)
129 PF03604 DNA_RNApol_7kD:  DNA d  26.7      40 0.00086   15.8   0.9    8  117-124    17-24  (32)
130 PF08209 Sgf11:  Sgf11 (transcr  26.6      85  0.0018   14.8   2.3   22  117-141     4-25  (33)
131 smart00834 CxxC_CXXC_SSSS Puta  26.0      34 0.00074   16.4   0.7   12   57-70      6-17  (41)
132 PF10571 UPF0547:  Uncharacteri  25.9      37 0.00081   15.0   0.7   11   57-69     15-25  (26)
133 PRK00464 nrdR transcriptional   25.7     9.2  0.0002   25.2  -1.8   16   57-74     29-44  (154)
134 KOG2071|consensus               25.2      49  0.0011   26.7   1.7   26  115-142   416-441 (579)
135 PF04780 DUF629:  Protein of un  24.9      69  0.0015   25.3   2.4   26   56-83     57-83  (466)
136 KOG4727|consensus               23.8      49  0.0011   22.2   1.2   22  117-140    75-96  (193)
137 PRK09678 DNA-binding transcrip  23.1      27 0.00058   19.8  -0.0    6   93-98     34-39  (72)
138 COG3357 Predicted transcriptio  22.6      42 0.00091   20.0   0.7   14   55-70     57-70  (97)
139 KOG0801|consensus               22.3      19 0.00041   23.9  -0.9   20  102-125   127-146 (205)
140 KOG2482|consensus               21.8      58  0.0013   24.6   1.4   22   86-109   195-216 (423)
141 TIGR00143 hypF [NiFe] hydrogen  21.6     6.3 0.00014   32.5  -3.9   60   58-129    92-152 (711)
142 COG1773 Rubredoxin [Energy pro  21.2      51  0.0011   17.7   0.8   10  116-125     2-11  (55)
143 PF15135 UPF0515:  Uncharacteri  21.1      60  0.0013   23.3   1.3   12   57-70    156-167 (278)
144 TIGR00319 desulf_FeS4 desulfof  21.0      57  0.0012   15.1   0.9   10  116-125     6-15  (34)
145 PF09723 Zn-ribbon_8:  Zinc rib  21.0      47   0.001   16.4   0.6   29   57-96      6-34  (42)
146 PF03145 Sina:  Seven in absent  20.9      85  0.0018   21.3   2.1    7  103-109    62-68  (198)
147 cd00974 DSRD Desulforedoxin (D  20.9      58  0.0012   15.2   0.9   10  116-125     3-12  (34)
148 PF07295 DUF1451:  Protein of u  20.1      42 0.00092   21.9   0.4   13  118-131   131-143 (146)

No 1  
>KOG2462|consensus
Probab=99.89  E-value=5.4e-24  Score=146.41  Aligned_cols=107  Identities=22%  Similarity=0.448  Sum_probs=70.7

Q ss_pred             HhhhhcCCCCcceeeccC---CCccC---CCCCceeCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcccccCChH
Q psy11070         29 TEALQSLGINKEYFISST---GGKNS---KKQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMK  102 (148)
Q Consensus        29 ~~~~~~~~~~~~~~~~~~---~~~~h---~~~k~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~f~~~~  102 (148)
                      ...+.+..|++.|...++   |...|   ...+.+.|.  .|+|.|...-.|++|+++|+  .++.|.  .||+.|.+++
T Consensus       128 ~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~--~C~K~YvSmpALkMHirTH~--l~c~C~--iCGKaFSRPW  201 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCK--YCGKVYVSMPALKMHIRTHT--LPCECG--ICGKAFSRPW  201 (279)
T ss_pred             CCceeccccccccccccccchhhcccccccccccccCC--CCCceeeehHHHhhHhhccC--CCcccc--cccccccchH
Confidence            344566677777777665   33333   124556677  77777777777777777765  456677  6777777777


Q ss_pred             HHHHHHHHhcCCCCceeCCCCCCCcccccHHHHHHHHHhhCC
Q psy11070        103 QYSTHLKEHSNVSAPYMCDYKGVCMSLTLKISFVKAVANNSK  144 (148)
Q Consensus       103 ~l~~h~~~h~~~~k~~~C~~c~~~~~f~~~~~l~~h~~~h~~  144 (148)
                      .|+-|+|+|+| ||||.|..|+|  +|..+++|+-|+.+|+.
T Consensus       202 LLQGHiRTHTG-EKPF~C~hC~k--AFADRSNLRAHmQTHS~  240 (279)
T KOG2462|consen  202 LLQGHIRTHTG-EKPFSCPHCGK--AFADRSNLRAHMQTHSD  240 (279)
T ss_pred             HhhcccccccC-CCCccCCcccc--hhcchHHHHHHHHhhcC
Confidence            77777777777 67777777776  47777777777777654


No 2  
>KOG2462|consensus
Probab=99.89  E-value=3.1e-23  Score=142.68  Aligned_cols=104  Identities=22%  Similarity=0.337  Sum_probs=95.3

Q ss_pred             HhhhhcCCCCcceeeccC---CCccCCCCCceeCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcccccCChHHHH
Q psy11070         29 TEALQSLGINKEYFISST---GGKNSKKQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYS  105 (148)
Q Consensus        29 ~~~~~~~~~~~~~~~~~~---~~~~h~~~k~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~f~~~~~l~  105 (148)
                      .....+..|++.|-....   |+++|.  -+++|.  +|||.|.+.=-|+.|+|+|+|||||.|.  .|+++|...++|+
T Consensus       159 ~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~--iCGKaFSRPWLLQGHiRTHTGEKPF~C~--hC~kAFADRSNLR  232 (279)
T KOG2462|consen  159 KKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECG--ICGKAFSRPWLLQGHIRTHTGEKPFSCP--HCGKAFADRSNLR  232 (279)
T ss_pred             cccccCCCCCceeeehHHHhhHhhccC--CCcccc--cccccccchHHhhcccccccCCCCccCC--cccchhcchHHHH
Confidence            455678889999988866   888887  568888  9999999999999999999999999999  9999999999999


Q ss_pred             HHHHHhcCCCCceeCCCCCCCcccccHHHHHHHHHh
Q psy11070        106 THLKEHSNVSAPYMCDYKGVCMSLTLKISFVKAVAN  141 (148)
Q Consensus       106 ~h~~~h~~~~k~~~C~~c~~~~~f~~~~~l~~h~~~  141 (148)
                      .|+++|.+ .|+|.|..|+|  +|...+.|.+|...
T Consensus       233 AHmQTHS~-~K~~qC~~C~K--sFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  233 AHMQTHSD-VKKHQCPRCGK--SFALKSYLNKHSES  265 (279)
T ss_pred             HHHHhhcC-CccccCcchhh--HHHHHHHHHHhhhh
Confidence            99999999 89999999998  79999999999764


No 3  
>KOG1074|consensus
Probab=99.63  E-value=3.2e-17  Score=126.90  Aligned_cols=56  Identities=18%  Similarity=0.279  Sum_probs=51.6

Q ss_pred             CceecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCCCCcccccHHHHHHHHHhhCCC
Q psy11070         85 LTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLTLKISFVKAVANNSKY  145 (148)
Q Consensus        85 ~~~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~f~~~~~l~~h~~~h~~~  145 (148)
                      .|-+|.  .|.++...+.+|+.|.|+|+| ||||+|++||+  +|+.+.+|+.|+.+|.-.
T Consensus       604 dPNqCi--iC~rVlSC~saLqmHyrtHtG-ERPFkCKiCgR--AFtTkGNLkaH~~vHka~  659 (958)
T KOG1074|consen  604 DPNQCI--ICLRVLSCPSALQMHYRTHTG-ERPFKCKICGR--AFTTKGNLKAHMSVHKAK  659 (958)
T ss_pred             Ccccee--eeeecccchhhhhhhhhcccC-cCccccccccc--hhccccchhhcccccccC
Confidence            457799  999999999999999999999 99999999999  599999999999998743


No 4  
>KOG3576|consensus
Probab=99.63  E-value=2.3e-16  Score=104.62  Aligned_cols=89  Identities=22%  Similarity=0.428  Sum_probs=81.5

Q ss_pred             cCCCCCceeCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCCCCccc
Q psy11070         50 NSKKQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSL  129 (148)
Q Consensus        50 ~h~~~k~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~f  129 (148)
                      ..++...|.|.  .|+|.|.....|.+|++-|...+.+.|.  .||+.|..--.|++|+|+|+| .+||+|..|+|  +|
T Consensus       111 sssd~d~ftCr--vCgK~F~lQRmlnrh~kch~~vkr~lct--~cgkgfndtfdlkrh~rthtg-vrpykc~~c~k--af  183 (267)
T KOG3576|consen  111 SSSDQDSFTCR--VCGKKFGLQRMLNRHLKCHSDVKRHLCT--FCGKGFNDTFDLKRHTRTHTG-VRPYKCSLCEK--AF  183 (267)
T ss_pred             CCCCCCeeeee--hhhhhhhHHHHHHHHhhhccHHHHHHHh--hccCcccchhhhhhhhccccC-ccccchhhhhH--HH
Confidence            34556679999  9999999999999999999999999999  999999999999999999999 89999999998  69


Q ss_pred             ccHHHHHHHHHhhCCC
Q psy11070        130 TLKISFVKAVANNSKY  145 (148)
Q Consensus       130 ~~~~~l~~h~~~h~~~  145 (148)
                      +++-.|..|++.-++.
T Consensus       184 tqrcsleshl~kvhgv  199 (267)
T KOG3576|consen  184 TQRCSLESHLKKVHGV  199 (267)
T ss_pred             HhhccHHHHHHHHcCc
Confidence            9999999999877664


No 5  
>KOG3623|consensus
Probab=99.60  E-value=1.6e-16  Score=121.70  Aligned_cols=81  Identities=22%  Similarity=0.467  Sum_probs=76.9

Q ss_pred             CCceeCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCCCCcccccHH
Q psy11070         54 QQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLTLKI  133 (148)
Q Consensus        54 ~k~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~f~~~~  133 (148)
                      +.+|.|.  .|+|.|...+.|.+|.-.|+|.+||+|.  +|.++|+.+-.|..|.|.|.| +|||.|+.|+|  +|....
T Consensus       892 ~gmyaCD--qCDK~FqKqSSLaRHKYEHsGqRPyqC~--iCkKAFKHKHHLtEHkRLHSG-EKPfQCdKClK--RFSHSG  964 (1007)
T KOG3623|consen  892 DGMYACD--QCDKAFQKQSSLARHKYEHSGQRPYQCI--ICKKAFKHKHHLTEHKRLHSG-EKPFQCDKCLK--RFSHSG  964 (1007)
T ss_pred             cccchHH--HHHHHHHhhHHHHHhhhhhcCCCCcccc--hhhHhhhhhhhhhhhhhhccC-CCcchhhhhhh--hccccc
Confidence            4579999  9999999999999999999999999999  999999999999999999999 99999999998  799999


Q ss_pred             HHHHHHHh
Q psy11070        134 SFVKAVAN  141 (148)
Q Consensus       134 ~l~~h~~~  141 (148)
                      .+..||..
T Consensus       965 SYSQHMNH  972 (1007)
T KOG3623|consen  965 SYSQHMNH  972 (1007)
T ss_pred             chHhhhcc
Confidence            99999864


No 6  
>KOG3623|consensus
Probab=99.49  E-value=3.4e-15  Score=114.56  Aligned_cols=112  Identities=22%  Similarity=0.375  Sum_probs=88.9

Q ss_pred             chhHHHHhhhhcCCCCcceeeccC---CCcc--CCCCCceeCCCcccccccCChHHHHHHHHHhcC-------------C
Q psy11070         23 DEEDAITEALQSLGINKEYFISST---GGKN--SKKQQLWSCPIKNCNKRFTTLSNLKMHMVRHGK-------------P   84 (148)
Q Consensus        23 ~~~~~~~~~~~~~~~~~~~~~~~~---~~~~--h~~~k~~~C~~~~C~~~f~~~~~l~~h~~~h~~-------------~   84 (148)
                      ...+.......+..|.+-+.+...   |++.  ...+..|.|.  .|.++|.+.+.|.+||.+|..             -
T Consensus       202 gtpdAfsqlltcpycdrgykrltslkeHikyrhekne~nfsC~--lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~l  279 (1007)
T KOG3623|consen  202 GTPDAFSQLLTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCM--LCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALL  279 (1007)
T ss_pred             CCcchhhhhhcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcch--hhhhhhhhHHHHHHHHHhhcCCCcccccccchhhh
Confidence            334444445566677776665543   4433  2345569999  999999999999999999853             2


Q ss_pred             CceecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCCCCcccccHHHHHHHHHh
Q psy11070         85 LTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLTLKISFVKAVAN  141 (148)
Q Consensus        85 ~~~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~f~~~~~l~~h~~~  141 (148)
                      +.|+|.  .|+++|+.+-.|+.|+|+|.| +|||.|.-|+|  +|.....+..|+..
T Consensus       280 RKFKCt--ECgKAFKfKHHLKEHlRIHSG-EKPfeCpnCkK--RFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  280 RKFKCT--ECGKAFKFKHHLKEHLRIHSG-EKPFECPNCKK--RFSHSGSYSSHMSS  331 (1007)
T ss_pred             cccccc--ccchhhhhHHHHHhhheeecC-CCCcCCccccc--ccccCCcccccccc
Confidence            569999  999999999999999999999 99999999998  79888888888753


No 7  
>KOG3576|consensus
Probab=99.48  E-value=6.2e-15  Score=97.90  Aligned_cols=106  Identities=19%  Similarity=0.255  Sum_probs=88.0

Q ss_pred             hhcCCCCcceeeccC---CCccCCCCCceeCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcccccCChHHHHHHH
Q psy11070         32 LQSLGINKEYFISST---GGKNSKKQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHL  108 (148)
Q Consensus        32 ~~~~~~~~~~~~~~~---~~~~h~~~k~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~f~~~~~l~~h~  108 (148)
                      +.+.-|++.|....-   |++.|+..|.+.|.  .||+.|.....|++|+++|+|.+||.|.  .|+++|.+.-.|-.|.
T Consensus       118 ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct--~cgkgfndtfdlkrh~rthtgvrpykc~--~c~kaftqrcsleshl  193 (267)
T KOG3576|consen  118 FTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCT--FCGKGFNDTFDLKRHTRTHTGVRPYKCS--LCEKAFTQRCSLESHL  193 (267)
T ss_pred             eeeehhhhhhhHHHHHHHHhhhccHHHHHHHh--hccCcccchhhhhhhhccccCccccchh--hhhHHHHhhccHHHHH
Confidence            344557777766543   89999999999999  9999999999999999999999999999  9999999999999998


Q ss_pred             H-HhcC---------CCCceeCCCCCCCcccccHHHHHHHHHhhC
Q psy11070        109 K-EHSN---------VSAPYMCDYKGVCMSLTLKISFVKAVANNS  143 (148)
Q Consensus       109 ~-~h~~---------~~k~~~C~~c~~~~~f~~~~~l~~h~~~h~  143 (148)
                      + +|..         .++.|.|+.||.  .-.....+..|++.|+
T Consensus       194 ~kvhgv~~~yaykerr~kl~vcedcg~--t~~~~e~~~~h~~~~h  236 (267)
T KOG3576|consen  194 KKVHGVQHQYAYKERRAKLYVCEDCGY--TSERPEVYYLHLKLHH  236 (267)
T ss_pred             HHHcCchHHHHHHHhhhheeeecccCC--CCCChhHHHHHHHhcC
Confidence            6 4442         157799999996  3555566778887765


No 8  
>KOG1074|consensus
Probab=99.25  E-value=8.7e-13  Score=102.83  Aligned_cols=85  Identities=20%  Similarity=0.343  Sum_probs=77.0

Q ss_pred             CceeCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcccccCChHHHHHHHHHhcCCC----CceeCC---CCCCCc
Q psy11070         55 QLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVS----APYMCD---YKGVCM  127 (148)
Q Consensus        55 k~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~f~~~~~l~~h~~~h~~~~----k~~~C~---~c~~~~  127 (148)
                      .|..|.  +|.+.+.-...|++|+++|+|++||+|+  +||++|.++.+|+.|+.+|.. .    -+|.|+   +|-+  
T Consensus       604 dPNqCi--iC~rVlSC~saLqmHyrtHtGERPFkCK--iCgRAFtTkGNLkaH~~vHka-~p~~R~q~ScP~~~ic~~--  676 (958)
T KOG1074|consen  604 DPNQCI--ICLRVLSCPSALQMHYRTHTGERPFKCK--ICGRAFTTKGNLKAHMSVHKA-KPPARVQFSCPSTFICQK--  676 (958)
T ss_pred             Ccccee--eeeecccchhhhhhhhhcccCcCccccc--cccchhccccchhhccccccc-CccccccccCCchhhhcc--
Confidence            468899  9999999999999999999999999999  999999999999999999986 3    247899   9987  


Q ss_pred             ccccHHHHHHHHHhhCCCC
Q psy11070        128 SLTLKISFVKAVANNSKYP  146 (148)
Q Consensus       128 ~f~~~~~l~~h~~~h~~~~  146 (148)
                      .|.....|..|+++|.+-.
T Consensus       677 kftn~V~lpQhIriH~~~~  695 (958)
T KOG1074|consen  677 KFTNAVTLPQHIRIHLGGQ  695 (958)
T ss_pred             cccccccccceEEeecCCC
Confidence            6999999999999988544


