Diaphorina citri psyllid: psy11078


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80------
MAATGNPNVNTRFLQAHGDCDPIVPYMWGQLTSSLLKGFVKNVTFNTYSGLQHSSNPELKQVSTRLENRALSGNIMETGKVTSTQQ
ccccccccccccEEEcccccccccccHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHccccccccccccccccc
******PNVNTRFLQAHGDCDPIVPYMWGQLTSSLLKGFVKNVTFNTYSGLQHSSNPELKQVSTRLENRAL***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAATGNPNVNTRFLQAHGDCDPIVPYMWGQLTSSLLKGFVKNVTFNTYSGLQHSSNPELKQVSTRLENRALSGNIMETGKVTSTQQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Acyl-protein thioesterase 1 Hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has depalmitoylating activity and also low lysophospholipase activity.confidentP70470
Acyl-protein thioesterase 1 Hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has depalmitoylating activity and also low lysophospholipase activity.confidentP97823
Acyl-protein thioesterase 1 Hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has depalmitoylating activity and also low lysophospholipase activity.confidentQ3MHR0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004091 [MF]carboxylesterase activityprobableGO:0016787, GO:0003674, GO:0016788, GO:0052689, GO:0003824
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0008152 [BP]metabolic processprobableGO:0008150
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0004622 [MF]lysophospholipase activityprobableGO:0016787, GO:0016788, GO:0003824, GO:0003674, GO:0052689, GO:0004620, GO:0016298

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FJ2, chain A
Confidence level:very confident
Coverage over the Query: 7-72
View the alignment between query and template
View the model in PyMOL