No 9  
>KOG3608|consensus
Probab=99.24  E-value=4.1e-12  Score=90.87  Aligned_cols=105  Identities=23%  Similarity=0.339  Sum_probs=74.6

Q ss_pred             hhcCCCCcceeeccC---CCccCCCCCceeCCCcccccccCChHHHHHH------------------------------H
Q psy11070         32 LQSLGINKEYFISST---GGKNSKKQQLWSCPIKNCNKRFTTLSNLKMH------------------------------M   78 (148)
Q Consensus        32 ~~~~~~~~~~~~~~~---~~~~h~~~k~~~C~~~~C~~~f~~~~~l~~h------------------------------~   78 (148)
                      +.+..|-+.+..+..   |++.|+++|...|+  .||.-|.+.+.|-.|                              +
T Consensus       180 C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp--~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv  257 (467)
T KOG3608|consen  180 CNWAMCTKHMGNKYRLREHIRTHSNEKVVACP--HCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHV  257 (467)
T ss_pred             ccchhhhhhhccHHHHHHHHHhcCCCeEEecc--hHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHH
Confidence            455556555555543   67777777655555  555555555544444                              4


Q ss_pred             HHhcCCCceecCcCCcccccCChHHHHHHHH-HhcCCCCceeCCCCCCCcccccHHHHHHHHHhhCCC
Q psy11070         79 VRHGKPLTLCCEELGCGRKFQTMKQYSTHLK-EHSNVSAPYMCDYKGVCMSLTLKISFVKAVANNSKY  145 (148)
Q Consensus        79 ~~h~~~~~~~c~~~~C~~~f~~~~~l~~h~~-~h~~~~k~~~C~~c~~~~~f~~~~~l~~h~~~h~~~  145 (148)
                      +.|.  ..|.|+  .|.......+.|..|++ .|.. +|||+|+.|++  +|.+.+.|.+|...|++.
T Consensus       258 ~rHv--n~ykCp--lCdmtc~~~ssL~~H~r~rHs~-dkpfKCd~Cd~--~c~~esdL~kH~~~HS~~  318 (467)
T KOG3608|consen  258 VRHV--NCYKCP--LCDMTCSSASSLTTHIRYRHSK-DKPFKCDECDT--RCVRESDLAKHVQVHSKT  318 (467)
T ss_pred             HHhh--hccccc--ccccCCCChHHHHHHHHhhhcc-CCCccccchhh--hhccHHHHHHHHHhcccc
Confidence            4443  357777  78888888888888887 4777 89999999997  799999999999999854


No 10 
>PHA00733 hypothetical protein
Probab=99.14  E-value=6.5e-11  Score=75.06  Aligned_cols=86  Identities=13%  Similarity=0.109  Sum_probs=71.5

Q ss_pred             CCCceeCCCcccccccCChHHHHHH--HH---HhcCCCceecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCCCCc
Q psy11070         53 KQQLWSCPIKNCNKRFTTLSNLKMH--MV---RHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCM  127 (148)
Q Consensus        53 ~~k~~~C~~~~C~~~f~~~~~l~~h--~~---~h~~~~~~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~  127 (148)
                      .++++.|.  .|.+.|.....|..+  +.   .+.+.+||.|.  .|++.|.....|..|++.|.   .+|.|..|++  
T Consensus        37 ~~~~~~~~--~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~--~Cgk~Fss~s~L~~H~r~h~---~~~~C~~CgK--  107 (128)
T PHA00733         37 EQKRLIRA--VVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCP--LCLMPFSSSVSLKQHIRYTE---HSKVCPVCGK--  107 (128)
T ss_pred             hhhhHHHH--HHhhhccChhhhcchHHHHhhcccCCCCCccCC--CCCCcCCCHHHHHHHHhcCC---cCccCCCCCC--
Confidence            35779999  999888877766655  22   23457899999  99999999999999999763   5799999998  


Q ss_pred             ccccHHHHHHHHHhhCCCCC
Q psy11070        128 SLTLKISFVKAVANNSKYPV  147 (148)
Q Consensus       128 ~f~~~~~l~~h~~~h~~~~~  147 (148)
                      .|.....|..|+...+++=|
T Consensus       108 ~F~~~~sL~~H~~~~h~~~~  127 (128)
T PHA00733        108 EFRNTDSTLDHVCKKHNICV  127 (128)
T ss_pred             ccCCHHHHHHHHHHhcCccc
Confidence            69999999999999888755


No 11 
>PHA02768 hypothetical protein; Provisional
Probab=98.92  E-value=6.1e-10  Score=59.35  Aligned_cols=40  Identities=20%  Similarity=0.475  Sum_probs=18.8

Q ss_pred             eeCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcccccCChH
Q psy11070         57 WSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMK  102 (148)
Q Consensus        57 ~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~f~~~~  102 (148)
                      |.|+  .||+.|...++|..||+.|+  +++.|.  .|++.|.+.+
T Consensus         6 y~C~--~CGK~Fs~~~~L~~H~r~H~--k~~kc~--~C~k~f~~~s   45 (55)
T PHA02768          6 YECP--ICGEIYIKRKSMITHLRKHN--TNLKLS--NCKRISLRTG   45 (55)
T ss_pred             cCcc--hhCCeeccHHHHHHHHHhcC--CcccCC--cccceecccc
Confidence            3444  44444444444444444444  344444  4444444443


No 12 
>KOG3608|consensus
Probab=98.90  E-value=4.4e-09  Score=75.63  Aligned_cols=81  Identities=20%  Similarity=0.441  Sum_probs=48.4

Q ss_pred             eeCCCcccccccCChHHHHHHHHH-hcCCCceecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCCCCcccccHHHH
Q psy11070         57 WSCPIKNCNKRFTTLSNLKMHMVR-HGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLTLKISF  135 (148)
Q Consensus        57 ~~C~~~~C~~~f~~~~~l~~h~~~-h~~~~~~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~f~~~~~l  135 (148)
                      |+|+  .|+-+....+.|..||+. |+..+||+|.  .|...|.+.+.|..|..+|..  -.|.|...++.++|+..-++
T Consensus       264 ykCp--lCdmtc~~~ssL~~H~r~rHs~dkpfKCd--~Cd~~c~~esdL~kH~~~HS~--~~y~C~h~~C~~s~r~~~q~  337 (467)
T KOG3608|consen  264 YKCP--LCDMTCSSASSLTTHIRYRHSKDKPFKCD--ECDTRCVRESDLAKHVQVHSK--TVYQCEHPDCHYSVRTYTQM  337 (467)
T ss_pred             cccc--ccccCCCChHHHHHHHHhhhccCCCcccc--chhhhhccHHHHHHHHHhccc--cceecCCCCCcHHHHHHHHH
Confidence            5566  666666666666666654 5566666666  666666666666666666653  45666664444455566666


Q ss_pred             HHHHHhhC
Q psy11070        136 VKAVANNS  143 (148)
Q Consensus       136 ~~h~~~h~  143 (148)
                      .+|.+-++
T Consensus       338 ~~H~~evh  345 (467)
T KOG3608|consen  338 RRHFLEVH  345 (467)
T ss_pred             HHHHHHhc
Confidence            66655443


No 13 
>PHA02768 hypothetical protein; Provisional
Probab=98.84  E-value=1.7e-09  Score=57.60  Aligned_cols=43  Identities=19%  Similarity=0.223  Sum_probs=37.3

Q ss_pred             ceecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCCCCcccccHHHH
Q psy11070         86 TLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLTLKISF  135 (148)
Q Consensus        86 ~~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~f~~~~~l  135 (148)
                      .|.|+  .||+.|.+.++|..|+++|+   ++|+|..|++  .|.+.+.|
T Consensus         5 ~y~C~--~CGK~Fs~~~~L~~H~r~H~---k~~kc~~C~k--~f~~~s~l   47 (55)
T PHA02768          5 GYECP--ICGEIYIKRKSMITHLRKHN---TNLKLSNCKR--ISLRTGEY   47 (55)
T ss_pred             ccCcc--hhCCeeccHHHHHHHHHhcC---CcccCCcccc--eeccccee
Confidence            47899  99999999999999999996   5799999998  57666554


No 14 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.82  E-value=2.7e-09  Score=48.79  Aligned_cols=22  Identities=32%  Similarity=0.819  Sum_probs=16.2

Q ss_pred             HHHHHHHHhcCCCCceeCCCCCC
Q psy11070        103 QYSTHLKEHSNVSAPYMCDYKGV  125 (148)
Q Consensus       103 ~l~~h~~~h~~~~k~~~C~~c~~  125 (148)
                      +|.+|+++|+| ++||.|+.|++
T Consensus         1 ~l~~H~~~H~~-~k~~~C~~C~k   22 (26)
T PF13465_consen    1 NLRRHMRTHTG-EKPYKCPYCGK   22 (26)
T ss_dssp             HHHHHHHHHSS-SSSEEESSSSE
T ss_pred             CHHHHhhhcCC-CCCCCCCCCcC
Confidence            46677777777 77777777776


No 15 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.80  E-value=2.4e-08  Score=76.89  Aligned_cols=82  Identities=16%  Similarity=0.272  Sum_probs=65.5

Q ss_pred             CCCceeCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCCCCcccc--
Q psy11070         53 KQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLT--  130 (148)
Q Consensus        53 ~~k~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~f~--  130 (148)
                      -++.+.|.  .|++.|. ...|..|+..++  +++.|+   |+..+ ....|..|+.+|.+ .+++.|..|+..  |.  
T Consensus       450 l~~H~~C~--~Cgk~f~-~s~LekH~~~~H--kpv~Cp---Cg~~~-~R~~L~~H~~thCp-~Kpi~C~fC~~~--v~~g  517 (567)
T PLN03086        450 AKNHVHCE--KCGQAFQ-QGEMEKHMKVFH--EPLQCP---CGVVL-EKEQMVQHQASTCP-LRLITCRFCGDM--VQAG  517 (567)
T ss_pred             cccCccCC--CCCCccc-hHHHHHHHHhcC--CCccCC---CCCCc-chhHHHhhhhccCC-CCceeCCCCCCc--cccC
Confidence            34567899  9999996 677999999874  788997   99755 56899999999999 899999999974  43  


Q ss_pred             --------cHHHHHHHHHhhCCCC
Q psy11070        131 --------LKISFVKAVANNSKYP  146 (148)
Q Consensus       131 --------~~~~l~~h~~~h~~~~  146 (148)
                              ..+.|..|...+...+
T Consensus       518 ~~~~d~~d~~s~Lt~HE~~CG~rt  541 (567)
T PLN03086        518 GSAMDVRDRLRGMSEHESICGSRT  541 (567)
T ss_pred             ccccchhhhhhhHHHHHHhcCCcc
Confidence                    2458999998876554


No 16 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.67  E-value=2.4e-08  Score=45.60  Aligned_cols=26  Identities=35%  Similarity=0.654  Sum_probs=23.5

Q ss_pred             HHHHHHHHhcCCCceecCcCCcccccCC
Q psy11070         73 NLKMHMVRHGKPLTLCCEELGCGRKFQT  100 (148)
Q Consensus        73 ~l~~h~~~h~~~~~~~c~~~~C~~~f~~  100 (148)
                      +|..||+.|++++||.|+  .|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~--~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCP--YCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEES--SSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCC--CCcCeeCc
Confidence            488999999999999999  99999863


No 17 
>PHA00733 hypothetical protein
Probab=98.61  E-value=1.1e-07  Score=60.34  Aligned_cols=56  Identities=25%  Similarity=0.508  Sum_probs=49.6

Q ss_pred             CCCCceeCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcccccCChHHHHHHHHHhcC
Q psy11070         52 KKQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSN  113 (148)
Q Consensus        52 ~~~k~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~f~~~~~l~~h~~~h~~  113 (148)
                      .+.++|.|.  .|++.|.....|..|++.|  ..++.|.  .|++.|.....|..|+....+
T Consensus        69 ~~~kPy~C~--~Cgk~Fss~s~L~~H~r~h--~~~~~C~--~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         69 KAVSPYVCP--LCLMPFSSSVSLKQHIRYT--EHSKVCP--VCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCCCCccCC--CCCCcCCCHHHHHHHHhcC--CcCccCC--CCCCccCCHHHHHHHHHHhcC
Confidence            347899999  9999999999999999976  3579999  999999999999999976544


No 18 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.59  E-value=1e-07  Score=73.45  Aligned_cols=85  Identities=21%  Similarity=0.266  Sum_probs=66.4

Q ss_pred             CCccCCCCCceeCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcccccC----------ChHHHHHHHHHhcCCCC
Q psy11070         47 GGKNSKKQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQ----------TMKQYSTHLKEHSNVSA  116 (148)
Q Consensus        47 ~~~~h~~~k~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~f~----------~~~~l~~h~~~h~~~~k  116 (148)
                      |...+.  +++.|+   |++.+ ....|..|+..|.+.+++.|.  .|+..|.          ....|..|..+. | .+
T Consensus       471 H~~~~H--kpv~Cp---Cg~~~-~R~~L~~H~~thCp~Kpi~C~--fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G-~r  540 (567)
T PLN03086        471 HMKVFH--EPLQCP---CGVVL-EKEQMVQHQASTCPLRLITCR--FCGDMVQAGGSAMDVRDRLRGMSEHESIC-G-SR  540 (567)
T ss_pred             HHHhcC--CCccCC---CCCCc-chhHHHhhhhccCCCCceeCC--CCCCccccCccccchhhhhhhHHHHHHhc-C-Cc
Confidence            444442  678887   99765 568899999999999999999  9999885          235899999986 6 79


Q ss_pred             ceeCCCCCCCcccccHHHHHHHHHhhCC
Q psy11070        117 PYMCDYKGVCMSLTLKISFVKAVANNSK  144 (148)
Q Consensus       117 ~~~C~~c~~~~~f~~~~~l~~h~~~h~~  144 (148)
                      ++.|..||+  .|..+ .+..|+-..+.
T Consensus       541 t~~C~~Cgk--~Vrlr-dm~~H~~~~h~  565 (567)
T PLN03086        541 TAPCDSCGR--SVMLK-EMDIHQIAVHQ  565 (567)
T ss_pred             ceEccccCC--eeeeh-hHHHHHHHhhc
Confidence            999999998  45444 67788765543


No 19 
>KOG3993|consensus
Probab=98.35  E-value=1.1e-07  Score=69.93  Aligned_cols=86  Identities=16%  Similarity=0.325  Sum_probs=70.0

Q ss_pred             ceeCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcccccCChHHHHHHHHHhcCC---------------------
Q psy11070         56 LWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNV---------------------  114 (148)
Q Consensus        56 ~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~f~~~~~l~~h~~~h~~~---------------------  114 (148)
                      .|.|.  .|...|.....|..|...-.-...|.|+  .|+++|+-+.+|..|.|=|.-.                     
T Consensus       267 dyiCq--LCK~kYeD~F~LAQHrC~RIV~vEYrCP--EC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~  342 (500)
T KOG3993|consen  267 DYICQ--LCKEKYEDAFALAQHRCPRIVHVEYRCP--ECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEV  342 (500)
T ss_pred             HHHHH--HHHHhhhhHHHHhhccCCeeEEeeecCC--cccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhh
Confidence            49999  9999999999998887643334468999  9999999999999998855410                     


Q ss_pred             -----------CCceeCCCCCCCcccccHHHHHHHHHhhCCCCC
Q psy11070        115 -----------SAPYMCDYKGVCMSLTLKISFVKAVANNSKYPV  147 (148)
Q Consensus       115 -----------~k~~~C~~c~~~~~f~~~~~l~~h~~~h~~~~~  147 (148)
                                 +--|.|..|+|  .|++...|++|+-+|.+.+.
T Consensus       343 ~ea~rsg~dss~gi~~C~~C~K--kFrRqAYLrKHqlthq~~~~  384 (500)
T KOG3993|consen  343 QEAERSGDDSSSGIFSCHTCGK--KFRRQAYLRKHQLTHQRAPL  384 (500)
T ss_pred             hhccccCCcccCceeecHHhhh--hhHHHHHHHHhHHhhhcccc
Confidence                       12489999998  79999999999999887543


No 20 
>PHA00616 hypothetical protein
Probab=98.33  E-value=2.7e-07  Score=46.92  Aligned_cols=31  Identities=23%  Similarity=0.359  Sum_probs=16.4

Q ss_pred             eecCcCCcccccCChHHHHHHHHHhcCCCCceeC
Q psy11070         87 LCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMC  120 (148)
Q Consensus        87 ~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C  120 (148)
                      |+|+  .||+.|...+.|..|++.|+| ++++.|
T Consensus         2 YqC~--~CG~~F~~~s~l~~H~r~~hg-~~~~~~   32 (44)
T PHA00616          2 YQCL--RCGGIFRKKKEVIEHLLSVHK-QNKLTL   32 (44)
T ss_pred             Cccc--hhhHHHhhHHHHHHHHHHhcC-CCccce
Confidence            4555  555555555555555555555 455444


No 21 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=98.29  E-value=3.2e-07  Score=65.38  Aligned_cols=73  Identities=19%  Similarity=0.347  Sum_probs=50.6

Q ss_pred             CCCceeCCCcccccccCChHHHHHHHHH-hcCCCceecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCCCCccccc
Q psy11070         53 KQQLWSCPIKNCNKRFTTLSNLKMHMVR-HGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLTL  131 (148)
Q Consensus        53 ~~k~~~C~~~~C~~~f~~~~~l~~h~~~-h~~~~~~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~f~~  131 (148)
                      ++|||+|+.+.|.|.|+....|+.|+.- |...+...-+.+.--..|            -.. +|||.|++|+|  +++.
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F------------~~~-~KPYrCevC~K--RYKN  410 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIF------------SAK-DKPYRCEVCDK--RYKN  410 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccc------------ccc-CCceeccccch--hhcc
Confidence            3599999999999999999999999875 543333332210100112            233 79999999998  6888


Q ss_pred             HHHHHHHHH
Q psy11070        132 KISFVKAVA  140 (148)
Q Consensus       132 ~~~l~~h~~  140 (148)
                      .-.|+-|+.
T Consensus       411 lNGLKYHr~  419 (423)
T COG5189         411 LNGLKYHRK  419 (423)
T ss_pred             Cccceeccc
Confidence            878877753


No 22 
>PHA00616 hypothetical protein
Probab=98.27  E-value=4.8e-07  Score=46.01  Aligned_cols=33  Identities=21%  Similarity=0.417  Sum_probs=31.0

Q ss_pred             ceeCCCcccccccCChHHHHHHHHHhcCCCceecC
Q psy11070         56 LWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCE   90 (148)
Q Consensus        56 ~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~   90 (148)
                      ||.|+  .||+.|.....|..|++.|+|++++.|.
T Consensus         1 pYqC~--~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCL--RCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccc--hhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            58899  9999999999999999999999998876


No 23 
>PHA00732 hypothetical protein
Probab=98.07  E-value=3.6e-06  Score=48.84  Aligned_cols=48  Identities=27%  Similarity=0.586  Sum_probs=39.0

Q ss_pred             ceeCCCcccccccCChHHHHHHHHH-hcCCCceecCcCCcccccCChHHHHHHHHHhcC
Q psy11070         56 LWSCPIKNCNKRFTTLSNLKMHMVR-HGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSN  113 (148)
Q Consensus        56 ~~~C~~~~C~~~f~~~~~l~~h~~~-h~~~~~~~c~~~~C~~~f~~~~~l~~h~~~h~~  113 (148)
                      ||.|.  .|++.|.....|..|++. |.+   +.|.  .|++.|.   .|..|..+..+
T Consensus         1 py~C~--~Cgk~F~s~s~Lk~H~r~~H~~---~~C~--~CgKsF~---~l~~H~~~~~~   49 (79)
T PHA00732          1 MFKCP--ICGFTTVTLFALKQHARRNHTL---TKCP--VCNKSYR---RLNQHFYSQYD   49 (79)
T ss_pred             CccCC--CCCCccCCHHHHHHHhhcccCC---CccC--CCCCEeC---ChhhhhcccCC
Confidence            57888  999999999999999984 653   4798  9999998   47788876654


No 24 
>PHA00732 hypothetical protein
Probab=98.06  E-value=4e-06  Score=48.63  Aligned_cols=46  Identities=17%  Similarity=0.257  Sum_probs=37.1

Q ss_pred             ceecCcCCcccccCChHHHHHHHH-HhcCCCCceeCCCCCCCcccccHHHHHHHHHhh
Q psy11070         86 TLCCEELGCGRKFQTMKQYSTHLK-EHSNVSAPYMCDYKGVCMSLTLKISFVKAVANN  142 (148)
Q Consensus        86 ~~~c~~~~C~~~f~~~~~l~~h~~-~h~~~~k~~~C~~c~~~~~f~~~~~l~~h~~~h  142 (148)
                      ||.|.  .|++.|.+...|..|++ .|.+    +.|+.||+  .|.   .|..|....
T Consensus         1 py~C~--~Cgk~F~s~s~Lk~H~r~~H~~----~~C~~CgK--sF~---~l~~H~~~~   47 (79)
T PHA00732          1 MFKCP--ICGFTTVTLFALKQHARRNHTL----TKCPVCNK--SYR---RLNQHFYSQ   47 (79)
T ss_pred             CccCC--CCCCccCCHHHHHHHhhcccCC----CccCCCCC--EeC---Chhhhhccc
Confidence            57899  99999999999999998 4655    58999998  465   477777543


No 25 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.81  E-value=2e-05  Score=34.59  Aligned_cols=22  Identities=55%  Similarity=1.026  Sum_probs=11.8

Q ss_pred             eeCCCcccccccCChHHHHHHHHH
Q psy11070         57 WSCPIKNCNKRFTTLSNLKMHMVR   80 (148)
Q Consensus        57 ~~C~~~~C~~~f~~~~~l~~h~~~   80 (148)
                      |.|+  .|++.|.....|..|++.
T Consensus         1 y~C~--~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCP--ICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEET--TTTEEESSHHHHHHHHHH
T ss_pred             CCCC--CCCCccCCHHHHHHHHhH
Confidence            3455  555555555555555544


No 26 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.71  E-value=0.00011  Score=39.45  Aligned_cols=50  Identities=18%  Similarity=0.358  Sum_probs=25.2

Q ss_pred             eecCcCCcccccCChHHHHHHHH-HhcCCCCceeCCCCCCCcccccHHHHHHHHHhhC
Q psy11070         87 LCCEELGCGRKFQTMKQYSTHLK-EHSNVSAPYMCDYKGVCMSLTLKISFVKAVANNS  143 (148)
Q Consensus        87 ~~c~~~~C~~~f~~~~~l~~h~~-~h~~~~k~~~C~~c~~~~~f~~~~~l~~h~~~h~  143 (148)
                      |.|+  .|++ ..+...|..|.. .|..+.+.+.|++|..  .+.  .+|..|+..++
T Consensus         3 f~CP--~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~--~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCP--YCGK-GFSESSLVEHCEDEHRSESKNVVCPICSS--RVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCC--CCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchh--hhh--hHHHHHHHHhc
Confidence            4566  5666 344455666643 3443123466666664  222  25666665544


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.71  E-value=4e-05  Score=33.55  Aligned_cols=22  Identities=23%  Similarity=0.425  Sum_probs=11.9

Q ss_pred             eeCCCCCCCcccccHHHHHHHHHh
Q psy11070        118 YMCDYKGVCMSLTLKISFVKAVAN  141 (148)
Q Consensus       118 ~~C~~c~~~~~f~~~~~l~~h~~~  141 (148)
                      |.|+.|++  .|.....|..|++.
T Consensus         1 y~C~~C~~--~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGK--SFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTE--EESSHHHHHHHHHH
T ss_pred             CCCCCCCC--ccCCHHHHHHHHhH
Confidence            45555554  45555555555554


No 28 
>KOG3993|consensus
Probab=97.64  E-value=1.5e-05  Score=59.09  Aligned_cols=27  Identities=7%  Similarity=0.265  Sum_probs=19.0

Q ss_pred             CCceeCCCCCCCcccccHHHHHHHHHhhC
Q psy11070        115 SAPYMCDYKGVCMSLTLKISFVKAVANNS  143 (148)
Q Consensus       115 ~k~~~C~~c~~~~~f~~~~~l~~h~~~h~  143 (148)
                      +.-|.|..|--  .|.....|.+|+..++
T Consensus       456 ~q~f~~ky~~a--tfyss~~ltrhin~~H  482 (500)
T KOG3993|consen  456 EQGFTCKYCPA--TFYSSPGLTRHINKCH  482 (500)
T ss_pred             hhccccccchH--hhhcCcchHhHhhhcC
Confidence            34577888875  5777778888876544


No 29 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.61  E-value=7.6e-05  Score=32.72  Aligned_cols=23  Identities=17%  Similarity=0.338  Sum_probs=13.3

Q ss_pred             eeCCCCCCCcccccHHHHHHHHHhh
Q psy11070        118 YMCDYKGVCMSLTLKISFVKAVANN  142 (148)
Q Consensus       118 ~~C~~c~~~~~f~~~~~l~~h~~~h  142 (148)
                      |.|++|++  .|.+...|..|+..|
T Consensus         1 ~~C~~C~~--~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGK--SFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS---EESSHHHHHHHHHHH
T ss_pred             CCCcCCCC--cCCcHHHHHHHHHhh
Confidence            45666665  566666666666655


No 30 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.49  E-value=0.00032  Score=37.66  Aligned_cols=49  Identities=24%  Similarity=0.481  Sum_probs=38.4

Q ss_pred             ceeCCCcccccccCChHHHHHHHHH-hcCC-CceecCcCCcccccCChHHHHHHHHHh
Q psy11070         56 LWSCPIKNCNKRFTTLSNLKMHMVR-HGKP-LTLCCEELGCGRKFQTMKQYSTHLKEH  111 (148)
Q Consensus        56 ~~~C~~~~C~~~f~~~~~l~~h~~~-h~~~-~~~~c~~~~C~~~f~~~~~l~~h~~~h  111 (148)
                      .|.|+  .|++ ..+...|..|... |..+ +.+.|+  .|...+.  .+|..|+..+
T Consensus         2 ~f~CP--~C~~-~~~~~~L~~H~~~~H~~~~~~v~CP--iC~~~~~--~~l~~Hl~~~   52 (54)
T PF05605_consen    2 SFTCP--YCGK-GFSESSLVEHCEDEHRSESKNVVCP--ICSSRVT--DNLIRHLNSQ   52 (54)
T ss_pred             CcCCC--CCCC-ccCHHHHHHHHHhHCcCCCCCccCC--Cchhhhh--hHHHHHHHHh
Confidence            48899  9999 5667889999775 6654 569999  9998654  4888998754


No 31 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.44  E-value=7.9e-05  Score=33.96  Aligned_cols=25  Identities=16%  Similarity=0.357  Sum_probs=13.4

Q ss_pred             ceeCCCCCCCcccccHHHHHHHHHhhC
Q psy11070        117 PYMCDYKGVCMSLTLKISFVKAVANNS  143 (148)
Q Consensus       117 ~~~C~~c~~~~~f~~~~~l~~h~~~h~  143 (148)
                      ||.|..|++  .|.....|..|++.|.
T Consensus         1 ~~~C~~C~~--~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGK--TFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTE--EESSHHHHHHHHCTTT
T ss_pred             CCCCCccCC--ccCChhHHHHHhHHhc
Confidence            355555554  4555555555555443


No 32 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.27  E-value=0.00035  Score=41.98  Aligned_cols=74  Identities=12%  Similarity=0.270  Sum_probs=20.6

Q ss_pred             eCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCCCCcccccHHHHHH
Q psy11070         58 SCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLTLKISFVK  137 (148)
Q Consensus        58 ~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~f~~~~~l~~  137 (148)
                      .|.  .|+..|.....|..|+....+...-.      ...+.....+..+.+.-.  ...+.|..|++  .|.....|..
T Consensus         1 ~C~--~C~~~f~~~~~l~~H~~~~H~~~~~~------~~~l~~~~~~~~~~~~~~--~~~~~C~~C~~--~f~s~~~l~~   68 (100)
T PF12756_consen    1 QCL--FCDESFSSVDDLLQHMKKKHGFDIPD------QKYLVDPNRLLNYLRKKV--KESFRCPYCNK--TFRSREALQE   68 (100)
T ss_dssp             ----------------------------------------------------------SSEEBSSSS---EESSHHHHHH
T ss_pred             Ccc--cccccccccccccccccccccccccc------cccccccccccccccccc--CCCCCCCccCC--CCcCHHHHHH
Confidence            377  99999999999999987633321101      112223334444443322  24689999997  5889999999


Q ss_pred             HHHhhC
Q psy11070        138 AVANNS  143 (148)
Q Consensus       138 h~~~h~  143 (148)
                      |++.++
T Consensus        69 Hm~~~~   74 (100)
T PF12756_consen   69 HMRSKH   74 (100)
T ss_dssp             HHHHTT
T ss_pred             HHcCcc
Confidence            998643


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.26  E-value=0.00036  Score=30.45  Aligned_cols=22  Identities=41%  Similarity=0.880  Sum_probs=11.1

Q ss_pred             eeCCCcccccccCChHHHHHHHHH
Q psy11070         57 WSCPIKNCNKRFTTLSNLKMHMVR   80 (148)
Q Consensus        57 ~~C~~~~C~~~f~~~~~l~~h~~~   80 (148)
                      |.|+  .|++.|.+...|..|+..
T Consensus         1 ~~C~--~C~~~~~~~~~l~~H~~~   22 (24)
T PF13894_consen    1 FQCP--ICGKSFRSKSELRQHMRT   22 (24)
T ss_dssp             EE-S--STS-EESSHHHHHHHHHH
T ss_pred             CCCc--CCCCcCCcHHHHHHHHHh
Confidence            3455  555555555555555554


No 34 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.17  E-value=0.00035  Score=31.74  Aligned_cols=23  Identities=26%  Similarity=0.829  Sum_probs=13.0

Q ss_pred             eecCcCCcccccCChHHHHHHHHHh
Q psy11070         87 LCCEELGCGRKFQTMKQYSTHLKEH  111 (148)
Q Consensus        87 ~~c~~~~C~~~f~~~~~l~~h~~~h  111 (148)
                      |.|.  .|++.|.....|..|++.|
T Consensus         2 ~~C~--~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    2 FECD--ECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             EEET--TTTEEESSHHHHHHHHCTT
T ss_pred             CCCC--ccCCccCChhHHHHHhHHh
Confidence            4555  5555555555555555544


No 35 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.92  E-value=0.0012  Score=29.12  Aligned_cols=23  Identities=17%  Similarity=0.309  Sum_probs=13.7

Q ss_pred             eeCCCCCCCcccccHHHHHHHHHhh
Q psy11070        118 YMCDYKGVCMSLTLKISFVKAVANN  142 (148)
Q Consensus       118 ~~C~~c~~~~~f~~~~~l~~h~~~h  142 (148)
                      |.|..|++  .|.....|..|++.|
T Consensus         1 ~~C~~C~~--~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGK--VFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcc--hhCCHHHHHHHHHHh
Confidence            45666665  466666666666644


No 36 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.74  E-value=0.0026  Score=33.24  Aligned_cols=28  Identities=18%  Similarity=0.341  Sum_probs=11.4

Q ss_pred             CCceecCcCCcccccCChHHHHHHHHHhcC
Q psy11070         84 PLTLCCEELGCGRKFQTMKQYSTHLKEHSN  113 (148)
Q Consensus        84 ~~~~~c~~~~C~~~f~~~~~l~~h~~~h~~  113 (148)
                      +.|..|+  .|+..+.+..+|.+|+..+.+
T Consensus        22 ~~PatCP--~C~a~~~~srnLrRHle~~H~   49 (54)
T PF09237_consen   22 EQPATCP--ICGAVIRQSRNLRRHLEIRHF   49 (54)
T ss_dssp             S--EE-T--TT--EESSHHHHHHHHHHHTT
T ss_pred             CCCCCCC--cchhhccchhhHHHHHHHHhc
Confidence            3444555  555555555555555544433


No 37 
>PRK04860 hypothetical protein; Provisional
Probab=96.67  E-value=0.0018  Score=42.65  Aligned_cols=37  Identities=19%  Similarity=0.362  Sum_probs=30.7

Q ss_pred             ceecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCCCCccc
Q psy11070         86 TLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSL  129 (148)
Q Consensus        86 ~~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~f  129 (148)
                      +|.|.   |+.   ....+.+|.++|++ +++|.|..|+..+.|
T Consensus       119 ~Y~C~---C~~---~~~~~rrH~ri~~g-~~~YrC~~C~~~l~~  155 (160)
T PRK04860        119 PYRCK---CQE---HQLTVRRHNRVVRG-EAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEcC---CCC---eeCHHHHHHHHhcC-CccEECCCCCceeEE
Confidence            57885   876   67788999999999 999999999985444


No 38 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.64  E-value=0.0026  Score=27.96  Aligned_cols=19  Identities=47%  Similarity=0.732  Sum_probs=10.5

Q ss_pred             ccccccCChHHHHHHHHHh
Q psy11070         63 NCNKRFTTLSNLKMHMVRH   81 (148)
Q Consensus        63 ~C~~~f~~~~~l~~h~~~h   81 (148)
                      .|++.|.....|..|++.|
T Consensus         5 ~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        5 ECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCcchhCCHHHHHHHHHHh
Confidence            5555555555555555544


No 39 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.58  E-value=0.0023  Score=28.12  Aligned_cols=23  Identities=17%  Similarity=0.307  Sum_probs=14.4

Q ss_pred             eeCCCCCCCcccccHHHHHHHHHhhC
Q psy11070        118 YMCDYKGVCMSLTLKISFVKAVANNS  143 (148)
Q Consensus       118 ~~C~~c~~~~~f~~~~~l~~h~~~h~  143 (148)
                      |+|..|+.  ... ...|..|++.++
T Consensus         1 y~C~~C~y--~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSY--STS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS---EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCC--cCC-HHHHHHHHHhhC
Confidence            57777773  445 667777777754


No 40 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.42  E-value=0.0063  Score=31.84  Aligned_cols=33  Identities=21%  Similarity=0.330  Sum_probs=23.5

Q ss_pred             CCCCceeCCCcccccccCChHHHHHHHHHhcCCCc
Q psy11070         52 KKQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLT   86 (148)
Q Consensus        52 ~~~k~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~   86 (148)
                      ..+.|-.|+  .|+..+.+..+|.+|+....+.+|
T Consensus        20 ~S~~PatCP--~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCP--ICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-T--TT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCC--cchhhccchhhHHHHHHHHhcccC
Confidence            356789999  999999999999999988777665


No 41 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=95.65  E-value=0.0078  Score=26.56  Aligned_cols=17  Identities=35%  Similarity=0.725  Sum_probs=8.4

Q ss_pred             ccccccCChHHHHHHHH
Q psy11070         63 NCNKRFTTLSNLKMHMV   79 (148)
Q Consensus        63 ~C~~~f~~~~~l~~h~~   79 (148)
                      .|++.|.....|..|++
T Consensus         5 ~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    5 ICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             TTTEEESSHHHHHHHHT
T ss_pred             CCCCCcCCHHHHHHHHC
Confidence            55555555555544443


No 42 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=95.49  E-value=0.014  Score=25.67  Aligned_cols=17  Identities=24%  Similarity=0.597  Sum_probs=9.0

Q ss_pred             CcccccCChHHHHHHHH
Q psy11070         93 GCGRKFQTMKQYSTHLK  109 (148)
Q Consensus        93 ~C~~~f~~~~~l~~h~~  109 (148)
                      .|++.|.....|..|++
T Consensus         5 ~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    5 ICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             TTTEEESSHHHHHHHHT
T ss_pred             CCCCCcCCHHHHHHHHC
Confidence            55555555555555544


No 43 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=95.10  E-value=0.027  Score=24.55  Aligned_cols=22  Identities=45%  Similarity=0.925  Sum_probs=11.4

Q ss_pred             eeCCCcccccccCChHHHHHHHHHh
Q psy11070         57 WSCPIKNCNKRFTTLSNLKMHMVRH   81 (148)
Q Consensus        57 ~~C~~~~C~~~f~~~~~l~~h~~~h   81 (148)
                      |.|.  .|+.... ...|..|++.+
T Consensus         1 y~C~--~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    1 YKCP--HCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             EE-S--SSS-EES-HHHHHHHHHHH
T ss_pred             CCCC--CCCCcCC-HHHHHHHHHhh
Confidence            4555  6665555 55666665553


No 44 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.37  E-value=0.0079  Score=45.11  Aligned_cols=67  Identities=21%  Similarity=0.332  Sum_probs=53.6

Q ss_pred             CceeCCCcccccccCChHHHHHHHH--HhcCC--CceecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCC
Q psy11070         55 QLWSCPIKNCNKRFTTLSNLKMHMV--RHGKP--LTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKG  124 (148)
Q Consensus        55 k~~~C~~~~C~~~f~~~~~l~~h~~--~h~~~--~~~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~  124 (148)
                      .++.|.  .|...|.....|..|.+  .|+++  +++.|++..|++.|.+...+..|..+|.+ .+++.+..-.
T Consensus       288 ~~~~~~--~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~  358 (467)
T COG5048         288 LPIKSK--QCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTS-ISPAKEKLLN  358 (467)
T ss_pred             cCCCCc--cccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccC-CCcccccccc
Confidence            356777  88888888888888888  78888  88888855588888888888888888888 7777665544


No 45 
>KOG4173|consensus
Probab=94.21  E-value=0.022  Score=38.76  Aligned_cols=85  Identities=25%  Similarity=0.509  Sum_probs=64.2

Q ss_pred             CceeCCCcccccccCChHHHHHHHHH-hcCCCceecCcCCcccccCChHHHHHHHHH-hc---------CCCCceeCCCC
Q psy11070         55 QLWSCPIKNCNKRFTTLSNLKMHMVR-HGKPLTLCCEELGCGRKFQTMKQYSTHLKE-HS---------NVSAPYMCDYK  123 (148)
Q Consensus        55 k~~~C~~~~C~~~f~~~~~l~~h~~~-h~~~~~~~c~~~~C~~~f~~~~~l~~h~~~-h~---------~~~k~~~C~~c  123 (148)
                      +.+.|+...|...|.....+..|..+ |+.    .|.  .|.+.|.+..-|..|+.- |.         | .--|.|-+=
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~~----sCs--~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG-~dMy~ClvE  150 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHGN----SCS--FCKRAFPTGHLLDAHILEWHDSLFQALVERG-QDMYQCLVE  150 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhcccc----hhH--HHHHhCCchhhhhHHHHHHHHHHHHHHHHcC-ccHHHHHHH
Confidence            45889988999999888888888765 432    588  899999999999888752 22         2 234788665


Q ss_pred             CCCcccccHHHHHHHHHhhCCCC
Q psy11070        124 GVCMSLTLKISFVKAVANNSKYP  146 (148)
Q Consensus       124 ~~~~~f~~~~~l~~h~~~h~~~~  146 (148)
                      ||+..|++.-..+.|+-.-+++|
T Consensus       151 gCt~KFkT~r~RkdH~I~~Hk~P  173 (253)
T KOG4173|consen  151 GCTEKFKTSRDRKDHMIRMHKYP  173 (253)
T ss_pred             hhhhhhhhhhhhhhHHHHhccCC
Confidence            55567999888999988777766


No 46 
>PRK04860 hypothetical protein; Provisional
Probab=93.75  E-value=0.047  Score=36.09  Aligned_cols=39  Identities=15%  Similarity=0.363  Sum_probs=31.4

Q ss_pred             ceeCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcccccCChH
Q psy11070         56 LWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMK  102 (148)
Q Consensus        56 ~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~f~~~~  102 (148)
                      +|.|.   |++   ....+..|.++|+++++|.|.  .|+..|....
T Consensus       119 ~Y~C~---C~~---~~~~~rrH~ri~~g~~~YrC~--~C~~~l~~~~  157 (160)
T PRK04860        119 PYRCK---CQE---HQLTVRRHNRVVRGEAVYRCR--RCGETLVFKG  157 (160)
T ss_pred             EEEcC---CCC---eeCHHHHHHHHhcCCccEECC--CCCceeEEec
Confidence            47775   766   455688999999999999999  9998886543


No 47 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=93.09  E-value=0.022  Score=25.72  Aligned_cols=21  Identities=38%  Similarity=0.808  Sum_probs=12.2

Q ss_pred             eeCCCcccccccCChHHHHHHHH
Q psy11070         57 WSCPIKNCNKRFTTLSNLKMHMV   79 (148)
Q Consensus        57 ~~C~~~~C~~~f~~~~~l~~h~~   79 (148)
                      |.|.  .|++.|.....|..|++
T Consensus         2 ~~C~--~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCD--ACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBT--TTTBBBSSHHHHHCCTT
T ss_pred             CCcc--cCCCCcCCHHHHHHHHc
Confidence            4455  66666666666655543


No 48 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=91.75  E-value=0.21  Score=22.12  Aligned_cols=20  Identities=30%  Similarity=0.725  Sum_probs=13.5

Q ss_pred             eeCCCcccccccCChHHHHHHHH
Q psy11070         57 WSCPIKNCNKRFTTLSNLKMHMV   79 (148)
Q Consensus        57 ~~C~~~~C~~~f~~~~~l~~h~~   79 (148)
                      ..|+  .||+.| ..+.|..|+.
T Consensus         3 ~~C~--~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCP--ICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCC--CCCCEE-CHHHHHHHHH
Confidence            3577  888888 4556777754


No 49 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=91.66  E-value=0.19  Score=23.87  Aligned_cols=22  Identities=23%  Similarity=0.366  Sum_probs=14.7

Q ss_pred             ceeCCCCCCCcccccHHHHHHHHH
Q psy11070        117 PYMCDYKGVCMSLTLKISFVKAVA  140 (148)
Q Consensus       117 ~~~C~~c~~~~~f~~~~~l~~h~~  140 (148)
                      +|.|..|++  .|.....+..|+.
T Consensus         3 ~~~C~~C~~--~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNV--TFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCC--ccCCHHHHHHHHC
Confidence            466777776  4666666666654


No 50 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=90.46  E-value=0.05  Score=40.79  Aligned_cols=57  Identities=18%  Similarity=0.398  Sum_probs=50.4

Q ss_pred             CceecCcCCcccccCChHHHHHHHH--HhcCCC--CceeCC--CCCCCcccccHHHHHHHHHhhCCCC
Q psy11070         85 LTLCCEELGCGRKFQTMKQYSTHLK--EHSNVS--APYMCD--YKGVCMSLTLKISFVKAVANNSKYP  146 (148)
Q Consensus        85 ~~~~c~~~~C~~~f~~~~~l~~h~~--~h~~~~--k~~~C~--~c~~~~~f~~~~~l~~h~~~h~~~~  146 (148)
                      .++.|.  .|...|.....|..|.+  .|++ +  +++.|.  .|++  .|.+...+..|...|.+..
T Consensus       288 ~~~~~~--~~~~~~s~~~~l~~~~~~~~h~~-~~~~~~~~p~~~~~~--~~~~~~~~~~~~~~~~~~~  350 (467)
T COG5048         288 LPIKSK--QCNISFSRSSPLTRHLRSVNHSG-ESLKPFSCPYSLCGK--LFSRNDALKRHILLHTSIS  350 (467)
T ss_pred             cCCCCc--cccCCcccccccccccccccccc-ccCCceeeeccCCCc--cccccccccCCcccccCCC
Confidence            367788  99999999999999999  8999 8  999999  7997  6999999999988887654


No 51 
>KOG2893|consensus
Probab=90.23  E-value=0.056  Score=37.75  Aligned_cols=33  Identities=21%  Similarity=0.315  Sum_probs=25.3

Q ss_pred             CcccccCChHHHHHHHHHhcCCCCceeCCCCCCCccccc
Q psy11070         93 GCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLTL  131 (148)
Q Consensus        93 ~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~f~~  131 (148)
                      .|++.|....-|..|++     .|-|+|-+|-| +.|+.
T Consensus        15 ycnrefddekiliqhqk-----akhfkchichk-kl~sg   47 (341)
T KOG2893|consen   15 YCNREFDDEKILIQHQK-----AKHFKCHICHK-KLFSG   47 (341)
T ss_pred             ecccccchhhhhhhhhh-----hccceeeeehh-hhccC
Confidence            68888988888888776     57788988887 35543


No 52 
>KOG1146|consensus
Probab=89.69  E-value=0.12  Score=44.18  Aligned_cols=79  Identities=18%  Similarity=0.280  Sum_probs=43.8

Q ss_pred             CCCCCceeCCCcccccccCChHHHHHHHHH-hcCCCceecCcCCcccccCChHHHHHHHHHh-cCCCCceeCCCCCCCcc
Q psy11070         51 SKKQQLWSCPIKNCNKRFTTLSNLKMHMVR-HGKPLTLCCEELGCGRKFQTMKQYSTHLKEH-SNVSAPYMCDYKGVCMS  128 (148)
Q Consensus        51 h~~~k~~~C~~~~C~~~f~~~~~l~~h~~~-h~~~~~~~c~~~~C~~~f~~~~~l~~h~~~h-~~~~k~~~C~~c~~~~~  128 (148)
                      ++-.+.++|+  .|+..|+....|..||+. |.....-.|.|     .-... .+ ....+. .+ -++|.|..|..  .
T Consensus       460 ~S~~kt~~cp--kc~~~yk~a~~L~vhmRskhp~~~~~~c~~-----gq~~~-~~-arg~~~~~~-~~p~~C~~C~~--s  527 (1406)
T KOG1146|consen  460 HSFFKTLKCP--KCNWHYKLAQTLGVHMRSKHPESQSAYCKA-----GQNHP-RL-ARGEVYRCP-GKPYPCRACNY--S  527 (1406)
T ss_pred             ecccccccCC--ccchhhhhHHHhhhcccccccccchhHhHh-----ccccc-cc-cccccccCC-CCcccceeeee--e
Confidence            4455677777  888888877778777776 33221111211     00000 00 000111 12 37888998886  6


Q ss_pred             cccHHHHHHHHHh
Q psy11070        129 LTLKISFVKAVAN  141 (148)
Q Consensus       129 f~~~~~l~~h~~~  141 (148)
                      +.....|..|+..
T Consensus       528 tttng~LsihlqS  540 (1406)
T KOG1146|consen  528 TTTNGNLSIHLQS  540 (1406)
T ss_pred             eecchHHHHHHHH
Confidence            7787888888764


No 53 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=88.04  E-value=0.6  Score=27.59  Aligned_cols=24  Identities=38%  Similarity=0.771  Sum_probs=17.3

Q ss_pred             ceeCCCcccccccCChHHHHHHHHHh
Q psy11070         56 LWSCPIKNCNKRFTTLSNLKMHMVRH   81 (148)
Q Consensus        56 ~~~C~~~~C~~~f~~~~~l~~h~~~h   81 (148)
                      .+.|.  .|++.|.+...|..||+.+
T Consensus        50 ~~~C~--~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCP--YCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBS--SSS-EESSHHHHHHHHHHT
T ss_pred             CCCCC--ccCCCCcCHHHHHHHHcCc
Confidence            47777  8888888888888887763


No 54 
>KOG1146|consensus
Probab=87.61  E-value=0.55  Score=40.49  Aligned_cols=22  Identities=5%  Similarity=0.135  Sum_probs=12.8

Q ss_pred             ceeCCCCCCCcccccHHHHHHHHH
Q psy11070        117 PYMCDYKGVCMSLTLKISFVKAVA  140 (148)
Q Consensus       117 ~~~C~~c~~~~~f~~~~~l~~h~~  140 (148)
                      .+.|.+|+..  -.-.-+|..|+.
T Consensus       589 ~~~C~vc~ye--tniarnlrihmt  610 (1406)
T KOG1146|consen  589 SWRCEVCSYE--TNIARNLRIHMT  610 (1406)
T ss_pred             Ccchhhhcch--hhhhhccccccc
Confidence            3789999853  333335555543


No 55 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=87.27  E-value=0.38  Score=35.15  Aligned_cols=25  Identities=16%  Similarity=0.295  Sum_probs=13.0

Q ss_pred             CceeCCCCCCCcccccHHHHHHHHH
Q psy11070        116 APYMCDYKGVCMSLTLKISFVKAVA  140 (148)
Q Consensus       116 k~~~C~~c~~~~~f~~~~~l~~h~~  140 (148)
                      |||+|++.||.+.++..-.|+-|+.
T Consensus       348 KpykCpV~gC~K~YknqnGLKYH~l  372 (423)
T COG5189         348 KPYKCPVEGCNKKYKNQNGLKYHML  372 (423)
T ss_pred             ceecCCCCCchhhhccccchhhhhh
Confidence            5555555554445555555555544


No 56 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=86.13  E-value=2.1  Score=28.26  Aligned_cols=45  Identities=9%  Similarity=0.197  Sum_probs=32.4

Q ss_pred             cCCCceecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCCCCcccccHHHHHHH
Q psy11070         82 GKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLTLKISFVKA  138 (148)
Q Consensus        82 ~~~~~~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~f~~~~~l~~h  138 (148)
                      .+..-|.|+  .|+..|+...++.          --|.|+.||..+.+...+.+..-
T Consensus       105 ~~~~~Y~Cp--~c~~r~tf~eA~~----------~~F~Cp~Cg~~L~~~dn~~~i~~  149 (158)
T TIGR00373       105 TNNMFFICP--NMCVRFTFNEAME----------LNFTCPRCGAMLDYLDNSEAIEK  149 (158)
T ss_pred             cCCCeEECC--CCCcEeeHHHHHH----------cCCcCCCCCCEeeeccCHHHHHH
Confidence            445669999  9999998888774          23999999986555555554443


No 57 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=84.14  E-value=0.97  Score=22.77  Aligned_cols=26  Identities=12%  Similarity=0.257  Sum_probs=14.6

Q ss_pred             CCceeCCCCCCCcccc--cHHHHHHHHH
Q psy11070        115 SAPYMCDYKGVCMSLT--LKISFVKAVA  140 (148)
Q Consensus       115 ~k~~~C~~c~~~~~f~--~~~~l~~h~~  140 (148)
                      .....|..|++.+...  ..+.|..|++
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL~   41 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHLK   41 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHHH
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhhh
Confidence            4456788888754453  5567888874


No 58 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=83.59  E-value=3.3  Score=27.92  Aligned_cols=43  Identities=14%  Similarity=0.294  Sum_probs=29.9

Q ss_pred             CCCceecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCCCCcccccHHHHHH
Q psy11070         83 KPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLTLKISFVK  137 (148)
Q Consensus        83 ~~~~~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~f~~~~~l~~  137 (148)
                      ...-|.|+  .|+..|....++.          --|.|+.||..+.+-..+.+..
T Consensus       114 ~~~~Y~Cp--~C~~rytf~eA~~----------~~F~Cp~Cg~~L~~~dn~~~~~  156 (178)
T PRK06266        114 NNMFFFCP--NCHIRFTFDEAME----------YGFRCPQCGEMLEEYDNSELIK  156 (178)
T ss_pred             CCCEEECC--CCCcEEeHHHHhh----------cCCcCCCCCCCCeecccHHHHH
Confidence            44568999  8999888887652          2499999997655544444433


No 59 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=78.31  E-value=3  Score=22.66  Aligned_cols=31  Identities=23%  Similarity=0.443  Sum_probs=17.1

Q ss_pred             ceecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCC
Q psy11070         86 TLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKG  124 (148)
Q Consensus        86 ~~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~  124 (148)
                      .|.|+  .||...-....--   |.+   ..+|.|+.||
T Consensus        27 ~F~CP--nCGe~~I~Rc~~C---Rk~---g~~Y~Cp~CG   57 (61)
T COG2888          27 KFPCP--NCGEVEIYRCAKC---RKL---GNPYRCPKCG   57 (61)
T ss_pred             EeeCC--CCCceeeehhhhH---HHc---CCceECCCcC
Confidence            47777  7775433332211   111   3678888887


No 60 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=77.68  E-value=2.8  Score=21.75  Aligned_cols=22  Identities=18%  Similarity=0.303  Sum_probs=11.9

Q ss_pred             eCCCCCCCcccc---cHHHHHHHHH
Q psy11070        119 MCDYKGVCMSLT---LKISFVKAVA  140 (148)
Q Consensus       119 ~C~~c~~~~~f~---~~~~l~~h~~  140 (148)
                      .|..|++.++..   ..+.|.+|++
T Consensus        20 ~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       20 KCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EecCCCCEeeeCCCCCcHHHHHHHH
Confidence            466666643332   2356666666


No 61 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=77.06  E-value=1.5  Score=23.50  Aligned_cols=26  Identities=31%  Similarity=0.579  Sum_probs=19.3

Q ss_pred             cCCCceecCcCCcccccCChHHHHHHHH
Q psy11070         82 GKPLTLCCEELGCGRKFQTMKQYSTHLK  109 (148)
Q Consensus        82 ~~~~~~~c~~~~C~~~f~~~~~l~~h~~  109 (148)
                      .|+.-+.|+  .|+..|.......+|..
T Consensus        13 DGE~~lrCP--RC~~~FR~~K~Y~RHVN   38 (65)
T COG4049          13 DGEEFLRCP--RCGMVFRRRKDYIRHVN   38 (65)
T ss_pred             CCceeeeCC--chhHHHHHhHHHHHHhh
Confidence            456667788  88888888877777775


No 62 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=77.06  E-value=2.9  Score=22.68  Aligned_cols=30  Identities=27%  Similarity=0.706  Sum_probs=17.8

Q ss_pred             ceecCcCCcccc-cCChHHHHHHHHHhcCCCCceeCCCCC
Q psy11070         86 TLCCEELGCGRK-FQTMKQYSTHLKEHSNVSAPYMCDYKG  124 (148)
Q Consensus        86 ~~~c~~~~C~~~-f~~~~~l~~h~~~h~~~~k~~~C~~c~  124 (148)
                      .|.|+  .||.. ..+=..-    |..   ..+|.|+.||
T Consensus        25 ~F~CP--nCG~~~I~RC~~C----Rk~---~~~Y~CP~CG   55 (59)
T PRK14890         25 KFLCP--NCGEVIIYRCEKC----RKQ---SNPYTCPKCG   55 (59)
T ss_pred             EeeCC--CCCCeeEeechhH----Hhc---CCceECCCCC
Confidence            47888  88876 3222111    111   4679999988


No 63 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=76.33  E-value=1.8  Score=20.41  Aligned_cols=10  Identities=30%  Similarity=1.082  Sum_probs=5.5

Q ss_pred             eeCCCccccccc
Q psy11070         57 WSCPIKNCNKRF   68 (148)
Q Consensus        57 ~~C~~~~C~~~f   68 (148)
                      |.|.  .||..+
T Consensus         2 ~~C~--~CGy~y   11 (33)
T cd00350           2 YVCP--VCGYIY   11 (33)
T ss_pred             EECC--CCCCEE
Confidence            4555  666554


No 64 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=76.22  E-value=9.9  Score=24.67  Aligned_cols=40  Identities=15%  Similarity=0.326  Sum_probs=26.0

Q ss_pred             CCCceecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCCCCccc
Q psy11070         83 KPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSL  129 (148)
Q Consensus        83 ~~~~~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~f  129 (148)
                      +..-|.|+  .|+..|.....+.. .  . . +..|.|+.||.....
T Consensus        96 ~~~~Y~Cp--~C~~~y~~~ea~~~-~--d-~-~~~f~Cp~Cg~~l~~  135 (147)
T smart00531       96 NNAYYKCP--NCQSKYTFLEANQL-L--D-M-DGTFTCPRCGEELEE  135 (147)
T ss_pred             CCcEEECc--CCCCEeeHHHHHHh-c--C-C-CCcEECCCCCCEEEE
Confidence            44569999  99999886554332 0  1 1 233999999975433


No 65 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=73.71  E-value=1.8  Score=26.64  Aligned_cols=30  Identities=30%  Similarity=0.847  Sum_probs=19.9

Q ss_pred             eeCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcccccCCh
Q psy11070         57 WSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTM  101 (148)
Q Consensus        57 ~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~f~~~  101 (148)
                      ..|+  .||++|....           ..|-.|+  .||..|...
T Consensus        10 R~Cp--~CG~kFYDLn-----------k~PivCP--~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCP--SCGAKFYDLN-----------KDPIVCP--KCGTEFPPE   39 (108)
T ss_pred             ccCC--CCcchhccCC-----------CCCccCC--CCCCccCcc
Confidence            3677  8887775432           3566788  788777665


No 66 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=73.44  E-value=2.3  Score=22.78  Aligned_cols=30  Identities=17%  Similarity=0.528  Sum_probs=25.1

Q ss_pred             ccCCCCCceeCCCcccccccCChHHHHHHHHH
Q psy11070         49 KNSKKQQLWSCPIKNCNKRFTTLSNLKMHMVR   80 (148)
Q Consensus        49 ~~h~~~k~~~C~~~~C~~~f~~~~~l~~h~~~   80 (148)
                      +...|+..+.|+  -|+..|.....+.+|...
T Consensus        10 ~~RDGE~~lrCP--RC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          10 RDRDGEEFLRCP--RCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             eccCCceeeeCC--chhHHHHHhHHHHHHhhH
Confidence            344577889999  999999999999999875


No 67 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=72.95  E-value=3.1  Score=19.82  Aligned_cols=9  Identities=44%  Similarity=0.733  Sum_probs=4.9

Q ss_pred             CceeCCCCC
Q psy11070        116 APYMCDYKG  124 (148)
Q Consensus       116 k~~~C~~c~  124 (148)
                      .|..|++||
T Consensus        17 ~p~~CP~Cg   25 (34)
T cd00729          17 APEKCPICG   25 (34)
T ss_pred             CCCcCcCCC
Confidence            344566665


No 68 
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=72.80  E-value=5.3  Score=19.90  Aligned_cols=26  Identities=12%  Similarity=-0.078  Sum_probs=13.6

Q ss_pred             eeCCCCCCCcccccHHHHHHHHHhhC
Q psy11070        118 YMCDYKGVCMSLTLKISFVKAVANNS  143 (148)
Q Consensus       118 ~~C~~c~~~~~f~~~~~l~~h~~~h~  143 (148)
                      -.|+.||=.+.......-..|.+.|.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            35666664444444555555555554


No 69 
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=72.53  E-value=1.8  Score=22.57  Aligned_cols=20  Identities=15%  Similarity=0.169  Sum_probs=15.8

Q ss_pred             CCceeCCCCCCCcccccHHH
Q psy11070        115 SAPYMCDYKGVCMSLTLKIS  134 (148)
Q Consensus       115 ~k~~~C~~c~~~~~f~~~~~  134 (148)
                      ++.+.|..||..|.|+-...
T Consensus         2 Dk~l~C~dCg~~FvfTa~EQ   21 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTAGEQ   21 (49)
T ss_pred             CeeEEcccCCCeEEEehhHH
Confidence            57899999999888865543


No 70 
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=71.93  E-value=0.48  Score=38.37  Aligned_cols=61  Identities=23%  Similarity=0.480  Sum_probs=42.6

Q ss_pred             eCCCcccccccCChHHHHHHHHHhcCCCce-ecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCCCCcccc
Q psy11070         58 SCPIKNCNKRFTTLSNLKMHMVRHGKPLTL-CCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLT  130 (148)
Q Consensus        58 ~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~-~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~f~  130 (148)
                      .|.  .||.+|+....|..- |.+|....| .|+  .|.+.|..+.+-+    .|   ..|..|+.||-...+.
T Consensus       125 ~CT--~CGPRfTIi~alPYD-R~nTsM~~F~lC~--~C~~EY~dP~nRR----fH---AQp~aCp~CGP~~~l~  186 (750)
T COG0068         125 NCT--NCGPRFTIIEALPYD-RENTSMADFPLCP--FCDKEYKDPLNRR----FH---AQPIACPKCGPHLFLV  186 (750)
T ss_pred             ccC--CCCcceeeeccCCCC-cccCccccCcCCH--HHHHHhcCccccc----cc---cccccCcccCCCeEEE
Confidence            488  999999987776432 334444443 488  8999998887644    44   4689999999644444


No 71 
>KOG2186|consensus
Probab=71.32  E-value=2.7  Score=29.81  Aligned_cols=49  Identities=24%  Similarity=0.596  Sum_probs=30.5

Q ss_pred             eeCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcccccCChHHHHHHHHHhc
Q psy11070         57 WSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQYSTHLKEHS  112 (148)
Q Consensus        57 ~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~f~~~~~l~~h~~~h~  112 (148)
                      |.|.  .||.+.... .+..|+-.=++ ..|.|.  -|+..|.+ .....|..--+
T Consensus         4 FtCn--vCgEsvKKp-~vekH~srCrn-~~fSCI--DC~k~F~~-~sYknH~kCIT   52 (276)
T KOG2186|consen    4 FTCN--VCGESVKKP-QVEKHMSRCRN-AYFSCI--DCGKTFER-VSYKNHTKCIT   52 (276)
T ss_pred             Eehh--hhhhhcccc-chHHHHHhccC-CeeEEe--eccccccc-chhhhhhhhcc
Confidence            5666  777766544 35667665444 457777  77777776 55666655443


No 72 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=71.18  E-value=4.7  Score=19.53  Aligned_cols=9  Identities=22%  Similarity=0.265  Sum_probs=4.0

Q ss_pred             ceeCCCCCC
Q psy11070        117 PYMCDYKGV  125 (148)
Q Consensus       117 ~~~C~~c~~  125 (148)
                      ..+|+.|+.
T Consensus        25 ~vrC~~C~~   33 (37)
T PF13719_consen   25 KVRCPKCGH   33 (37)
T ss_pred             EEECCCCCc
Confidence            344444443


No 73 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=70.41  E-value=4.6  Score=19.43  Aligned_cols=7  Identities=43%  Similarity=1.084  Sum_probs=3.2

Q ss_pred             ccccccC
Q psy11070         63 NCNKRFT   69 (148)
Q Consensus        63 ~C~~~f~   69 (148)
                      .|+..|.
T Consensus         7 ~C~~~~~   13 (38)
T TIGR02098         7 NCKTSFR   13 (38)
T ss_pred             CCCCEEE
Confidence            4444443


No 74 
>KOG2785|consensus
Probab=68.47  E-value=7.2  Score=29.43  Aligned_cols=26  Identities=23%  Similarity=0.371  Sum_probs=21.6

Q ss_pred             ceeCCCcccccccCChHHHHHHHHHhcC
Q psy11070         56 LWSCPIKNCNKRFTTLSNLKMHMVRHGK   83 (148)
Q Consensus        56 ~~~C~~~~C~~~f~~~~~l~~h~~~h~~   83 (148)
                      |--|.  .|++.+.....-..||..++|
T Consensus       166 Pt~CL--fC~~~~k~~e~~~~HM~~~Hg  191 (390)
T KOG2785|consen  166 PTDCL--FCDKKSKSLEENLKHMFKEHG  191 (390)
T ss_pred             Cccee--ecCCCcccHHHHHHHHhhccC
Confidence            45688  999999999888999988665


No 75 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=67.91  E-value=6.9  Score=18.85  Aligned_cols=8  Identities=25%  Similarity=0.945  Sum_probs=3.6

Q ss_pred             ccccccCC
Q psy11070         63 NCNKRFTT   70 (148)
Q Consensus        63 ~C~~~f~~   70 (148)
                      .|+..|.-
T Consensus         7 ~C~~~y~i   14 (36)
T PF13717_consen    7 NCQAKYEI   14 (36)
T ss_pred             CCCCEEeC
Confidence            44444443


No 76 
>KOG2231|consensus
Probab=66.48  E-value=8.2  Score=31.50  Aligned_cols=15  Identities=40%  Similarity=0.620  Sum_probs=9.0

Q ss_pred             cccCChHHHHHHHHH
Q psy11070         66 KRFTTLSNLKMHMVR   80 (148)
Q Consensus        66 ~~f~~~~~l~~h~~~   80 (148)
                      ..|.....|+.|+..
T Consensus       122 ~~~~s~~~Lk~H~~~  136 (669)
T KOG2231|consen  122 TEFKSVENLKNHMRD  136 (669)
T ss_pred             cchhHHHHHHHHHHH
Confidence            334466777777743


No 77 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=64.56  E-value=5  Score=29.96  Aligned_cols=24  Identities=33%  Similarity=0.772  Sum_probs=14.8

Q ss_pred             eeCCCcccccccCChHHHHHHHHH
Q psy11070         57 WSCPIKNCNKRFTTLSNLKMHMVR   80 (148)
Q Consensus        57 ~~C~~~~C~~~f~~~~~l~~h~~~   80 (148)
                      |.|+-..|..+......|+.|.+.
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~  175 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKA  175 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHh
Confidence            666655666655555666666665


No 78 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=61.65  E-value=6.4  Score=25.95  Aligned_cols=35  Identities=29%  Similarity=0.674  Sum_probs=27.3

Q ss_pred             CCCCceeCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcccccC
Q psy11070         52 KKQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQ   99 (148)
Q Consensus        52 ~~~k~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~f~   99 (148)
                      .+..-|.|+  .|+.+|+....+.         ..|.|+  .||....
T Consensus       105 ~~~~~Y~Cp--~c~~r~tf~eA~~---------~~F~Cp--~Cg~~L~  139 (158)
T TIGR00373       105 TNNMFFICP--NMCVRFTFNEAME---------LNFTCP--RCGAMLD  139 (158)
T ss_pred             cCCCeEECC--CCCcEeeHHHHHH---------cCCcCC--CCCCEee
Confidence            344569999  9999998887764         269999  9997654


No 79 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=60.97  E-value=9.4  Score=23.28  Aligned_cols=31  Identities=16%  Similarity=0.376  Sum_probs=23.6

Q ss_pred             CCccCCCCCceeC----CCcccccccCChHHHHHHHHHhc
Q psy11070         47 GGKNSKKQQLWSC----PIKNCNKRFTTLSNLKMHMVRHG   82 (148)
Q Consensus        47 ~~~~h~~~k~~~C----~~~~C~~~f~~~~~l~~h~~~h~   82 (148)
                      .+.++.|   |.|    .  .|+....+...+..|.+.+.
T Consensus        74 gLp~~~G---~~C~~~~~--~C~y~~~~~~~m~~H~~~~H  108 (109)
T PF12013_consen   74 GLPVYDG---YRCQCDPP--HCGYITRSKKTMRKHWRKEH  108 (109)
T ss_pred             CCCCCCC---eeeecCCC--CCCcEeccHHHHHHHHHHhc
Confidence            3445544   888    6  99999999999999988754


No 80 
>KOG4173|consensus
Probab=60.46  E-value=3  Score=28.75  Aligned_cols=79  Identities=24%  Similarity=0.336  Sum_probs=55.6

Q ss_pred             HhhhhcCCCCcceeeccC---CCccCCCCCceeCCCcccccccCChHHHHHHHHH-h---------cCCCceecCcCCcc
Q psy11070         29 TEALQSLGINKEYFISST---GGKNSKKQQLWSCPIKNCNKRFTTLSNLKMHMVR-H---------GKPLTLCCEELGCG   95 (148)
Q Consensus        29 ~~~~~~~~~~~~~~~~~~---~~~~h~~~k~~~C~~~~C~~~f~~~~~l~~h~~~-h---------~~~~~~~c~~~~C~   95 (148)
                      ...+...+|...|...-.   |...-.+   ..|.  .|.+.|.+..-|..|+.. |         .|.-.|+|..++|+
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs--~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt  153 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHG---NSCS--FCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCT  153 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhccc---chhH--HHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhh
Confidence            334566677776665532   2211111   3799  999999999999999864 4         34556999877899


Q ss_pred             cccCChHHHHHHH-HHhc
Q psy11070         96 RKFQTMKQYSTHL-KEHS  112 (148)
Q Consensus        96 ~~f~~~~~l~~h~-~~h~  112 (148)
                      ..|.+...-+.|+ +.|.
T Consensus       154 ~KFkT~r~RkdH~I~~Hk  171 (253)
T KOG4173|consen  154 EKFKTSRDRKDHMIRMHK  171 (253)
T ss_pred             hhhhhhhhhhhHHHHhcc
Confidence            9999999999997 4554


No 81 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=60.30  E-value=5.3  Score=26.93  Aligned_cols=35  Identities=29%  Similarity=0.744  Sum_probs=26.7

Q ss_pred             CCCceeCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcccccCC
Q psy11070         53 KQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQT  100 (148)
Q Consensus        53 ~~k~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~f~~  100 (148)
                      +..-|.|+  .|+.+|+....+.         ..|.|+  .||.....
T Consensus       114 ~~~~Y~Cp--~C~~rytf~eA~~---------~~F~Cp--~Cg~~L~~  148 (178)
T PRK06266        114 NNMFFFCP--NCHIRFTFDEAME---------YGFRCP--QCGEMLEE  148 (178)
T ss_pred             CCCEEECC--CCCcEEeHHHHhh---------cCCcCC--CCCCCCee
Confidence            34569999  9999998877652         369999  99976543


No 82 
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=60.20  E-value=8.5  Score=19.62  Aligned_cols=22  Identities=14%  Similarity=0.149  Sum_probs=14.1

Q ss_pred             eeCCCCCCCcccccHHHHHHHHHh
Q psy11070        118 YMCDYKGVCMSLTLKISFVKAVAN  141 (148)
Q Consensus       118 ~~C~~c~~~~~f~~~~~l~~h~~~  141 (148)
                      |+|-+|.  |....++.|-.|++.
T Consensus        21 ykcfqcp--ftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCP--FTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCC--cccchHHHHHHHHHH
Confidence            5576666  455667777777653


No 83 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=59.58  E-value=5.8  Score=25.15  Aligned_cols=32  Identities=22%  Similarity=0.392  Sum_probs=19.6

Q ss_pred             eeCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcccccCChHH
Q psy11070         57 WSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQTMKQ  103 (148)
Q Consensus        57 ~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~f~~~~~  103 (148)
                      ..|+  .||++|....           ..|-.|+  .||..|.....
T Consensus        10 r~Cp--~cg~kFYDLn-----------k~p~vcP--~cg~~~~~~~~   41 (129)
T TIGR02300        10 RICP--NTGSKFYDLN-----------RRPAVSP--YTGEQFPPEEA   41 (129)
T ss_pred             ccCC--CcCccccccC-----------CCCccCC--CcCCccCcchh
Confidence            4677  7777775422           3466777  77777655533


No 84 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=59.16  E-value=13  Score=24.17  Aligned_cols=39  Identities=26%  Similarity=0.692  Sum_probs=26.3

Q ss_pred             CCCceeCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcccccC
Q psy11070         53 KQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRKFQ   99 (148)
Q Consensus        53 ~~k~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~f~   99 (148)
                      +..-|.|+  .|+..|.....+..   ... ...|.|+  .||....
T Consensus        96 ~~~~Y~Cp--~C~~~y~~~ea~~~---~d~-~~~f~Cp--~Cg~~l~  134 (147)
T smart00531       96 NNAYYKCP--NCQSKYTFLEANQL---LDM-DGTFTCP--RCGEELE  134 (147)
T ss_pred             CCcEEECc--CCCCEeeHHHHHHh---cCC-CCcEECC--CCCCEEE
Confidence            34569999  99999986554321   122 3349999  9997664


No 85 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=59.08  E-value=11  Score=22.93  Aligned_cols=25  Identities=20%  Similarity=0.186  Sum_probs=21.4

Q ss_pred             eeC----CCCCCCcccccHHHHHHHHHhhCC
Q psy11070        118 YMC----DYKGVCMSLTLKISFVKAVANNSK  144 (148)
Q Consensus       118 ~~C----~~c~~~~~f~~~~~l~~h~~~h~~  144 (148)
                      |.|    ..|+.  .+.....+++|.+.++|
T Consensus        81 ~~C~~~~~~C~y--~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGY--ITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCc--EeccHHHHHHHHHHhcC
Confidence            889    88874  78899999999998775


No 86 
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=58.77  E-value=7.8  Score=23.54  Aligned_cols=14  Identities=29%  Similarity=0.653  Sum_probs=7.1

Q ss_pred             ceecCcCCcccccCCh
Q psy11070         86 TLCCEELGCGRKFQTM  101 (148)
Q Consensus        86 ~~~c~~~~C~~~f~~~  101 (148)
                      |++|.  .||..|..-
T Consensus         2 pH~Ct--rCG~vf~~g   15 (112)
T COG3364           2 PHQCT--RCGEVFDDG   15 (112)
T ss_pred             Cceec--ccccccccc
Confidence            34555  555555543


No 87 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=57.85  E-value=4.1  Score=20.68  Aligned_cols=8  Identities=38%  Similarity=0.771  Sum_probs=3.9

Q ss_pred             eeCCCCCC
Q psy11070        118 YMCDYKGV  125 (148)
Q Consensus       118 ~~C~~c~~  125 (148)
                      ..|+.||.
T Consensus        22 ~~Cp~CG~   29 (46)
T PRK00398         22 VRCPYCGY   29 (46)
T ss_pred             eECCCCCC
Confidence            45555553


No 88 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=56.48  E-value=8.5  Score=25.68  Aligned_cols=10  Identities=40%  Similarity=0.767  Sum_probs=5.5

Q ss_pred             CCceeCCCCC
Q psy11070        115 SAPYMCDYKG  124 (148)
Q Consensus       115 ~k~~~C~~c~  124 (148)
                      +-|-.|++||
T Consensus       147 e~P~~CPiCg  156 (166)
T COG1592         147 EAPEVCPICG  156 (166)
T ss_pred             CCCCcCCCCC
Confidence            4455555555


No 89 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=56.28  E-value=12  Score=23.91  Aligned_cols=29  Identities=31%  Similarity=0.539  Sum_probs=16.5

Q ss_pred             CCCceeCCCcccccccCChHHHHHHHHHhcCCCc
Q psy11070         53 KQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLT   86 (148)
Q Consensus        53 ~~k~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~   86 (148)
                      .+.-..|-  .||+.|+.   |++|+..|.|-.|
T Consensus        69 ~~d~i~cl--ecGk~~k~---LkrHL~~~~gltp   97 (132)
T PF05443_consen   69 TPDYIICL--ECGKKFKT---LKRHLRTHHGLTP   97 (132)
T ss_dssp             -SS-EE-T--BT--EESB---HHHHHHHTT-S-H
T ss_pred             ccCeeEEc--cCCcccch---HHHHHHHccCCCH
Confidence            34447788  99998875   5889888866543


No 90 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=55.40  E-value=13  Score=18.80  Aligned_cols=9  Identities=22%  Similarity=0.246  Sum_probs=4.6

Q ss_pred             ceeCCCCCC
Q psy11070        117 PYMCDYKGV  125 (148)
Q Consensus       117 ~~~C~~c~~  125 (148)
                      +..|+.||.
T Consensus        19 ~irC~~CG~   27 (44)
T smart00659       19 VVRCRECGY   27 (44)
T ss_pred             ceECCCCCc
Confidence            345555553


No 91 
>KOG2231|consensus
Probab=55.36  E-value=25  Score=28.87  Aligned_cols=21  Identities=24%  Similarity=0.485  Sum_probs=13.6

Q ss_pred             ecCcCCcccccCChHHHHHHHHH
Q psy11070         88 CCEELGCGRKFQTMKQYSTHLKE  110 (148)
Q Consensus        88 ~c~~~~C~~~f~~~~~l~~h~~~  110 (148)
                      .|.  .|...|.....|..|++.
T Consensus       184 ~C~--~C~~~fld~~el~rH~~~  204 (669)
T KOG2231|consen  184 LCK--FCHERFLDDDELYRHLRF  204 (669)
T ss_pred             cch--hhhhhhccHHHHHHhhcc
Confidence            455  666667777677666653


No 92 
>KOG2593|consensus
Probab=54.63  E-value=18  Score=27.89  Aligned_cols=37  Identities=14%  Similarity=0.468  Sum_probs=24.4

Q ss_pred             CCCceecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCCC
Q psy11070         83 KPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGV  125 (148)
Q Consensus        83 ~~~~~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~  125 (148)
                      ....|.|+  .|.+.|.....++.   .-.. .--|.|..|+-
T Consensus       125 ~~~~Y~Cp--~C~kkyt~Lea~~L---~~~~-~~~F~C~~C~g  161 (436)
T KOG2593|consen  125 NVAGYVCP--NCQKKYTSLEALQL---LDNE-TGEFHCENCGG  161 (436)
T ss_pred             ccccccCC--ccccchhhhHHHHh---hccc-CceEEEecCCC
Confidence            45668888  88888887776642   1221 23588888874


No 93 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=54.46  E-value=7.6  Score=17.00  Aligned_cols=8  Identities=38%  Similarity=0.978  Sum_probs=4.7

Q ss_pred             ceeCCCCC
Q psy11070        117 PYMCDYKG  124 (148)
Q Consensus       117 ~~~C~~c~  124 (148)
                      .|.|+.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            46666665


No 94 
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=54.38  E-value=10  Score=24.17  Aligned_cols=13  Identities=23%  Similarity=0.690  Sum_probs=7.1

Q ss_pred             eeCCCcccccccCCh
Q psy11070         57 WSCPIKNCNKRFTTL   71 (148)
Q Consensus        57 ~~C~~~~C~~~f~~~   71 (148)
                      +.|.  .||+.|..-
T Consensus         2 H~Ct--~Cg~~f~dg   14 (131)
T PF09845_consen    2 HQCT--KCGRVFEDG   14 (131)
T ss_pred             cccC--cCCCCcCCC
Confidence            4555  666655543


No 95 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=53.84  E-value=17  Score=22.58  Aligned_cols=78  Identities=17%  Similarity=0.221  Sum_probs=42.2

Q ss_pred             CceeCCCcccccccCChHHHHHHHHHhc-CCCc------------eecCcCCcccccCChHHHHHHHHHhcCCCCceeCC
Q psy11070         55 QLWSCPIKNCNKRFTTLSNLKMHMVRHG-KPLT------------LCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCD  121 (148)
Q Consensus        55 k~~~C~~~~C~~~f~~~~~l~~h~~~h~-~~~~------------~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~  121 (148)
                      -|-.|+  .|+-+.-....|.+..- |. ..++            -.|-  .|...|........-  .-.. ...|.|.
T Consensus        14 LP~~Cp--iCgLtLVss~HLARSyH-HLfPl~~f~ev~~~~~~~~~~C~--~C~~~f~~~~~~~~~--~~~~-~~~y~C~   85 (112)
T TIGR00622        14 LPVECP--ICGLTLILSTHLARSYH-HLFPLKAFQEIPLEEYNGSRFCF--GCQGPFPKPPVSPFD--ELKD-SHRYVCA   85 (112)
T ss_pred             CCCcCC--cCCCEEeccchHHHhhh-ccCCCcccccccccccCCCCccc--CcCCCCCCccccccc--cccc-ccceeCC
Confidence            346777  88887777777654211 10 1111            1377  788888765321100  0112 3468899


Q ss_pred             CCCCCcccccHHHHHHHHHhh
Q psy11070        122 YKGVCMSLTLKISFVKAVANN  142 (148)
Q Consensus       122 ~c~~~~~f~~~~~l~~h~~~h  142 (148)
                      .|..  .|-..-+.-.|...|
T Consensus        86 ~C~~--~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        86 VCKN--VFCVDCDVFVHESLH  104 (112)
T ss_pred             CCCC--ccccccchhhhhhcc
Confidence            9987  455444555555444


No 96 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=53.09  E-value=12  Score=26.02  Aligned_cols=28  Identities=29%  Similarity=0.729  Sum_probs=21.3

Q ss_pred             CCCceeCCCcccccccCChHHHHHHHHH-hc
Q psy11070         53 KQQLWSCPIKNCNKRFTTLSNLKMHMVR-HG   82 (148)
Q Consensus        53 ~~k~~~C~~~~C~~~f~~~~~l~~h~~~-h~   82 (148)
                      ++..|.|.  .|+|.|+-......|+.. |.
T Consensus        74 ~~~K~~C~--lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   74 DEDKWRCP--LCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SSEEEEE---SSS-EESSHHHHHHHHHHH-H
T ss_pred             cCCEECCC--CCCcccCChHHHHHHHhhcCH
Confidence            44559999  999999999999999986 53


No 97 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=52.64  E-value=29  Score=26.16  Aligned_cols=77  Identities=19%  Similarity=0.446  Sum_probs=48.7

Q ss_pred             eCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcc----cccCChHHHHHHHHHhcCCCCceeCCC----CCCCccc
Q psy11070         58 SCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCG----RKFQTMKQYSTHLKEHSNVSAPYMCDY----KGVCMSL  129 (148)
Q Consensus        58 ~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~----~~f~~~~~l~~h~~~h~~~~k~~~C~~----c~~~~~f  129 (148)
                      .|.  .|...|.....|..|++.-. ++.+.|+  .-+    ..|..-..|-.|-+     .--|.|..    -|+-+.|
T Consensus       222 ~C~--FC~~~FYdDDEL~~HcR~~H-E~ChICD--~v~p~~~QYFK~Y~~Le~HF~-----~~hy~ct~qtc~~~k~~vf  291 (493)
T COG5236         222 LCI--FCKIYFYDDDELRRHCRLRH-EACHICD--MVGPIRYQYFKSYEDLEAHFR-----NAHYCCTFQTCRVGKCYVF  291 (493)
T ss_pred             hhh--hccceecChHHHHHHHHhhh-hhhhhhh--ccCccchhhhhCHHHHHHHhh-----cCceEEEEEEEecCcEEEe
Confidence            577  89999999999999988632 4555555  222    23455555655544     23355543    2344578


Q ss_pred             ccHHHHHHHHHhhCC
Q psy11070        130 TLKISFVKAVANNSK  144 (148)
Q Consensus       130 ~~~~~l~~h~~~h~~  144 (148)
                      .....|..|+-.-++
T Consensus       292 ~~~~el~~h~~~~h~  306 (493)
T COG5236         292 PYHTELLEHLTRFHK  306 (493)
T ss_pred             ccHHHHHHHHHHHhh
Confidence            888888888765444


No 98 
>KOG4377|consensus
Probab=52.48  E-value=5.4  Score=30.44  Aligned_cols=76  Identities=14%  Similarity=0.256  Sum_probs=51.5

Q ss_pred             CCCCceeCCCcccccccCChHHHHHHHHHhcCC------------CceecCcCCcccccCChHHHHHHHHHhcCC----C
Q psy11070         52 KKQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKP------------LTLCCEELGCGRKFQTMKQYSTHLKEHSNV----S  115 (148)
Q Consensus        52 ~~~k~~~C~~~~C~~~f~~~~~l~~h~~~h~~~------------~~~~c~~~~C~~~f~~~~~l~~h~~~h~~~----~  115 (148)
                      .+...|.|.-+.|+..+..+..+.+|...|...            ..|.|....|.+   .-++...|-..|+..    -
T Consensus       267 ~~rEhyhcl~e~C~ykr~~k~DvirH~~~hkkrdnsL~dgf~rfs~syhC~~~~C~k---sTsdV~~h~nFht~~~n~Gf  343 (480)
T KOG4377|consen  267 AGREHYHCLNEYCFYKRGQKNDVIRHVEIHKKRDNSLIDGFHRFSNSYHCTGQICEK---STSDVLLHDNFHTDKRNNGF  343 (480)
T ss_pred             ccchhhcccCccccccccchhhhHHHHHHHhhcccccccchhhcCccchhhhcccCc---ccccccccCccccccccCce
Confidence            345568898889998777788888998887532            225677667887   334455666666530    1


Q ss_pred             C--ceeCCCCCCCcccc
Q psy11070        116 A--PYMCDYKGVCMSLT  130 (148)
Q Consensus       116 k--~~~C~~c~~~~~f~  130 (148)
                      +  -|.|..||+++.|+
T Consensus       344 rrthfhC~r~gCTdtfK  360 (480)
T KOG4377|consen  344 RRTHFHCQRIGCTDTFK  360 (480)
T ss_pred             ecceeEEeccCCccccc
Confidence            2  36799999876776


No 99 
>KOG4167|consensus
Probab=50.73  E-value=3.9  Score=33.51  Aligned_cols=25  Identities=28%  Similarity=0.686  Sum_probs=22.8

Q ss_pred             ceeCCCcccccccCChHHHHHHHHHhc
Q psy11070         56 LWSCPIKNCNKRFTTLSNLKMHMVRHG   82 (148)
Q Consensus        56 ~~~C~~~~C~~~f~~~~~l~~h~~~h~   82 (148)
                      -|.|.  .|++.|....++..||+.|.
T Consensus       792 iFpCr--eC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCR--ECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehH--HHHHHHHHHhhhhHHHHHHH
Confidence            49999  99999999999999999985


No 100
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=49.83  E-value=3.4  Score=28.72  Aligned_cols=17  Identities=35%  Similarity=0.724  Sum_probs=12.0

Q ss_pred             CceeCCCcccccccCChHH
Q psy11070         55 QLWSCPIKNCNKRFTTLSN   73 (148)
Q Consensus        55 k~~~C~~~~C~~~f~~~~~   73 (148)
                      +...|+  .|++.|....-
T Consensus         4 k~~~CP--vC~~~F~~~~v   20 (214)
T PF09986_consen    4 KKITCP--VCGKEFKTKKV   20 (214)
T ss_pred             CceECC--CCCCeeeeeEE
Confidence            456788  88888876643


No 101
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=48.35  E-value=14  Score=19.26  Aligned_cols=11  Identities=36%  Similarity=0.960  Sum_probs=6.8

Q ss_pred             ceecCcCCccccc
Q psy11070         86 TLCCEELGCGRKF   98 (148)
Q Consensus        86 ~~~c~~~~C~~~f   98 (148)
                      .|.|.  .||+.|
T Consensus         6 ~Y~C~--~Cg~~~   16 (49)
T COG1996           6 EYKCA--RCGREV   16 (49)
T ss_pred             EEEhh--hcCCee
Confidence            35666  666666


No 102
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=45.40  E-value=54  Score=22.16  Aligned_cols=42  Identities=12%  Similarity=0.164  Sum_probs=26.6

Q ss_pred             hcCCCceecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCCCCcccccHHH
Q psy11070         81 HGKPLTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLTLKIS  134 (148)
Q Consensus        81 h~~~~~~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~f~~~~~  134 (148)
                      -++..-|.|+  .|...|+.-.+.          +..|.|+.||....+...+.
T Consensus       108 ~~~~~~y~C~--~~~~r~sfdeA~----------~~~F~Cp~Cg~~L~~~d~s~  149 (176)
T COG1675         108 ETENNYYVCP--NCHVKYSFDEAM----------ELGFTCPKCGEDLEEYDSSE  149 (176)
T ss_pred             hccCCceeCC--CCCCcccHHHHH----------HhCCCCCCCCchhhhccchH
Confidence            3455668998  887766655432          23389999997655544443


No 103
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=43.78  E-value=14  Score=23.75  Aligned_cols=25  Identities=28%  Similarity=0.389  Sum_probs=19.8

Q ss_pred             eeCCCcccccccCChHHHHHHHHHhcCCCc
Q psy11070         57 WSCPIKNCNKRFTTLSNLKMHMVRHGKPLT   86 (148)
Q Consensus        57 ~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~   86 (148)
                      ..|-  .+|+.|+   +|++|..+|.|--|
T Consensus        77 IicL--EDGkkfK---SLKRHL~t~~gmTP  101 (148)
T COG4957          77 IICL--EDGKKFK---SLKRHLTTHYGLTP  101 (148)
T ss_pred             EEEe--ccCcchH---HHHHHHhcccCCCH
Confidence            6788  9999885   48899998877554


No 104
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=42.96  E-value=21  Score=24.88  Aligned_cols=25  Identities=16%  Similarity=0.133  Sum_probs=16.7

Q ss_pred             CceeCCCCCCCcccccHHHHHHHHHhh
Q psy11070        116 APYMCDYKGVCMSLTLKISFVKAVANN  142 (148)
Q Consensus       116 k~~~C~~c~~~~~f~~~~~l~~h~~~h  142 (148)
                      -.|.|..|+|  .|+-..-..+|+..-
T Consensus        76 ~K~~C~lc~K--lFkg~eFV~KHI~nK  100 (214)
T PF04959_consen   76 DKWRCPLCGK--LFKGPEFVRKHIFNK  100 (214)
T ss_dssp             EEEEE-SSS---EESSHHHHHHHHHHH
T ss_pred             CEECCCCCCc--ccCChHHHHHHHhhc
Confidence            4578888886  677777777777653


No 105
>PHA00626 hypothetical protein
Probab=41.58  E-value=38  Score=18.21  Aligned_cols=13  Identities=15%  Similarity=0.434  Sum_probs=8.3

Q ss_pred             ceeCCCcccccccCC
Q psy11070         56 LWSCPIKNCNKRFTT   70 (148)
Q Consensus        56 ~~~C~~~~C~~~f~~   70 (148)
                      .|+|.  .||..|+.
T Consensus        23 rYkCk--dCGY~ft~   35 (59)
T PHA00626         23 DYVCC--DCGYNDSK   35 (59)
T ss_pred             ceEcC--CCCCeech
Confidence            46677  77766653


No 106
>KOG2186|consensus
Probab=41.39  E-value=24  Score=25.31  Aligned_cols=46  Identities=22%  Similarity=0.447  Sum_probs=34.2

Q ss_pred             eecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCCCCcccccHHHHHHHHH
Q psy11070         87 LCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSLTLKISFVKAVA  140 (148)
Q Consensus        87 ~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~f~~~~~l~~h~~  140 (148)
                      |.|.  .||....-+ .+-.|+..-.+  ..|.|.-||+  .|-+ ...+.|..
T Consensus         4 FtCn--vCgEsvKKp-~vekH~srCrn--~~fSCIDC~k--~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCN--VCGESVKKP-QVEKHMSRCRN--AYFSCIDCGK--TFER-VSYKNHTK   49 (276)
T ss_pred             Eehh--hhhhhcccc-chHHHHHhccC--CeeEEeeccc--cccc-chhhhhhh
Confidence            7798  999887766 45568876665  6799999998  4755 55667754


No 107
>KOG4167|consensus
Probab=41.12  E-value=6.9  Score=32.18  Aligned_cols=26  Identities=31%  Similarity=0.731  Sum_probs=23.3

Q ss_pred             ceecCcCCcccccCChHHHHHHHHHhcC
Q psy11070         86 TLCCEELGCGRKFQTMKQYSTHLKEHSN  113 (148)
Q Consensus        86 ~~~c~~~~C~~~f~~~~~l~~h~~~h~~  113 (148)
                      -|.|.  .|++.|.-...+..||++|.-
T Consensus       792 iFpCr--eC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  792 IFPCR--ECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eeehH--HHHHHHHHHhhhhHHHHHHHH
Confidence            38899  999999999999999999874


No 108
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=40.31  E-value=9.4  Score=26.21  Aligned_cols=23  Identities=26%  Similarity=0.401  Sum_probs=0.0

Q ss_pred             CCceeCCCCCCCcccccHHHHHHH
Q psy11070        115 SAPYMCDYKGVCMSLTLKISFVKA  138 (148)
Q Consensus       115 ~k~~~C~~c~~~~~f~~~~~l~~h  138 (148)
                      .+-|.|.+||- +.|..+-.+.+|
T Consensus        99 ~~ey~CEICGN-~~Y~GrkaFekH  121 (196)
T PF11931_consen   99 GVEYKCEICGN-QSYKGRKAFEKH  121 (196)
T ss_dssp             ------------------------
T ss_pred             CCeeeeEeCCC-cceecHHHHHHh
Confidence            45566666665 244444444444


No 109
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=40.28  E-value=36  Score=14.97  Aligned_cols=19  Identities=21%  Similarity=0.562  Sum_probs=10.3

Q ss_pred             eCCCcccccccCChHHHHHHHH
Q psy11070         58 SCPIKNCNKRFTTLSNLKMHMV   79 (148)
Q Consensus        58 ~C~~~~C~~~f~~~~~l~~h~~   79 (148)
                      .|+  .|++.+ ....+..|..
T Consensus         3 ~CP--iC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCP--VCFREV-PENLINSHLD   21 (26)
T ss_pred             cCC--CCcCcc-cHHHHHHHHH
Confidence            466  777666 3344455543


No 110
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=39.55  E-value=27  Score=24.10  Aligned_cols=41  Identities=15%  Similarity=0.233  Sum_probs=22.4

Q ss_pred             CcccccCChHHHHHHHHHhcCCCCceeCCCCCCCc--ccccHHHHHHHHH
Q psy11070         93 GCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCM--SLTLKISFVKAVA  140 (148)
Q Consensus        93 ~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~--~f~~~~~l~~h~~  140 (148)
                      .||..|...-++..-       .+--.|.+||++.  .|.-.+.|.+.+.
T Consensus       213 ~CGH~FC~~Cai~~y-------~kg~~C~~Cgk~t~G~f~V~~d~~kmL~  255 (259)
T COG5152         213 ECGHSFCSLCAIRKY-------QKGDECGVCGKATYGRFWVVSDLQKMLN  255 (259)
T ss_pred             hcchhHHHHHHHHHh-------ccCCcceecchhhccceeHHhhHHHHHh
Confidence            455555555444432       2234688888742  3555666666554


No 111
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=36.99  E-value=30  Score=18.52  Aligned_cols=34  Identities=15%  Similarity=0.336  Sum_probs=16.6

Q ss_pred             CceecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCCC
Q psy11070         85 LTLCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGV  125 (148)
Q Consensus        85 ~~~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~  125 (148)
                      .|....  .|+..|....-+.. +   .. .+...|++-|+
T Consensus        23 ~PV~s~--~C~H~fek~aI~~~-i---~~-~~~~~CPv~GC   56 (57)
T PF11789_consen   23 DPVKSK--KCGHTFEKEAILQY-I---QR-NGSKRCPVAGC   56 (57)
T ss_dssp             SEEEES--SS--EEEHHHHHHH-C---TT-TS-EE-SCCC-
T ss_pred             CCcCcC--CCCCeecHHHHHHH-H---Hh-cCCCCCCCCCC
Confidence            456666  77777776644332 2   22 45677877664


No 112
>PF14353 CpXC:  CpXC protein
Probab=36.80  E-value=55  Score=20.45  Aligned_cols=9  Identities=44%  Similarity=1.542  Sum_probs=5.1

Q ss_pred             eCCCccccccc
Q psy11070         58 SCPIKNCNKRF   68 (148)
Q Consensus        58 ~C~~~~C~~~f   68 (148)
                      .|+  .|+..|
T Consensus         3 tCP--~C~~~~   11 (128)
T PF14353_consen    3 TCP--HCGHEF   11 (128)
T ss_pred             CCC--CCCCee
Confidence            455  666554


No 113
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=35.69  E-value=8.7  Score=19.87  Aligned_cols=11  Identities=36%  Similarity=1.189  Sum_probs=5.8

Q ss_pred             eeCCCcccccccC
Q psy11070         57 WSCPIKNCNKRFT   69 (148)
Q Consensus        57 ~~C~~~~C~~~f~   69 (148)
                      |.|.  .|+..|.
T Consensus         6 y~C~--~Cg~~fe   16 (52)
T TIGR02605         6 YRCT--ACGHRFE   16 (52)
T ss_pred             EEeC--CCCCEeE
Confidence            4555  5555554


No 114
>KOG3408|consensus
Probab=34.75  E-value=29  Score=21.85  Aligned_cols=24  Identities=33%  Similarity=0.546  Sum_probs=18.6

Q ss_pred             CCceecCcCCcccccCChHHHHHHHH
Q psy11070         84 PLTLCCEELGCGRKFQTMKQYSTHLK  109 (148)
Q Consensus        84 ~~~~~c~~~~C~~~f~~~~~l~~h~~  109 (148)
                      ...|-|.  .|.+-|.....|..|.+
T Consensus        55 ~GqfyCi--~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   55 GGQFYCI--ECARYFIDAKALKTHFK   78 (129)
T ss_pred             Cceeehh--hhhhhhcchHHHHHHHh
Confidence            3447788  88888888888888876


No 115
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=34.20  E-value=39  Score=20.90  Aligned_cols=13  Identities=15%  Similarity=0.299  Sum_probs=6.9

Q ss_pred             CCceeCCCccccccc
Q psy11070         54 QQLWSCPIKNCNKRF   68 (148)
Q Consensus        54 ~k~~~C~~~~C~~~f   68 (148)
                      ..|..|+  .||++|
T Consensus        24 rdPiVsP--ytG~s~   36 (129)
T COG4530          24 RDPIVSP--YTGKSY   36 (129)
T ss_pred             CCccccC--cccccc
Confidence            3445555  555555


No 116
>KOG2636|consensus
Probab=34.02  E-value=31  Score=26.88  Aligned_cols=28  Identities=21%  Similarity=0.310  Sum_probs=21.8

Q ss_pred             HHhcCCCCceeCCCCCCCcccccHHHHHHH
Q psy11070        109 KEHSNVSAPYMCDYKGVCMSLTLKISFVKA  138 (148)
Q Consensus       109 ~~h~~~~k~~~C~~c~~~~~f~~~~~l~~h  138 (148)
                      +.|.- ..-|.|.+||. +++..+-.+.+|
T Consensus       394 KLHGL-~~ey~CEICGN-y~Y~GrkaF~RH  421 (497)
T KOG2636|consen  394 KLHGL-DIEYNCEICGN-YVYKGRKAFDRH  421 (497)
T ss_pred             hhcCC-CcccceeeccC-ccccCcHHHHHH
Confidence            55666 78899999995 467777777777


No 117
>KOG2593|consensus
Probab=33.86  E-value=37  Score=26.29  Aligned_cols=39  Identities=31%  Similarity=0.761  Sum_probs=27.0

Q ss_pred             CCCCceeCCCcccccccCChHHHHHHHHHhcCCCceecCcCCcccc
Q psy11070         52 KKQQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGRK   97 (148)
Q Consensus        52 ~~~k~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~   97 (148)
                      +...-|.|+  .|.+.|.....++   ..--....|.|.  .|+-.
T Consensus       124 t~~~~Y~Cp--~C~kkyt~Lea~~---L~~~~~~~F~C~--~C~ge  162 (436)
T KOG2593|consen  124 TNVAGYVCP--NCQKKYTSLEALQ---LLDNETGEFHCE--NCGGE  162 (436)
T ss_pred             cccccccCC--ccccchhhhHHHH---hhcccCceEEEe--cCCCc
Confidence            344569999  9999998777653   333234468898  88853


No 118
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=33.80  E-value=40  Score=17.71  Aligned_cols=21  Identities=29%  Similarity=0.597  Sum_probs=11.3

Q ss_pred             hHHHHHHHHHhcCCCCceeCCC
Q psy11070        101 MKQYSTHLKEHSNVSAPYMCDY  122 (148)
Q Consensus       101 ~~~l~~h~~~h~~~~k~~~C~~  122 (148)
                      ...|..|+..--. .++..|..
T Consensus        23 r~~l~~H~~~~C~-~~~v~C~~   43 (60)
T PF02176_consen   23 RKELDDHLENECP-KRPVPCPY   43 (60)
T ss_dssp             CCCHHHHHHTTST-TSEEE-SS
T ss_pred             HHHHHHHHHccCC-CCcEECCC
Confidence            3356666664444 45666766


No 119
>KOG4124|consensus
Probab=33.17  E-value=16  Score=27.51  Aligned_cols=53  Identities=9%  Similarity=-0.050  Sum_probs=38.4

Q ss_pred             CCCceeCCCcccccccCChHHHHHH-----HHHhcCCCceecCcCCcccccCChHHHHHHH
Q psy11070         53 KQQLWSCPIKNCNKRFTTLSNLKMH-----MVRHGKPLTLCCEELGCGRKFQTMKQYSTHL  108 (148)
Q Consensus        53 ~~k~~~C~~~~C~~~f~~~~~l~~h-----~~~h~~~~~~~c~~~~C~~~f~~~~~l~~h~  108 (148)
                      .|+++.|..+.|.+++........|     +...+-.+||+|+   |++++..+..|+.|-
T Consensus       175 EE~~~S~~vp~~~~~~~~~Ns~~~~S~~~~~T~~t~~~p~k~~---~~~~~~T~~~l~~HS  232 (442)
T KOG4124|consen  175 EEYRVSVVVPAAAAAAAAANSSDMSSDEASSTAETTGTPKKMP---ESLVMDTSSPLSDHS  232 (442)
T ss_pred             ccccccccCchhhhhhhccccccccccccccccccccCCccCc---ccccccccchhhhcc
Confidence            5788899888888877655444333     2333456889996   999999999988774


No 120
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=32.98  E-value=13  Score=30.81  Aligned_cols=14  Identities=21%  Similarity=0.332  Sum_probs=9.8

Q ss_pred             hcCCCCceeCCCCCC
Q psy11070        111 HSNVSAPYMCDYKGV  125 (148)
Q Consensus       111 h~~~~k~~~C~~c~~  125 (148)
                      |.. ..|..|+.||-
T Consensus       470 ~~~-~~p~~Cp~Cgs  483 (730)
T COG1198         470 YQE-PIPQSCPECGS  483 (730)
T ss_pred             CCC-CCCCCCCCCCC
Confidence            444 57788888885


No 121
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=32.31  E-value=7.7  Score=17.68  Aligned_cols=10  Identities=50%  Similarity=1.305  Sum_probs=6.1

Q ss_pred             eeCCCccccccc
Q psy11070         57 WSCPIKNCNKRF   68 (148)
Q Consensus        57 ~~C~~~~C~~~f   68 (148)
                      |.|.  .|++.|
T Consensus         1 ~sCi--DC~~~F   10 (28)
T PF08790_consen    1 FSCI--DCSKDF   10 (28)
T ss_dssp             EEET--TTTEEE
T ss_pred             Ceee--cCCCCc
Confidence            3456  666666


No 122
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=31.93  E-value=24  Score=17.09  Aligned_cols=10  Identities=30%  Similarity=0.541  Sum_probs=5.8

Q ss_pred             CceeCCCCCC
Q psy11070        116 APYMCDYKGV  125 (148)
Q Consensus       116 k~~~C~~c~~  125 (148)
                      +-|+|..||.
T Consensus         5 ~~YkC~~CGn   14 (36)
T PF06397_consen    5 EFYKCEHCGN   14 (36)
T ss_dssp             EEEE-TTT--
T ss_pred             cEEEccCCCC
Confidence            4689999995


No 123
>KOG2785|consensus
Probab=29.37  E-value=73  Score=24.32  Aligned_cols=22  Identities=23%  Similarity=0.632  Sum_probs=17.5

Q ss_pred             eeCCCcccccccCChHHHHHHHHH
Q psy11070         57 WSCPIKNCNKRFTTLSNLKMHMVR   80 (148)
Q Consensus        57 ~~C~~~~C~~~f~~~~~l~~h~~~   80 (148)
                      |+|.  -|...|.....-+.|+++
T Consensus         4 ftC~--tC~v~F~~ad~Qr~HyKS   25 (390)
T KOG2785|consen    4 FTCN--TCNVEFDDADEQRAHYKS   25 (390)
T ss_pred             ceee--ceeeeeccHHHHHHHhhh
Confidence            7788  888888888777777765


No 124
>KOG3002|consensus
Probab=29.30  E-value=1.2e+02  Score=22.48  Aligned_cols=85  Identities=20%  Similarity=0.343  Sum_probs=50.8

Q ss_pred             CCceeCCCcccccccCChHHHHHHHHHhcCCCceecC--cCCcccccCChHHHHHHHHHhcCCCCceeCCCCCCCccc-c
Q psy11070         54 QQLWSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCE--ELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSL-T  130 (148)
Q Consensus        54 ~k~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~--~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~f-~  130 (148)
                      +....|+  .|...+.....|.+-.....  ....|+  ..+|.+.|..-.. ..|.+.-..  +||.|+..|-...+ -
T Consensus        78 ~~~~~CP--~Cr~~~g~~R~~amEkV~e~--~~vpC~~~~~GC~~~~~Y~~~-~~HE~~C~f--~~~~CP~p~~~C~~~G  150 (299)
T KOG3002|consen   78 KVSNKCP--TCRLPIGNIRCRAMEKVAEA--VLVPCKNAKLGCTKSFPYGEK-SKHEKVCEF--RPCSCPVPGAECKYTG  150 (299)
T ss_pred             hhcccCC--ccccccccHHHHHHHHHHHh--ceecccccccCCceeeccccc-ccccccccc--CCcCCCCCcccCCccC
Confidence            4567889  89988886655433323222  233443  2268888887766 456655443  78888887321123 3


Q ss_pred             cHHHHHHHHHhhCCC
Q psy11070        131 LKISFVKAVANNSKY  145 (148)
Q Consensus       131 ~~~~l~~h~~~h~~~  145 (148)
                      ....|..|.+..++.
T Consensus       151 ~~~~l~~H~~~~hk~  165 (299)
T KOG3002|consen  151 SYKDLYAHLNDTHKS  165 (299)
T ss_pred             cHHHHHHHHHhhChh
Confidence            445788887765544


No 125
>KOG2482|consensus
Probab=29.00  E-value=36  Score=25.59  Aligned_cols=23  Identities=35%  Similarity=0.583  Sum_probs=21.1

Q ss_pred             ceeCCCcccccccCChHHHHHHHHH
Q psy11070         56 LWSCPIKNCNKRFTTLSNLKMHMVR   80 (148)
Q Consensus        56 ~~~C~~~~C~~~f~~~~~l~~h~~~   80 (148)
                      .+.|-  .|.+.|..+..|+.||+.
T Consensus       195 r~~CL--yCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  195 RLRCL--YCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             hheee--eeccccCCcHHHHHHHHh
Confidence            37899  999999999999999985


No 126
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=27.86  E-value=57  Score=27.30  Aligned_cols=15  Identities=27%  Similarity=0.806  Sum_probs=10.6

Q ss_pred             hcCCCceecCcCCcccc
Q psy11070         81 HGKPLTLCCEELGCGRK   97 (148)
Q Consensus        81 h~~~~~~~c~~~~C~~~   97 (148)
                      +....|..|+  .||..
T Consensus       470 ~~~~~p~~Cp--~Cgs~  484 (730)
T COG1198         470 YQEPIPQSCP--ECGSE  484 (730)
T ss_pred             CCCCCCCCCC--CCCCC
Confidence            3445678899  89864


No 127
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=27.63  E-value=34  Score=15.78  Aligned_cols=9  Identities=22%  Similarity=0.416  Sum_probs=4.5

Q ss_pred             CceeCCCCC
Q psy11070        116 APYMCDYKG  124 (148)
Q Consensus       116 k~~~C~~c~  124 (148)
                      ..|.|+.|+
T Consensus        18 ~~~vCp~C~   26 (30)
T PF08274_consen   18 ELLVCPECG   26 (30)
T ss_dssp             SSEEETTTT
T ss_pred             CEEeCCccc
Confidence            345555554


No 128
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=26.89  E-value=49  Score=17.26  Aligned_cols=7  Identities=29%  Similarity=0.558  Sum_probs=2.3

Q ss_pred             eCCCCCC
Q psy11070        119 MCDYKGV  125 (148)
Q Consensus       119 ~C~~c~~  125 (148)
                      .|+.|+.
T Consensus        22 ~CPlC~r   28 (54)
T PF04423_consen   22 CCPLCGR   28 (54)
T ss_dssp             E-TTT--
T ss_pred             cCCCCCC
Confidence            5555554


No 129
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=26.70  E-value=40  Score=15.80  Aligned_cols=8  Identities=38%  Similarity=0.713  Sum_probs=4.2

Q ss_pred             ceeCCCCC
Q psy11070        117 PYMCDYKG  124 (148)
Q Consensus       117 ~~~C~~c~  124 (148)
                      +..|..||
T Consensus        17 ~irC~~CG   24 (32)
T PF03604_consen   17 PIRCPECG   24 (32)
T ss_dssp             TSSBSSSS
T ss_pred             cEECCcCC
Confidence            34555555


No 130
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=26.56  E-value=85  Score=14.83  Aligned_cols=22  Identities=14%  Similarity=0.114  Sum_probs=11.8

Q ss_pred             ceeCCCCCCCcccccHHHHHHHHHh
Q psy11070        117 PYMCDYKGVCMSLTLKISFVKAVAN  141 (148)
Q Consensus       117 ~~~C~~c~~~~~f~~~~~l~~h~~~  141 (148)
                      -+.|+.|++   -...+.+-.|+..
T Consensus         4 ~~~C~nC~R---~v~a~RfA~HLek   25 (33)
T PF08209_consen    4 YVECPNCGR---PVAASRFAPHLEK   25 (33)
T ss_dssp             EEE-TTTSS---EEEGGGHHHHHHH
T ss_pred             eEECCCCcC---CcchhhhHHHHHH
Confidence            467888876   2334445556554


No 131
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=25.96  E-value=34  Score=16.37  Aligned_cols=12  Identities=25%  Similarity=1.007  Sum_probs=8.1

Q ss_pred             eeCCCcccccccCC
Q psy11070         57 WSCPIKNCNKRFTT   70 (148)
Q Consensus        57 ~~C~~~~C~~~f~~   70 (148)
                      |.|.  .||..|..
T Consensus         6 y~C~--~Cg~~fe~   17 (41)
T smart00834        6 YRCE--DCGHTFEV   17 (41)
T ss_pred             EEcC--CCCCEEEE
Confidence            6677  77776653


No 132
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=25.89  E-value=37  Score=15.02  Aligned_cols=11  Identities=36%  Similarity=0.921  Sum_probs=8.1

Q ss_pred             eeCCCcccccccC
Q psy11070         57 WSCPIKNCNKRFT   69 (148)
Q Consensus        57 ~~C~~~~C~~~f~   69 (148)
                      -.|+  .||..|.
T Consensus        15 ~~Cp--~CG~~F~   25 (26)
T PF10571_consen   15 KFCP--HCGYDFE   25 (26)
T ss_pred             CcCC--CCCCCCc
Confidence            4578  8888774


No 133
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=25.73  E-value=9.2  Score=25.18  Aligned_cols=16  Identities=44%  Similarity=0.908  Sum_probs=10.9

Q ss_pred             eeCCCcccccccCChHHH
Q psy11070         57 WSCPIKNCNKRFTTLSNL   74 (148)
Q Consensus        57 ~~C~~~~C~~~f~~~~~l   74 (148)
                      +.|+  .||++|.....+
T Consensus        29 ~~c~--~c~~~f~~~e~~   44 (154)
T PRK00464         29 RECL--ACGKRFTTFERV   44 (154)
T ss_pred             eecc--ccCCcceEeEec
Confidence            7777  777777665444


No 134
>KOG2071|consensus
Probab=25.19  E-value=49  Score=26.73  Aligned_cols=26  Identities=15%  Similarity=0.204  Sum_probs=0.0

Q ss_pred             CCceeCCCCCCCcccccHHHHHHHHHhh
Q psy11070        115 SAPYMCDYKGVCMSLTLKISFVKAVANN  142 (148)
Q Consensus       115 ~k~~~C~~c~~~~~f~~~~~l~~h~~~h  142 (148)
                      .+|-.|..||.  +|.......+|+..|
T Consensus       416 ~~pnqC~~CG~--R~~~~ee~sk~md~H  441 (579)
T KOG2071|consen  416 DSPNQCKSCGL--RFDDSEERSKHMDIH  441 (579)
T ss_pred             CCcchhccccc--ccccchhhhhHhhhh


No 135
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=24.86  E-value=69  Score=25.26  Aligned_cols=26  Identities=35%  Similarity=0.889  Sum_probs=22.6

Q ss_pred             ceeCCCcccccccCChHHHHHHHHH-hcC
Q psy11070         56 LWSCPIKNCNKRFTTLSNLKMHMVR-HGK   83 (148)
Q Consensus        56 ~~~C~~~~C~~~f~~~~~l~~h~~~-h~~   83 (148)
                      -+.|+  .|.+.|.....+..|+.. |.+
T Consensus        57 FWiCp--~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   57 FWICP--RCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             EeeCC--cccceeCCHHHHHHHHHHhhhh
Confidence            47899  999999999999999985 654


No 136
>KOG4727|consensus
Probab=23.75  E-value=49  Score=22.24  Aligned_cols=22  Identities=23%  Similarity=0.480  Sum_probs=16.7

Q ss_pred             ceeCCCCCCCcccccHHHHHHHHH
Q psy11070        117 PYMCDYKGVCMSLTLKISFVKAVA  140 (148)
Q Consensus       117 ~~~C~~c~~~~~f~~~~~l~~h~~  140 (148)
                      .|-|.+|++  .|....++-.|+.
T Consensus        75 GyyCdVCdc--vvKDSinflDHiN   96 (193)
T KOG4727|consen   75 GYYCDVCDC--VVKDSINFLDHIN   96 (193)
T ss_pred             ceeeeecce--eehhhHHHHHHhc
Confidence            489999998  5877777766653


No 137
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=23.13  E-value=27  Score=19.85  Aligned_cols=6  Identities=33%  Similarity=1.043  Sum_probs=2.5

Q ss_pred             Cccccc
Q psy11070         93 GCGRKF   98 (148)
Q Consensus        93 ~C~~~f   98 (148)
                      .||..|
T Consensus        34 eCg~tF   39 (72)
T PRK09678         34 NCSATF   39 (72)
T ss_pred             CCCCEE
Confidence            344444


No 138
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=22.59  E-value=42  Score=20.01  Aligned_cols=14  Identities=21%  Similarity=0.546  Sum_probs=8.2

Q ss_pred             CceeCCCcccccccCC
Q psy11070         55 QLWSCPIKNCNKRFTT   70 (148)
Q Consensus        55 k~~~C~~~~C~~~f~~   70 (148)
                      +|-.|.  .||..|..
T Consensus        57 ~Pa~Ck--kCGfef~~   70 (97)
T COG3357          57 RPARCK--KCGFEFRD   70 (97)
T ss_pred             cChhhc--ccCccccc
Confidence            345566  66666654


No 139
>KOG0801|consensus
Probab=22.27  E-value=19  Score=23.95  Aligned_cols=20  Identities=20%  Similarity=0.368  Sum_probs=15.0

Q ss_pred             HHHHHHHHHhcCCCCceeCCCCCC
Q psy11070        102 KQYSTHLKEHSNVSAPYMCDYKGV  125 (148)
Q Consensus       102 ~~l~~h~~~h~~~~k~~~C~~c~~  125 (148)
                      ..|..|+..|.|    ++|++|.|
T Consensus       127 ~slP~hi~~~~g----~KCPvC~K  146 (205)
T KOG0801|consen  127 DSLPVHIMDHSG----MKCPVCHK  146 (205)
T ss_pred             hccceeeeccCC----ccCCcccc
Confidence            456667767777    78999997


No 140
>KOG2482|consensus
Probab=21.83  E-value=58  Score=24.56  Aligned_cols=22  Identities=23%  Similarity=0.561  Sum_probs=20.3

Q ss_pred             ceecCcCCcccccCChHHHHHHHH
Q psy11070         86 TLCCEELGCGRKFQTMKQYSTHLK  109 (148)
Q Consensus        86 ~~~c~~~~C~~~f~~~~~l~~h~~  109 (148)
                      .+.|.  .|.+.|..+..|+.|||
T Consensus       195 r~~CL--yCekifrdkntLkeHMr  216 (423)
T KOG2482|consen  195 RLRCL--YCEKIFRDKNTLKEHMR  216 (423)
T ss_pred             hheee--eeccccCCcHHHHHHHH
Confidence            37799  99999999999999997


No 141
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=21.57  E-value=6.3  Score=32.55  Aligned_cols=60  Identities=22%  Similarity=0.511  Sum_probs=38.3

Q ss_pred             eCCCcccccccCChHHHHHHHHHhcCCCc-eecCcCCcccccCChHHHHHHHHHhcCCCCceeCCCCCCCccc
Q psy11070         58 SCPIKNCNKRFTTLSNLKMHMVRHGKPLT-LCCEELGCGRKFQTMKQYSTHLKEHSNVSAPYMCDYKGVCMSL  129 (148)
Q Consensus        58 ~C~~~~C~~~f~~~~~l~~h~~~h~~~~~-~~c~~~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~f  129 (148)
                      .|.  .||.+|.....|..- +.++.-.. -.|+  .|.+.|..+.+.    |.|   -.+-.|..||-...+
T Consensus        92 nCt--~CGPr~~i~~~lpyd-r~~t~m~~f~~C~--~C~~ey~~p~~r----r~h---~~~~~C~~Cgp~l~l  152 (711)
T TIGR00143        92 SCT--HCGPRFTIIEALPYD-RENTSMADFPLCP--DCAKEYKDPLDR----RFH---AQPIACPRCGPQLNF  152 (711)
T ss_pred             ccc--CCCCCeEEeecCCCC-CCCcCCCCCcCCH--HHHHHhcCCccc----cCC---CCCccCCCCCcEEEE
Confidence            488  999999877665422 22333322 3588  888888777543    333   356789999964444


No 142
>COG1773 Rubredoxin [Energy production and conversion]
Probab=21.21  E-value=51  Score=17.67  Aligned_cols=10  Identities=20%  Similarity=0.491  Sum_probs=6.8

Q ss_pred             CceeCCCCCC
Q psy11070        116 APYMCDYKGV  125 (148)
Q Consensus       116 k~~~C~~c~~  125 (148)
                      +.|+|..||.
T Consensus         2 ~~~~C~~CG~   11 (55)
T COG1773           2 KRWRCSVCGY   11 (55)
T ss_pred             CceEecCCce
Confidence            3577888874


No 143
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=21.10  E-value=60  Score=23.27  Aligned_cols=12  Identities=33%  Similarity=1.157  Sum_probs=8.6

Q ss_pred             eeCCCcccccccCC
Q psy11070         57 WSCPIKNCNKRFTT   70 (148)
Q Consensus        57 ~~C~~~~C~~~f~~   70 (148)
                      |.|+  .|+..|.-
T Consensus       156 f~C~--~C~h~F~G  167 (278)
T PF15135_consen  156 FHCP--KCRHNFRG  167 (278)
T ss_pred             eecc--cccccchh
Confidence            7777  77777753


No 144
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=21.00  E-value=57  Score=15.13  Aligned_cols=10  Identities=30%  Similarity=0.637  Sum_probs=8.2

Q ss_pred             CceeCCCCCC
Q psy11070        116 APYMCDYKGV  125 (148)
Q Consensus       116 k~~~C~~c~~  125 (148)
                      +-|+|..||.
T Consensus         6 ~~ykC~~Cgn   15 (34)
T TIGR00319         6 QVYKCEVCGN   15 (34)
T ss_pred             cEEEcCCCCc
Confidence            4689999985


No 145
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=20.96  E-value=47  Score=16.41  Aligned_cols=29  Identities=24%  Similarity=0.744  Sum_probs=16.0

Q ss_pred             eeCCCcccccccCChHHHHHHHHHhcCCCceecCcCCccc
Q psy11070         57 WSCPIKNCNKRFTTLSNLKMHMVRHGKPLTLCCEELGCGR   96 (148)
Q Consensus        57 ~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~   96 (148)
                      |.|.  .||..|.....+      .. ..+-.|+  .||.
T Consensus         6 y~C~--~Cg~~fe~~~~~------~~-~~~~~CP--~Cg~   34 (42)
T PF09723_consen    6 YRCE--ECGHEFEVLQSI------SE-DDPVPCP--ECGS   34 (42)
T ss_pred             EEeC--CCCCEEEEEEEc------CC-CCCCcCC--CCCC
Confidence            6677  777776543221      11 3345677  6765


No 146
>PF03145 Sina:  Seven in absentia protein family;  InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non-neuronal cell type. The Sina protein contains an N-terminal RING finger domain C3HC4-type. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologues of Sina have also been identified. The human homologue Siah-1 [] also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation [, ]. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is a C3HC4-type, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologues, whose similarity was noted previously, this family also includes putative homologues from Caenorhabditis elegans, Arabidopsis thaliana.; GO: 0006511 ubiquitin-dependent protein catabolic process, 0007275 multicellular organismal development, 0005634 nucleus; PDB: 2A25_A 1K2F_B 2AN6_C.
Probab=20.93  E-value=85  Score=21.29  Aligned_cols=7  Identities=29%  Similarity=0.586  Sum_probs=3.3

Q ss_pred             HHHHHHH
Q psy11070        103 QYSTHLK  109 (148)
Q Consensus       103 ~l~~h~~  109 (148)
                      .|..|..
T Consensus        62 ~l~~Hl~   68 (198)
T PF03145_consen   62 ELLDHLR   68 (198)
T ss_dssp             CHHHHHH
T ss_pred             HHHHHHH
Confidence            4445544


No 147
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=20.87  E-value=58  Score=15.15  Aligned_cols=10  Identities=30%  Similarity=0.657  Sum_probs=8.1

Q ss_pred             CceeCCCCCC
Q psy11070        116 APYMCDYKGV  125 (148)
Q Consensus       116 k~~~C~~c~~  125 (148)
                      +-|+|..||.
T Consensus         3 ~~ykC~~CGn   12 (34)
T cd00974           3 EVYKCEICGN   12 (34)
T ss_pred             cEEEcCCCCc
Confidence            4689999995


No 148
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=20.06  E-value=42  Score=21.90  Aligned_cols=13  Identities=23%  Similarity=0.181  Sum_probs=7.6

Q ss_pred             eeCCCCCCCccccc
Q psy11070        118 YMCDYKGVCMSLTL  131 (148)
Q Consensus       118 ~~C~~c~~~~~f~~  131 (148)
                      -.|+.||.. .|.+
T Consensus       131 ~~Cp~C~~~-~F~R  143 (146)
T PF07295_consen  131 PPCPKCGHT-EFTR  143 (146)
T ss_pred             CCCCCCCCC-eeee
Confidence            367777763 4543


Done!